NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568937099|ref|XP_006530343|]
View 

T-box transcription factor TBX5 isoform X2 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
T-box_TBX4_5-like cd20189
DNA-binding domain of T-box transcription factor 4 and 5, and related T-box proteins; This ...
54-238 1.18e-142

DNA-binding domain of T-box transcription factor 4 and 5, and related T-box proteins; This subfamily includes the T-box transcription factors TBX4 and TBX5 which play important roles in vertebrate limb and heart development, and in lung and trachea development. TBX4 is needed for normal skeletal and muscular hindlimb development and is involved in super-enhancer-driven transcriptional programs underlying features specific to lung fibroblasts. TBX5 plays a role in regulating cardiac conduction system function, and in coordinating forelimb muscle pattern. Mutations in human TBX5 and TBX4 are associated with Holt-Oram syndrome and Small Patella syndrome, respectively. Both syndromes are characterized by limb defects in addition to other abnormalities. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


:

Pssm-ID: 410315  Cd Length: 185  Bit Score: 407.59  E-value: 1.18e-142
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:cd20189    1 IKVFLENRELWQKFHEVGTEMIITKAGRRMFPSIKVKVTGLNPKTKYILLMDIVPADDHRYKFHDSEWVVAGKAEPAMPG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIA 213
Cdd:cd20189   81 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDQFGHIILNSMHKYQPRIHIVQADDNNAFGSKNTAFSTHVFPETAFIA 160
                        170       180
                 ....*....|....*....|....*
gi 568937099 214 VTSYQNHKITQLKIENNPFAKGFRG 238
Cdd:cd20189  161 VTAYQNHQITQLKIENNPFAKGFRG 185
 
Name Accession Description Interval E-value
T-box_TBX4_5-like cd20189
DNA-binding domain of T-box transcription factor 4 and 5, and related T-box proteins; This ...
54-238 1.18e-142

DNA-binding domain of T-box transcription factor 4 and 5, and related T-box proteins; This subfamily includes the T-box transcription factors TBX4 and TBX5 which play important roles in vertebrate limb and heart development, and in lung and trachea development. TBX4 is needed for normal skeletal and muscular hindlimb development and is involved in super-enhancer-driven transcriptional programs underlying features specific to lung fibroblasts. TBX5 plays a role in regulating cardiac conduction system function, and in coordinating forelimb muscle pattern. Mutations in human TBX5 and TBX4 are associated with Holt-Oram syndrome and Small Patella syndrome, respectively. Both syndromes are characterized by limb defects in addition to other abnormalities. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410315  Cd Length: 185  Bit Score: 407.59  E-value: 1.18e-142
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:cd20189    1 IKVFLENRELWQKFHEVGTEMIITKAGRRMFPSIKVKVTGLNPKTKYILLMDIVPADDHRYKFHDSEWVVAGKAEPAMPG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIA 213
Cdd:cd20189   81 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDQFGHIILNSMHKYQPRIHIVQADDNNAFGSKNTAFSTHVFPETAFIA 160
                        170       180
                 ....*....|....*....|....*
gi 568937099 214 VTSYQNHKITQLKIENNPFAKGFRG 238
Cdd:cd20189  161 VTAYQNHQITQLKIENNPFAKGFRG 185
T-box pfam00907
T-box; The T-box encodes a 180 amino acid domain that binds to DNA. Genes encoding T-box ...
56-237 1.81e-120

T-box; The T-box encodes a 180 amino acid domain that binds to DNA. Genes encoding T-box proteins are found in a wide range of animals, but not in other kingdoms such as plants. Family members are all thought to bind to the DNA consensus sequence TCACACCT. they are found exclusively in the nucleus, and perform DNA-binding and transcriptional activation/repression roles. They are generally required for development of the specific tissues they are expressed in, and mutations in T-box genes are implicated in human conditions such as DiGeorge syndrome and X-linked cleft palate, which feature malformations.


Pssm-ID: 395727  Cd Length: 182  Bit Score: 351.10  E-value: 1.81e-120
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099   56 VFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRL 135
Cdd:pfam00907   1 VSLENKELWKKFHELGTEMIITKSGRRMFPTLKVSVSGLDPNALYSVLLDIVPVDDKRYKFHNGKWVVAGKAEPHSPPRV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  136 YVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTaFCTHVFPETAFIAVT 215
Cdd:pfam00907  81 YIHPDSPATGEHWMKQPVSFDKLKLTNNKSDKNGHIILNSMHKYQPRLHIVRVGGDRPPLPEEN-VKTFSFPETEFIAVT 159
                         170       180
                  ....*....|....*....|..
gi 568937099  216 SYQNHKITQLKIENNPFAKGFR 237
Cdd:pfam00907 160 AYQNEEITQLKIDNNPFAKGFR 181
TBOX smart00425
Domain first found in the mice T locus (Brachyury) protein;
54-237 9.81e-113

Domain first found in the mice T locus (Brachyury) protein;


Pssm-ID: 214656  Cd Length: 190  Bit Score: 331.54  E-value: 9.81e-113
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099    54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:smart00425   1 IKVSLEDKELWRKFHELGTEMIVTKSGRRMFPTLKYKVSGLDPNALYSVLMDLVPVDDKRYKFNNGKWVVAGKAEPHMPS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099   134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGH--IILNSMHKYQPRLHIVKADENNGFgsKNTAFCTHVFPETAF 211
Cdd:smart00425  81 RVYVHPDSPATGAHWMKQPVSFDKVKLTNNQSDKNGHlqIILNSMHKYQPRLHIVEVDDISKE--ILSQFKTFVFPETQF 158
                          170       180
                   ....*....|....*....|....*.
gi 568937099   212 IAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:smart00425 159 IAVTAYQNQKITKLKIDNNPFAKGFR 184
 
Name Accession Description Interval E-value
T-box_TBX4_5-like cd20189
DNA-binding domain of T-box transcription factor 4 and 5, and related T-box proteins; This ...
54-238 1.18e-142

DNA-binding domain of T-box transcription factor 4 and 5, and related T-box proteins; This subfamily includes the T-box transcription factors TBX4 and TBX5 which play important roles in vertebrate limb and heart development, and in lung and trachea development. TBX4 is needed for normal skeletal and muscular hindlimb development and is involved in super-enhancer-driven transcriptional programs underlying features specific to lung fibroblasts. TBX5 plays a role in regulating cardiac conduction system function, and in coordinating forelimb muscle pattern. Mutations in human TBX5 and TBX4 are associated with Holt-Oram syndrome and Small Patella syndrome, respectively. Both syndromes are characterized by limb defects in addition to other abnormalities. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410315  Cd Length: 185  Bit Score: 407.59  E-value: 1.18e-142
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:cd20189    1 IKVFLENRELWQKFHEVGTEMIITKAGRRMFPSIKVKVTGLNPKTKYILLMDIVPADDHRYKFHDSEWVVAGKAEPAMPG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIA 213
Cdd:cd20189   81 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDQFGHIILNSMHKYQPRIHIVQADDNNAFGSKNTAFSTHVFPETAFIA 160
                        170       180
                 ....*....|....*....|....*
gi 568937099 214 VTSYQNHKITQLKIENNPFAKGFRG 238
Cdd:cd20189  161 VTAYQNHQITQLKIENNPFAKGFRG 185
T-box pfam00907
T-box; The T-box encodes a 180 amino acid domain that binds to DNA. Genes encoding T-box ...
56-237 1.81e-120

T-box; The T-box encodes a 180 amino acid domain that binds to DNA. Genes encoding T-box proteins are found in a wide range of animals, but not in other kingdoms such as plants. Family members are all thought to bind to the DNA consensus sequence TCACACCT. they are found exclusively in the nucleus, and perform DNA-binding and transcriptional activation/repression roles. They are generally required for development of the specific tissues they are expressed in, and mutations in T-box genes are implicated in human conditions such as DiGeorge syndrome and X-linked cleft palate, which feature malformations.


Pssm-ID: 395727  Cd Length: 182  Bit Score: 351.10  E-value: 1.81e-120
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099   56 VFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRL 135
Cdd:pfam00907   1 VSLENKELWKKFHELGTEMIITKSGRRMFPTLKVSVSGLDPNALYSVLLDIVPVDDKRYKFHNGKWVVAGKAEPHSPPRV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  136 YVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTaFCTHVFPETAFIAVT 215
Cdd:pfam00907  81 YIHPDSPATGEHWMKQPVSFDKLKLTNNKSDKNGHIILNSMHKYQPRLHIVRVGGDRPPLPEEN-VKTFSFPETEFIAVT 159
                         170       180
                  ....*....|....*....|..
gi 568937099  216 SYQNHKITQLKIENNPFAKGFR 237
Cdd:pfam00907 160 AYQNEEITQLKIDNNPFAKGFR 181
TBOX smart00425
Domain first found in the mice T locus (Brachyury) protein;
54-237 9.81e-113

Domain first found in the mice T locus (Brachyury) protein;


Pssm-ID: 214656  Cd Length: 190  Bit Score: 331.54  E-value: 9.81e-113
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099    54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:smart00425   1 IKVSLEDKELWRKFHELGTEMIVTKSGRRMFPTLKYKVSGLDPNALYSVLMDLVPVDDKRYKFNNGKWVVAGKAEPHMPS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099   134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGH--IILNSMHKYQPRLHIVKADENNGFgsKNTAFCTHVFPETAF 211
Cdd:smart00425  81 RVYVHPDSPATGAHWMKQPVSFDKVKLTNNQSDKNGHlqIILNSMHKYQPRLHIVEVDDISKE--ILSQFKTFVFPETQF 158
                          170       180
                   ....*....|....*....|....*.
gi 568937099   212 IAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:smart00425 159 IAVTAYQNQKITKLKIDNNPFAKGFR 184
T-box_TBX2_3-like cd20188
DNA-binding domain of T-box transcription factor 2 and 3, and related T-box proteins; This ...
52-237 5.53e-109

DNA-binding domain of T-box transcription factor 2 and 3, and related T-box proteins; This subfamily includes the T-box transcription factors TBX2 and TBX3 and similar proteins. TBX2 is an oncogenic transcription factor implicated in developmental processes, including coordinating cell fate, patterning and morphogenesis of a wide range of tissues and organs. It is overexpressed in several cancers, including melanoma and breast, and plays a key role during cardiac development. TBX2 is a negative regulator of promyelocytic leukemia protein (PML) function in cellular senescence, and it interacts with HP1 to recruit a repression complex to EGR1-responsive promoters to drive the proliferation of breast cancer cells. TBX3 has also been implicated in oncogenesis in breast cancer and melanoma. The tbx3 gene is downregulated by PML. TBX3 directly represses TBX2 under the control of the PRC2 complex in skeletal muscle and rhabdomyosarcoma. Also included in this family is the Drosophila melanogaster optomotor-blind protein (Omb, also known as lethal(1)optomotor-blind, or L(1)omb, or protein bifid) which controls many developmental processes such as wing, eye, and abdominal tergites and optic lobes, and induces epithelial cell migration and extrusion in vivo. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410314  Cd Length: 185  Bit Score: 322.07  E-value: 5.53e-109
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  52 EGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAM 131
Cdd:cd20188    1 DDPKVELEAKDLWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEM 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 132 PGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKAdeNNGFGSKNTAFCTHVFPETAF 211
Cdd:cd20188   81 PKRMYIHPDSPSTGEQWMQKVVSFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRA--NDILKLPYSTFRTYVFKETEF 158
                        170       180
                 ....*....|....*....|....*.
gi 568937099 212 IAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20188  159 IAVTAYQNEKITQLKIDNNPFAKGFR 184
T-box_VegT-like cd20197
DNA-binding domain of Xenopus VegT and related T-box proteins; VegT, (also known as Antipodean, ...
54-237 4.09e-99

DNA-binding domain of Xenopus VegT and related T-box proteins; VegT, (also known as Antipodean, Brat and Xombi), is a T-box transcription factor required in early Xenopus embryos for the formation of both, the mesoderm and endoderm germ layers. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410323  Cd Length: 183  Bit Score: 296.75  E-value: 4.09e-99
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:cd20197    1 VRASLEDQDLWKKFHQIGTEMIITKSGRRMFPQCKIRVSGLLPYAKYVMLVDFVPVDNFRYKWNKDQWEVAGKAEPQPPC 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENngFGSKNTAFCTHVFPETAFIA 213
Cdd:cd20197   81 RTYVHPDSPAPGSHWMKQPISFQKLKLTNNTLDQHGHIILHSMHRYQPRFHIVQADDL--FNVRWSLFQVFSFPETVFTA 158
                        170       180
                 ....*....|....*....|....
gi 568937099 214 VTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20197  159 VTAYQNEKITKLKIDNNPFAKGFR 182
T-box_TBX1_10-like cd20187
DNA-binding domain of T-box transcription factor 1 and 10, and related T-box proteifactors; ...
53-237 2.10e-98

DNA-binding domain of T-box transcription factor 1 and 10, and related T-box proteifactors; This subfamily includes TBX1 and TBX10. TBX1 is a T-box transcription factor which plays an important role in heart development and has been implicated in DiGeorge or 22q11.2 deletion syndrome. This syndrome is associated with various types of cardiac outflow tract (OFT) and vascular defects. Wnt5a is regulated by TBX1 in the second heart field (SHF). TBX1 is required to maintain the integrity of extracellular matrix-cell interactions in the SHF and this interaction is critical for cardiac (OFT) development. TBX10 is a putative T-box transcription factor. Diseases associated with TBX10 include Isolated Cleft Lip and Cleft Lip/cleft lip with or without cleft palate. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410313  Cd Length: 189  Bit Score: 295.10  E-value: 2.10e-98
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  53 GIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFA--DNKWSVTGKAEPA 130
Cdd:cd20187    1 NVTVQLEMKALWDEFNQLGTEMIVTKAGRRMFPTFQVKIFGMDPMADYMLMMDFVPVDDKRYRYAfhSSSWLVAGKADPA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 131 MPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTA-FCTHVFPET 209
Cdd:cd20187   81 MPGRIHVHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVYVDPRKDSENSAEEnFKTFIFPET 160
                        170       180
                 ....*....|....*....|....*...
gi 568937099 210 AFIAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20187  161 KFTAVTAYQNHRITQLKIASNPFAKGFR 188
T-box_TBX20-like cd20193
DNA-binding domain of T-box transcription factor 20 and related T-box proteins; TBX20 is a ...
54-239 6.46e-98

DNA-binding domain of T-box transcription factor 20 and related T-box proteins; TBX20 is a T-box transcriptional factor which functions in embryonic development and its deficiency is associated with congenital heart disease. It acts both as a transcriptional activator and a repressor required for cardiac development, and has key roles in maintaining the functional and structural phenotypes in the adult heart. The TBX20-cardiac transcription factor CASZ1 protein complex is protective against dilated cardiomyopathy and is essential for maintaining cardiac homeostasis. TBX20 has also been shown to regulate angiogenesis through the PROK2-PROKR1 (prokineticin receptor 1) pathway and is involved in both, pathological and developmental, angiogenesis. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410319  Cd Length: 190  Bit Score: 293.95  E-value: 6.46e-98
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNK--WSVTGKAEPAM 131
Cdd:cd20193    1 VQCHLETKELWDKFHELGTEMIITKSGRRMFPTVRVSFSGVDPDAKYIVLMDIVPVDNKRYRYAYHRssWLVAGKADPPL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 132 PGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSK--NTAFCTHVFPET 209
Cdd:cd20193   81 PARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDKHGHIILNSMHKYQPRVHIVKKKDHTASLVNlkSEEFRTFIFPET 160
                        170       180       190
                 ....*....|....*....|....*....|
gi 568937099 210 AFIAVTSYQNHKITQLKIENNPFAKGFRGS 239
Cdd:cd20193  161 VFTAVTAYQNQLITKLKIDSNPFAKGFRDS 190
T-box cd00182
DNA-binding domain of the T-box transcription factor family; The T-box family is an ancient ...
54-230 1.10e-92

DNA-binding domain of the T-box transcription factor family; The T-box family is an ancient family of transcription factors which plays a multitude of diverse functions throughout development. The founding member of the family is Brachyury (also known as TBXT, or T). Members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns. The T-box factors in Caenorhabditis elegans have evolved very differently than those in other organisms; its genome contains 22 T-box genes which encode factors which are diverse in DNA-binding specificity, function and sequence, and only 3 of these factors fall into the conserved T-box subfamilies.


Pssm-ID: 410312  Cd Length: 176  Bit Score: 279.86  E-value: 1.10e-92
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAM-P 132
Cdd:cd00182    1 ITVSLRNEELWKKFHELGTEMIVTKSGRRMFPTLEYSVSGLDPNKLYSVSLHFERVDNKRYKFNNGKWVPSGKAEPPPeP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 133 GRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLD-PFGHIILNSMHKYQPRLHIVKADENngfGSKNTAFCTHVFPETAF 211
Cdd:cd00182   81 SRIYVHPDGPQTGSFWMKKGVSFDKVKITNNKEDkKEGHILLHSMHKYIPVLTIYEVDDN---GLLSKLVKEFRFPETEF 157
                        170
                 ....*....|....*....
gi 568937099 212 IAVTSYQNHKITQLKIENN 230
Cdd:cd00182  158 IAVTAYQNDEITQLKIDNN 176
T-box_Drosocross-like cd20681
DNA-binding domain of Drosophila Dorsocross and related T-box proteins; Drosophila Dorsocross ...
54-237 4.20e-92

DNA-binding domain of Drosophila Dorsocross and related T-box proteins; Drosophila Dorsocross (Doc) includes three Dorsocross paralogs, Doc1-3. These are key cardiogenic T-box transcription factors during specification and differentiation of heart cells. Drosophila Doc also functions in caudal visceral mesoderm development, and modulates Notch signaling in the developing Drosophila eye by regulating the expression of Delta in the eye imaginal discs. Doc also functions in the morphogenesis of epithelial tissues: in Drosophila, which possesses a single extraembryonic (EE) membrane, it is essential for EE epithelia tissue maintenance while in Tribolium castaneum, which has 2 EE membranes, Doc plays a major role in EE morphogenetic events throughout development without affecting EE tissue specificity or maintenance. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410332  Cd Length: 186  Bit Score: 278.83  E-value: 4.20e-92
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNK-WSVTGKAEP--A 130
Cdd:cd20681    1 VKVTLKNRDLWQQFHREGTEMIITKSGRRMFPSLRLSVSGLEPDARYCVLLEMVLASDCRFKYSGNGgWVPAGGAEPqpP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 131 MPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCThvFPETA 210
Cdd:cd20681   81 LPRRIYIHPDSPATGDHWMSQPISFSKVKLTNNTLDPQGNIVLTSMHKYQPRIHIVRCSDTLALPWAPTASFT--FPETE 158
                        170       180
                 ....*....|....*....|....*..
gi 568937099 211 FIAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20681  159 FIAVTAYQNERITKLKIDNNPFAKGFR 185
T-box_TBX6_VegT-like cd20190
DNA-binding domain of T-box transcription factor 6, VegT and related T-box proteins; This ...
54-237 1.65e-91

DNA-binding domain of T-box transcription factor 6, VegT and related T-box proteins; This subfamily includes the transcriptional regulators TBX6 and VegT. TBX6 plays an essential role in the fate determination of axial stem to become either neural or mesodermal. It also plays an essential role in the regulation of left/right patterning in mouse embryos through effects on nodal cilia and perinodal signaling. VegT (also known as Antipodean, Brat and Xombi) is required in early Xenopus embryos for the formation of both the mesoderm and endoderm germ layers. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved 1DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410316  Cd Length: 183  Bit Score: 277.15  E-value: 1.65e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:cd20190    1 VSLSLEDRELWKEFSSVGTEMIITKSGRRMFPACKVSVTGLDPEAKYLFLLDVVPVDNARYKWNKRRWEPSGKAEPHLPD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADE--NNGFGskntAFCTHVFPETAF 211
Cdd:cd20190   81 RVYIHPDSPAPGAHWMRQPISFHKLKLTNNTLDPHGHLILHSMHKYQPRIHLVQSADlcSQHWG----GMASFRFPETTF 156
                        170       180
                 ....*....|....*....|....*.
gi 568937099 212 IAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20190  157 IAVTAYQNPQITKLKIAANPFAKGFR 182
T-box_TBXT_TBX19-like cd20192
DNA-binding domain of T-box transcription factor T, T-box transcription factor 19 and related ...
54-236 2.67e-89

DNA-binding domain of T-box transcription factor T, T-box transcription factor 19 and related T-box proteins; Tbx19 (also known as Tpit) is a T-box factor restricted to two pituitary (pro-opiomelanocortin) POMC-expressing lineages, the corticotrophs and melanotrophs; it controls terminal differentiation of these lineages. TBX19 activates POMC gene transcription with the cooperation of another transcription factor Pitx1. TBXT, also known as Brachyury protein, or protein T, is a transcription factor needed for posterior mesoderm formation and differentiation as well as for the notochord development during embryogenesis. It binds to a 24 base-pair (bp) palindromic site (called the T site) and activates gene transcription when bound to such a site. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. TBXT is the founding member of the T-box family, members of which share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410318  Cd Length: 180  Bit Score: 271.44  E-value: 2.67e-89
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:cd20192    1 IRVTLEDRELWKKFHSLTNEMIVTKSGRRMFPVLKVSVSGLDPNAMYSVLLDFVQVDNHRWKYVNGEWVPGGKAEPPPPS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNhLDPFGHIILNSMHKYQPRLHIVKADENNgfGSKNTAfcTHVFPETAFIA 213
Cdd:cd20192   81 SVYVHPDSPNFGAHWMKGPVSFSKVKLTNK-PNGEGQIMLNSLHKYEPRVHIVRVGSNN--HERLVS--TFSFPETQFIA 155
                        170       180
                 ....*....|....*....|...
gi 568937099 214 VTSYQNHKITQLKIENNPFAKGF 236
Cdd:cd20192  156 VTAYQNEEITALKIKYNPFAKAF 178
T-box_TBX6 cd20196
DNA-binding domain of T-box transcription factor 6, and related T-box proteins; TBX6 is a ...
54-237 5.45e-89

DNA-binding domain of T-box transcription factor 6, and related T-box proteins; TBX6 is a T-box transcription factor which plays an essential role in the fate determination of axial stem to become either neural or mesodermal. It also plays an essential role in the regulation of left/right patterning in mouse embryos, through effects on nodal cilia and perinodal signaling. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410322  Cd Length: 182  Bit Score: 270.59  E-value: 5.45e-89
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:cd20196    1 VRMSLENAELWKQFSSVGTEMIITKAGRRMFPQLRVSVSGLDPEARYLLLLDVVPVDGSRYRWQGNSWEASGKAEPRLPD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFcthVFPETAFIA 213
Cdd:cd20196   81 RVYIHPDSPATGAHWMRQPISFHRAKLTNNTLDPHGHIILHSMHRYQPRVHVVRARDVLSWGGGCASF---TFPETQFIT 157
                        170       180
                 ....*....|....*....|....
gi 568937099 214 VTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20196  158 VTAYQNPKITQLKINSNPFAKGFR 181
T-box-like cd20682
T-box DNA-binding domain; uncharacterized subfamily; The T-box family is an ancient group that ...
54-237 4.38e-87

T-box DNA-binding domain; uncharacterized subfamily; The T-box family is an ancient group that appears to play a critical role in development in all animal species. These genes were uncovered on the basis of similarity to the DNA binding domain of murine Brachyury (T) gene product, the defining feature of the family. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development and conserved expression patterns, most of the known genes in all species being expressed in mesoderm or mesoderm precursors.


Pssm-ID: 410333  Cd Length: 191  Bit Score: 266.18  E-value: 4.38e-87
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFA--DNKWSVTGKAEPAM 131
Cdd:cd20682    1 IQVELCSRELWLQFHNLGNEMIITKAGRRMFPALKVKLTGLDPDKLYIVWVDIVPVDSNRYRYVyhSSKWVVAGSGDVLP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 132 PGRLYVHPDSPATGAHWMRQLVSFQKLKLTNN-HLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTH---VFP 207
Cdd:cd20682   81 PANRYIHPDSPASGKYWMSQIVSFDKLKLTNNkEPKQKGQISLHSMHKYQPRIHIQPVEDDGRNVEKAINSSKAlsfEFP 160
                        170       180       190
                 ....*....|....*....|....*....|
gi 568937099 208 ETAFIAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20682  161 ETSFITVTAYQNQQITKLKIASNPFAKGFR 190
T-box_MGA-like cd20195
DNA-binding domain of MAX gene-associated protein and related T-box proteins; MGA (also known ...
54-237 3.64e-83

DNA-binding domain of MAX gene-associated protein and related T-box proteins; MGA (also known as MGAP, MAX dimerization protein, MAD5, MXD5) is a dual-specificity transcription factor that regulates the expression of both, MAX-network and T-box family target genes. MGA functions as a repressor or an activator; it binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence. Its function is activated by heterodimerization with MAX. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410321  Cd Length: 186  Bit Score: 255.82  E-value: 3.64e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:cd20195    1 ITVTLENNSMWNEFYRCGTEMILTKQGRRMFPYCRFRISGLDPDRNYILVMDISPVDNFRYRWNGRWWEPSGKAEPHVLG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNT-AFCTHVFPETAFI 212
Cdd:cd20195   81 RVFIHPESPATGRHWMDQPVSFYKLKLTNNTLDQEGHIILHSMHRYLPRLHVVPADKEVDVIQLNGpDVHTFTFPQTEFF 160
                        170       180
                 ....*....|....*....|....*
gi 568937099 213 AVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20195  161 AVTAYQNKQITQLKIDYNPFAKGFR 185
T-box_TBR1_2_21-like cd20194
DNA-binding domain of T-box brain protein 1 and 2, T-box transcription factor 21 and related ...
56-237 7.35e-83

DNA-binding domain of T-box brain protein 1 and 2, T-box transcription factor 21 and related T-box proteins; TBX21 (also known as T-cell-specific T-box transcription factor T-bet or transcription factor TBLYM) is a lineage-defining transcription factor which directs T helper type 1 (Th1) cell differentiation. This subfamily includes TBR1 (also known as T-brain-1, or TES-56), which is a neuron-specific transcription factor involved in forebrain development, and TBR2 (also known as Eomesodermin, Eomes, or T-brain-2), which is associated with neurogenesis, cardiogenesis and tumor immune response. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410320  Cd Length: 185  Bit Score: 255.09  E-value: 7.35e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  56 VFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG-R 134
Cdd:cd20194    4 VYLCNRDLWLKFHQHQTEMIITKQGRRMFPTLSFNLSGLDPTAHYNVFVDMVLADPNHWKFQSGKWVPCGKAEGLPQGnR 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 135 LYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAfcTHVFPETAFIAV 214
Cdd:cd20194   84 VYVHPDSPNTGAHWMKQEISFSKLKLTNNKGADQGMIVLNSMHKYQPRIHVIEVGGNGPNEQRNLQ--THSFPETQFIAV 161
                        170       180
                 ....*....|....*....|...
gi 568937099 215 TSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20194  162 TAYQNTDITQLKIDHNPFAKGFR 184
T-box_TBX15_18_22-like cd20191
DNA-binding domain of T-box transcription factor 15, 18 and 22, and related T-box proteins; ...
52-237 3.30e-82

DNA-binding domain of T-box transcription factor 15, 18 and 22, and related T-box proteins; This subfamily includes the transcriptional regulators TBX15, TBX18 and TBX22 which are involved in various developmental processes. TBX15 (also known as TBX14) plays an important role in the development of the skeleton of the limb, vertebral column and head, possibly through its control of the number of mesenchymal precursor cells and chondrocytes; it also plays a role in the differentiation of brown and brite adipocytes. TBX18 is involved in the developmental processes of a variety of tissues and organs, including the ureter, vertebral column. epicardium and coronary vessels; it is important for the development of the head portion of the sino atrial node (SAN). Mutations in the T-box transcription factor gene TBX22 are found in X-linked Cleft Palate with or without Ankyloglossia syndrome (CPX syndrome), and associated with cleft lip and palate, and tooth agenesis. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410317  Cd Length: 194  Bit Score: 253.66  E-value: 3.30e-82
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  52 EGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFA--DNKWSVTGKAEP 129
Cdd:cd20191    1 KEIQVELQGSELWKRFHDIGTEMIITKAGRRMFPAIRVKVSGLDPHAQYIVAMDIVPVDNKRYRYVyhSSKWMVAGNADA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 130 AMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFC-----TH 204
Cdd:cd20191   81 PVPPRVYIHPDSPASGETWMRQVVSFDKLKLTNNEMDDQGHIILHSMHKYQPRVHVIRKDSSTDLSPKKPVPPgegvkTF 160
                        170       180       190
                 ....*....|....*....|....*....|...
gi 568937099 205 VFPETAFIAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20191  161 SFPETVFTTVTAYQNQQITRLKIDRNPFAKGFR 193
T-box_TBX18_like cd20199
DNA-binding domain of T-box transcription factor 18 and related T-box proteins; TBX18 acts as ...
52-237 3.69e-74

DNA-binding domain of T-box transcription factor 18 and related T-box proteins; TBX18 acts as a transcription repressor involved in the developmental processes of a variety of tissues and organs, including the ureter, vertebral column. epicardium and coronary vessels. TBX18 is important for the development of the head portion of the sino atrial node (SAN); SAN is the pacemaker region of the heart that initiates each heartbeat. This subgroup belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410325  Cd Length: 195  Bit Score: 233.01  E-value: 3.69e-74
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  52 EGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFA--DNKWSVTGKAEP 129
Cdd:cd20199    2 EEVRVDLQGADLWKRFHEIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVyhSSKWMVAGNADS 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 130 AMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGF--------GSKNTAF 201
Cdd:cd20199   82 PVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKECGEELspvkpipsGEGVKAF 161
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 568937099 202 CthvFPETAFIAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20199  162 S---FPETVFTTVTAYQNQQITRLKIDRNPFAKGFR 194
T-box_TBX22-like cd20200
DNA-binding domain of T-box transcription factor 22 and related T-box proteins; TBX22 is a ...
52-237 5.10e-73

DNA-binding domain of T-box transcription factor 22 and related T-box proteins; TBX22 is a transcriptional regulator involved in developmental processes. Mutations in the T-Box transcription factor gene TBX22 are found in X-linked Cleft Palate with or without Ankyloglossia syndrome (CPX syndrome). TBX22 mutation is also associated with cleft lip and palate, and tooth agenesis. This subgroup belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410326  Cd Length: 194  Bit Score: 230.19  E-value: 5.10e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  52 EGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFA--DNKWSVTGKAE- 128
Cdd:cd20200    1 RKVQVELQGSELWKRFHEIGTEMIITKAGRRMFPSVRVKVKGLDPLKQYYIAMDVVPVDSKRYRYVyhSSQWMVAGNTDh 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 129 PAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNT----AFCTH 204
Cdd:cd20200   81 SCITPRLYVHPDSPCSGETWMRQIISFDRVKLTNNEMDDKGHIILQSMHKYKPRVHVILQDSRFDLSQIQSlpaeGVKTF 160
                        170       180       190
                 ....*....|....*....|....*....|...
gi 568937099 205 VFPETAFIAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20200  161 SFPETEFTTVTAYQNQQITKLKIDRNPFAKGFR 193
T-box_TBXT cd20202
DNA-binding domain of T-box transcription factor T and related T-box proteins; TBXT, also ...
54-236 1.43e-72

DNA-binding domain of T-box transcription factor T and related T-box proteins; TBXT, also known as Brachyury protein, or protein T, is a transcription factor needed for posterior mesoderm formation and differentiation as well as for the notochord development during embryogenesis. It binds to a 24 base-pair (bp) palindromic site (called the T site) and activates gene transcription when bound to such a site. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. TBXT is the founding member of the T-box family, members of which share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410328  Cd Length: 179  Bit Score: 228.39  E-value: 1.43e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:cd20202    2 LKVSLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAPS 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNhLDPFGHIILNSMHKYQPRLHIVKAdenngfGSKNTAFCTHVFPETAFIA 213
Cdd:cd20202   82 CVYIHPDSPNFGAHWMKAPVSFSKVKLTNK-LNGGGQIMLNSLHKYEPRIHIVRV------GGPQRMITSHSFPETQFIA 154
                        170       180
                 ....*....|....*....|...
gi 568937099 214 VTSYQNHKITQLKIENNPFAKGF 236
Cdd:cd20202  155 VTAYQNEEITALKIKYNPFAKAF 177
T-box_TBX21 cd20203
DNA-binding domain of T-box transcription factor 21 and related T-box proteins; TBX21 (also ...
54-237 5.52e-72

DNA-binding domain of T-box transcription factor 21 and related T-box proteins; TBX21 (also known as T-cell-specific T-box transcription factor T-bet or transcription factor TBLYM) is a lineage-defining transcription factor which directs T helper type 1 (Th1) cell differentiation. It initiates Th1 lineage development from naive T helper precursor cells both by initiating the Th1 genetic programs and by inhibiting the opposing Th2 and Th17 lineage-commitment programs. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410329  Cd Length: 191  Bit Score: 227.15  E-value: 5.52e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:cd20203    2 LQVLLNNHPLWSKFHKHQTEMIITKQGRRMFPFLSFNLTGLDPTAHYNVYVDVVLADQHHWRYQGGKWVQCGKAEGNMPG 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 -RLYVHPDSPATGAHWMRQLVSFQKLKLTNNH---LDPFGHIILNSMHKYQPRLHIVKADENNG---FGSKNTAfcTHVF 206
Cdd:cd20203   82 nRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKgasNNVTQMIVLQSLHKYQPRLHIVEVKEGETeeaYSSSKTH--TFTF 159
                        170       180       190
                 ....*....|....*....|....*....|.
gi 568937099 207 PETAFIAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20203  160 PETQFIAVTAYQNAEITQLKIDHNPFAKGFR 190
T-box_TBX15-like cd20198
DNA-binding domain of T-box transcription factor 15 and related T-box proteins; TBX15 (also ...
51-237 5.68e-72

DNA-binding domain of T-box transcription factor 15 and related T-box proteins; TBX15 (also known as TBX14) plays an important role in the development of the skeleton of the limb, vertebral column and head, possibly through its control of the number of mesenchymal precursor cells and chondrocytes. TBX15 also plays a role in the differentiation of brown and brite adipocytes. This subgroup belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410324  Cd Length: 198  Bit Score: 227.69  E-value: 5.68e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  51 MEGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFA--DNKWSVTGKAE 128
Cdd:cd20198    4 MEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVyhSSKWMVAGNAD 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 129 PAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKN-----TAFCT 203
Cdd:cd20198   84 SPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSDLSPTKpvptgDGVKT 163
                        170       180       190
                 ....*....|....*....|....*....|....
gi 568937099 204 HVFPETAFIAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20198  164 FSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFR 197
T-box_TBX19-like cd20201
DNA-binding domain of T-box transcription factor 19 and related T-box proteins; Tbx19 (also ...
54-236 2.74e-66

DNA-binding domain of T-box transcription factor 19 and related T-box proteins; Tbx19 (also known as Tpit) is a T-box factor restricted to two pituitary (pro-opiomelanocortin) POMC-expressing lineages, the corticotrophs and melanotrophs; it controls terminal differentiation of these lineages. TBX19 activates POMC gene transcription with the cooperation of another transcription factor Pitx1. Mutations of the human TPIT gene cause early onset pituitary adrenocorticotrophic hormone (ACTH) deficiency. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410327  Cd Length: 183  Bit Score: 212.20  E-value: 2.74e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  54 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG 133
Cdd:cd20201    6 LQVSLEDAELWQRFKEVTNEMIVTKNGRRMFPVLKISVSGLDPNAMYSFLLDFAPADGHRWKYVNGEWVPAGKPEPHSHS 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNhLDPFGHIILNSMHKYQPRLHIVKAdenngfGSKNTAFCTHVFPETAFIA 213
Cdd:cd20201   86 CVYIHPDSPNFGAHWMKAPISFSKVKLTNK-LNGGGQIMLNSLHKYEPQIHIVRV------GGPHRMVTNCSFPETQFIA 158
                        170       180
                 ....*....|....*....|...
gi 568937099 214 VTSYQNHKITQLKIENNPFAKGF 236
Cdd:cd20201  159 VTAYQNEEITALKIKYNPFAKAF 181
T-box_TBR2 cd20205
DNA-binding domain of T-box brain protein 2 and related T-box proteins; TBR2 (also known as ...
55-237 2.69e-64

DNA-binding domain of T-box brain protein 2 and related T-box proteins; TBR2 (also known as Eomesodermin, Eomes, or T-brain-2) is a member of the T-box family of transcription factors and is associated with neurogenesis, cardiogenesis and tumor immune response. This subfamily belongs to the T-box family of transcription factors which plays a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410331  Cd Length: 191  Bit Score: 207.23  E-value: 2.69e-64
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  55 KVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG- 133
Cdd:cd20205    3 QVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNITGLNPTAHYNVFVEVVLADPNHWRFQGGKWVTCGKADNNMQGn 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNN---HLDPFGHIILNSMHKYQPRLHIVKADENN----GFGSKNTAFcthVF 206
Cdd:cd20205   83 KVYVHPESPNTGAHWMRQEISFGKLKLTNNkgaNNNNTQMIVLQSLHKYQPRLHIVEVSEDGvedlNDSSKTQTF---TF 159
                        170       180       190
                 ....*....|....*....|....*....|.
gi 568937099 207 PETAFIAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20205  160 PENQFIAVTAYQNTDITQLKIDHNPFAKGFR 190
T-box_Fungi_incertae_sedis cd20683
T-box DNA-binding domain; uncharacterized subfamily of fungi classified as Fungi incertae ...
58-239 2.99e-63

T-box DNA-binding domain; uncharacterized subfamily of fungi classified as Fungi incertae sedis; Fungi incertae sedis refers to a fungal taxonomic group where its broader relationships are unknown or undefined. The T-box family is an ancient group that appears to play a critical role in development in all animal species. These genes were uncovered on the basis of similarity to the DNA binding domain of murine Brachyury (T) gene product, the defining feature of the family. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development and conserved expression patterns, most of the known genes in all species being expressed in mesoderm or mesoderm precursors.


Pssm-ID: 410334  Cd Length: 214  Bit Score: 205.32  E-value: 2.99e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  58 LHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGK----------A 127
Cdd:cd20683    5 LEDADLWAQFHSVQNEMIITKSGRCLFPLLRFRAVNLDPKALYSIALDIEQVSPNRFRFRNGRWNPIDKdqrgddafssG 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 128 EPAM---PGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHL------------------DPFGHIILNSMHKYQPRLHIV 186
Cdd:cd20683   85 TADKsvlLPESYIHPDGPQTGAFWMANGISFAKIKLSNRQPnssdrdgpkenitnsisaLPDGHFFLTSFHKYQPRLHLI 164
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
gi 568937099 187 KADENNGFGSKNTafcTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGS 239
Cdd:cd20683  165 QHSAGDHDDILST---TFTFEETEFIAVTHYQNEKVNILKKDYNPHAKGFKDD 214
T-box_TBR1 cd20204
DNA-binding domain of T-box brain protein 1 and related T-box proteins; TBR1 (also known as ...
55-237 1.41e-61

DNA-binding domain of T-box brain protein 1 and related T-box proteins; TBR1 (also known as T-brain-1 or TES-56) is a neuron-specific transcription factor of the T-box family and involved in forebrain development. It has been recognized as a high-confidence risk gene for autism spectrum disorders (ASD); it regulates the expression of ASD-related genes that are critical for cortical development. This subfamily belongs to the T-box family of transcription factors which play a multitude of diverse functions throughout development. The founding member of the T-box family is Brachyury (also known as TBXT, or T). T-box family members share a conserved DNA-binding domain (T-box) which binds DNA in a sequence-specific manner. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development, and conserved expression patterns.


Pssm-ID: 410330  Cd Length: 191  Bit Score: 200.35  E-value: 1.41e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099  55 KVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPG- 133
Cdd:cd20204    3 QVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNISGLDPTAHYNIFVDVILADPNHWRFQGGKWVPCGKADTNVQGn 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937099 134 RLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGH---IILNSMHKYQPRLHIVKADENngfGSKNTA----FCTHVF 206
Cdd:cd20204   83 RVYMHPDSPNTGAHWMRQEISFGKLKLTNNKGASNNNgqmVVLQSLHKYQPRLHVVEVNED---GTEDTSqpgrVQTFTF 159
                        170       180       190
                 ....*....|....*....|....*....|.
gi 568937099 207 PETAFIAVTSYQNHKITQLKIENNPFAKGFR 237
Cdd:cd20204  160 PETQFIAVTAYQNTDITQLKIDHNPFAKGFR 190
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH