NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568937136|ref|XP_006530361|]
View 

L-serine dehydratase/L-threonine deaminase isoform X1 [Mus musculus]

Protein Classification

serine/threonine dehydratase family protein (domain architecture ID 10157824)

serine/threonine dehydratase family protein such as L-serine dehydratase/L-threonine deaminase, a pyridoxal-5'-phosphate (PLP)-dependent enzyme that catalyzes dehydration of L-Ser/Thr to yield pyruvate/ketobutyrate and ammonia

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
35-345 1.37e-157

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


:

Pssm-ID: 107209  Cd Length: 316  Bit Score: 444.05  E-value: 1.37e-157
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  35 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQG---CRHFVCSSAGNAGMATAYAARRLGIPATIV 111
Cdd:cd06448    1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 112 VPNTTPALTIERLKNEGATVEVVGEML-DEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETL--SAKPGAI 188
Cdd:cd06448   81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLqsQEKVDAI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 189 VLSVGGGGLLCGVVQGLREVGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFS 268
Cdd:cd06448  161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568937136 269 EVISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgRLQTPLASLVVIVCGGSNISLAQLQALKVQL 345
Cdd:cd06448  241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
 
Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
35-345 1.37e-157

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


Pssm-ID: 107209  Cd Length: 316  Bit Score: 444.05  E-value: 1.37e-157
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  35 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQG---CRHFVCSSAGNAGMATAYAARRLGIPATIV 111
Cdd:cd06448    1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 112 VPNTTPALTIERLKNEGATVEVVGEML-DEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETL--SAKPGAI 188
Cdd:cd06448   81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLqsQEKVDAI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 189 VLSVGGGGLLCGVVQGLREVGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFS 268
Cdd:cd06448  161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568937136 269 EVISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgRLQTPLASLVVIVCGGSNISLAQLQALKVQL 345
Cdd:cd06448  241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
PALP pfam00291
Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate ...
35-329 5.07e-67

Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate dependent enzymes. This family includes: serine dehydratase EC:4.2.1.13 P20132, threonine dehydratase EC:4.2.1.16, tryptophan synthase beta chain EC:4.2.1.20, threonine synthase EC:4.2.99.2, cysteine synthase EC:4.2.99.8 P11096, cystathionine beta-synthase EC:4.2.1.22, 1-aminocyclopropane-1-carboxylate deaminase EC:4.1.99.4.


Pssm-ID: 395228 [Multi-domain]  Cd Length: 295  Bit Score: 212.94  E-value: 5.07e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136   35 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCkMKAKQGC--RHFVCSSAGNAGMATAYAARRLGIPATIVV 112
Cdd:pfam00291   7 PTPLVRLPRLSKELGVDVYLKLESLNPTGSFKDRGALNLL-LRLKEGEggKTVVEASSGNHGRALAAAAARLGLKCTIVV 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  113 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSV 192
Cdd:pfam00291  86 PEDAPPGKLLLMRALGAEVVLVGGDYDEAVAAARELAAEGPGAYYINQYDNPLNIEGYGTIGLEILEQLGGDPDAVVVPV 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  193 GGGGLLCGVVQGLREvGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGV-NTVGAQTLKLFYEHPIFSEVI 271
Cdd:pfam00291 166 GGGGLIAGIARGLKE-LGPDVRVIGVEPEGAPALARSLAAGRPVPVPVSDTIADGLGVgDEPGALALDLLDEYVGEVVTV 244
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 568937136  272 SDQEAVSALEKFVDDEKILVEPACGAALAAVysrvvcRLQDEGRLQtPLASLVVIVCG 329
Cdd:pfam00291 245 SDEEALEAMRLLARREGIVVEPSSAAALAAL------KLALAGELK-GGDRVVVVLTG 295
IlvA COG1171
Threonine dehydratase [Amino acid transport and metabolism];
27-341 8.88e-59

Threonine dehydratase [Amino acid transport and metabolism];


Pssm-ID: 224092  Cd Length: 347  Bit Score: 193.20  E-value: 8.88e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  27 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQgcRHFVCSSAGNAGMATAY 99
Cdd:COG1171   14 AAAARLKgvvNPTPLQRSPSLSERLGAEIYLKRENLQPVGSFKIRGaynkLSSLSEEEERA--AGVIAASAGNHAQGVAY 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 100 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 179
Cdd:COG1171   92 AAKRLGIKATIVMPETTPKIKVDATRGYGAEVILHGDNFDDAYAAAEELAEEE-GLTFVPPFDDPDVIAGQGTIALEILE 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 180 TLSAKPGAIVLSVGGGGLLCGVVQGLREVGWeDVPIIAMETFGAHSFHAAIKEGKL-VTLPKITSVAKALGVNTVGAQTL 258
Cdd:COG1171  171 QLPDLPDAVFVPVGGGGLISGIATALKALSP-EIKVIGVEPEGAPSMYASLKAGKIvVVLPDVGTIADGLAVKRPGDLTF 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 259 KLFYEHPifSEVI--SDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgrlqtplaSLVVIVCGGsNISLA 336
Cdd:COG1171  250 EILRELV--DDIVlvDEDEICAAMRDLFERTKIIAEPAGALALAALLAGKIEPLQGK--------TVVVILSGG-NIDFE 318

                 ....*
gi 568937136 337 QLQAL 341
Cdd:COG1171  319 RLAEV 323
PRK08198 PRK08198
threonine dehydratase; Provisional
27-347 2.74e-43

threonine dehydratase; Provisional


Pssm-ID: 236182 [Multi-domain]  Cd Length: 404  Bit Score: 154.15  E-value: 2.74e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  27 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLckmKAKQGCRHFVCSSAGNAGMATAY 99
Cdd:PRK08198  11 EARERLKgvvRRTPLEYSRTLSELTGAEVYLKCENLQRTGSFKIRGaynkIASL---SEEERARGVVAASAGNHAQGVAY 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 100 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 179
Cdd:PRK08198  88 AASLLGIKATIVMPETAPLSKVKATRSYGAEVVLHGDVYDEALAKAQELAEET-GATFVHPFDDPDVIAGQGTIGLEILE 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 180 TL------------------------SAKPgaivlsvggggllcgvvqglrevgweDVPIIAMETFGAHSFHAAIKEGKL 235
Cdd:PRK08198 167 DLpdvdtvvvpigggglisgvatavkALRP--------------------------EVRVIGVQAEGAPAMPESLAAGRP 220
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 236 VTLPKITSVAKALGVNTVGAQTLKLFYEHpiFSEVI--SDQEAVSA----LEKfvddEKILVEPACGAALAAVYSRvvcR 309
Cdd:PRK08198 221 VELESVDTIADGIAVKRPGDLTFEIIREL--VDDVVtvSDEEIARAilllLER----AKLVVEGAGAVSVAALLSG---K 291
                        330       340       350
                 ....*....|....*....|....*....|....*...
gi 568937136 310 LQDEGRlqtplaSLVVIVCGGsNISLAQLQALkVQLGL 347
Cdd:PRK08198 292 LDVKGK------KVVAVLSGG-NIDVLLLSRV-IERGL 321
 
Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
35-345 1.37e-157

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


Pssm-ID: 107209  Cd Length: 316  Bit Score: 444.05  E-value: 1.37e-157
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  35 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQG---CRHFVCSSAGNAGMATAYAARRLGIPATIV 111
Cdd:cd06448    1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 112 VPNTTPALTIERLKNEGATVEVVGEML-DEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETL--SAKPGAI 188
Cdd:cd06448   81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLqsQEKVDAI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 189 VLSVGGGGLLCGVVQGLREVGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFS 268
Cdd:cd06448  161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568937136 269 EVISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgRLQTPLASLVVIVCGGSNISLAQLQALKVQL 345
Cdd:cd06448  241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
PALP pfam00291
Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate ...
35-329 5.07e-67

Pyridoxal-phosphate dependent enzyme; Members of this family are all pyridoxal-phosphate dependent enzymes. This family includes: serine dehydratase EC:4.2.1.13 P20132, threonine dehydratase EC:4.2.1.16, tryptophan synthase beta chain EC:4.2.1.20, threonine synthase EC:4.2.99.2, cysteine synthase EC:4.2.99.8 P11096, cystathionine beta-synthase EC:4.2.1.22, 1-aminocyclopropane-1-carboxylate deaminase EC:4.1.99.4.


Pssm-ID: 395228 [Multi-domain]  Cd Length: 295  Bit Score: 212.94  E-value: 5.07e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136   35 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCkMKAKQGC--RHFVCSSAGNAGMATAYAARRLGIPATIVV 112
Cdd:pfam00291   7 PTPLVRLPRLSKELGVDVYLKLESLNPTGSFKDRGALNLL-LRLKEGEggKTVVEASSGNHGRALAAAAARLGLKCTIVV 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  113 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSV 192
Cdd:pfam00291  86 PEDAPPGKLLLMRALGAEVVLVGGDYDEAVAAARELAAEGPGAYYINQYDNPLNIEGYGTIGLEILEQLGGDPDAVVVPV 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  193 GGGGLLCGVVQGLREvGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGV-NTVGAQTLKLFYEHPIFSEVI 271
Cdd:pfam00291 166 GGGGLIAGIARGLKE-LGPDVRVIGVEPEGAPALARSLAAGRPVPVPVSDTIADGLGVgDEPGALALDLLDEYVGEVVTV 244
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 568937136  272 SDQEAVSALEKFVDDEKILVEPACGAALAAVysrvvcRLQDEGRLQtPLASLVVIVCG 329
Cdd:pfam00291 245 SDEEALEAMRLLARREGIVVEPSSAAALAAL------KLALAGELK-GGDRVVVVLTG 295
IlvA COG1171
Threonine dehydratase [Amino acid transport and metabolism];
27-341 8.88e-59

Threonine dehydratase [Amino acid transport and metabolism];


Pssm-ID: 224092  Cd Length: 347  Bit Score: 193.20  E-value: 8.88e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  27 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQgcRHFVCSSAGNAGMATAY 99
Cdd:COG1171   14 AAAARLKgvvNPTPLQRSPSLSERLGAEIYLKRENLQPVGSFKIRGaynkLSSLSEEEERA--AGVIAASAGNHAQGVAY 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 100 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 179
Cdd:COG1171   92 AAKRLGIKATIVMPETTPKIKVDATRGYGAEVILHGDNFDDAYAAAEELAEEE-GLTFVPPFDDPDVIAGQGTIALEILE 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 180 TLSAKPGAIVLSVGGGGLLCGVVQGLREVGWeDVPIIAMETFGAHSFHAAIKEGKL-VTLPKITSVAKALGVNTVGAQTL 258
Cdd:COG1171  171 QLPDLPDAVFVPVGGGGLISGIATALKALSP-EIKVIGVEPEGAPSMYASLKAGKIvVVLPDVGTIADGLAVKRPGDLTF 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 259 KLFYEHPifSEVI--SDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgrlqtplaSLVVIVCGGsNISLA 336
Cdd:COG1171  250 EILRELV--DDIVlvDEDEICAAMRDLFERTKIIAEPAGALALAALLAGKIEPLQGK--------TVVVILSGG-NIDFE 318

                 ....*
gi 568937136 337 QLQAL 341
Cdd:COG1171  319 RLAEV 323
Thr-dehyd cd01562
Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. ...
27-333 2.02e-55

Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. Although the nitrogen atoms of most amino acids are transferred to alpha-ketoglutarate before removal, the alpha-amino group of threonine can be directly converted into NH4+. The direct deamination is catalyzed by threonine dehydratase, in which pyridoxal phosphate (PLP) is the prosthetic group. Threonine dehydratase is widely distributed in all three major phylogenetic divisions.


Pssm-ID: 107205  Cd Length: 304  Bit Score: 183.07  E-value: 2.02e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  27 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQGcrhFVCSSAGNAGMATAY 99
Cdd:cd01562    6 AAAARIKpvvRRTPLLTSPTLSELLGAEVYLKCENLQKTGSFKIRGaynkLLSLSEEERAKG---VVAASAGNHAQGVAY 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 100 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 179
Cdd:cd01562   83 AAKLLGIPATIVMPETAPAAKVDATRAYGAEVVLYGEDFDEAEAKARELAEEE-GLTFIHPFDDPDVIAGQGTIGLEILE 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 180 TLsAKPGAIVlsvggggllcgvvqglrevgwedVP----------------------IIAMETFGAHSFHAAIKEGKLVT 237
Cdd:cd01562  162 QV-PDLDAVF-----------------------VPvggggliagiatavkalspntkVIGVEPEGAPAMAQSLAAGKPVT 217
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 238 LPKITSVAKALGVNTVGAQTLKLFYEHPifSEVI--SDQEAVSALEKFVDDEKILVEPACGAALAAVysrvvcrlqDEGR 315
Cdd:cd01562  218 LPEVDTIADGLAVKRPGELTFEIIRKLV--DDVVtvSEDEIAAAMLLLFEREKLVAEPAGALALAAL---------LSGK 286
                        330
                 ....*....|....*...
gi 568937136 316 LQTPLASLVVIVCGGsNI 333
Cdd:cd01562  287 LDLKGKKVVVVLSGG-NI 303
Trp-synth-beta_II cd00640
Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP) ...
36-330 6.81e-55

Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions. This CD corresponds to aminocyclopropane-1-carboxylate deaminase (ACCD), tryptophan synthase beta chain (Trp-synth_B), cystathionine beta-synthase (CBS), O-acetylserine sulfhydrylase (CS), serine dehydratase (Ser-dehyd), threonine dehydratase (Thr-dehyd), diaminopropionate ammonia lyase (DAL), and threonine synthase (Thr-synth). ACCD catalyzes the conversion of 1-aminocyclopropane-1-carboxylate to alpha-ketobutyrate and ammonia. Tryptophan synthase folds into a tetramer, where the beta chain is the catalytic PLP-binding subunit and catalyzes the formation of L-tryptophan from indole and L-serine. CBS is a tetrameric hemeprotein that catalyzes condensation of serine and homocysteine to cystathionine. CS is a homodimer that catalyzes the formation of L-cysteine from O-acetyl-L-serine. Ser-dehyd catalyzes the conversion of L- or D-serine to pyruvate and ammonia. Thr-dehyd is active as a homodimer and catalyzes the conversion of L-threonine to 2-oxobutanoate and ammonia. DAL is also a homodimer and catalyzes the alpha, beta-elimination reaction of both L- and D-alpha, beta-diaminopropionate to form pyruvate and ammonia. Thr-synth catalyzes the formation of threonine and inorganic phosphate from O-phosphohomoserine.


Pssm-ID: 107202 [Multi-domain]  Cd Length: 244  Bit Score: 180.02  E-value: 6.81e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKM---KAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVV 112
Cdd:cd00640    1 TPLVRLKRLSKLGGANIYLKLEFLNPTGSFKDRGALNLILLaeeEGKLPKGVIIESTGGNTGIALAAAAARLGLKCTIVM 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 113 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETL-SAKPGAIvls 191
Cdd:cd00640   81 PEGASPEKVAQMRALGAEVVLVPGDFDDAIALAKELAEEDPGAYYVNQFDNPANIAGQGTIGLEILEQLgGQKPDAV--- 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 192 vggggllcgvvqglrevgwedvpIIAMETFGAHS-FHAAIKEGKLvtLPKItsvakalgvntVGAQTlklfyehpiFSEV 270
Cdd:cd00640  158 -----------------------VVPVGGGGNIAgIARALKELLP--NVKV-----------IGVEP---------EVVT 192
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 271 ISDQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcRLQDEGrlqTPLASLVVIVCGG 330
Cdd:cd00640  193 VSDEEALEAIRLLAREEGILVEPSSAAALAAAL-----KLAKKL---GKGKTVVVILTGG 244
PRK08198 PRK08198
threonine dehydratase; Provisional
27-347 2.74e-43

threonine dehydratase; Provisional


Pssm-ID: 236182 [Multi-domain]  Cd Length: 404  Bit Score: 154.15  E-value: 2.74e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  27 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLckmKAKQGCRHFVCSSAGNAGMATAY 99
Cdd:PRK08198  11 EARERLKgvvRRTPLEYSRTLSELTGAEVYLKCENLQRTGSFKIRGaynkIASL---SEEERARGVVAASAGNHAQGVAY 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 100 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 179
Cdd:PRK08198  88 AASLLGIKATIVMPETAPLSKVKATRSYGAEVVLHGDVYDEALAKAQELAEET-GATFVHPFDDPDVIAGQGTIGLEILE 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 180 TL------------------------SAKPgaivlsvggggllcgvvqglrevgweDVPIIAMETFGAHSFHAAIKEGKL 235
Cdd:PRK08198 167 DLpdvdtvvvpigggglisgvatavkALRP--------------------------EVRVIGVQAEGAPAMPESLAAGRP 220
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 236 VTLPKITSVAKALGVNTVGAQTLKLFYEHpiFSEVI--SDQEAVSA----LEKfvddEKILVEPACGAALAAVYSRvvcR 309
Cdd:PRK08198 221 VELESVDTIADGIAVKRPGDLTFEIIREL--VDDVVtvSDEEIARAilllLER----AKLVVEGAGAVSVAALLSG---K 291
                        330       340       350
                 ....*....|....*....|....*....|....*...
gi 568937136 310 LQDEGRlqtplaSLVVIVCGGsNISLAQLQALkVQLGL 347
Cdd:PRK08198 292 LDVKGK------KVVAVLSGG-NIDVLLLSRV-IERGL 321
PRK08639 PRK08639
threonine dehydratase; Validated
27-332 1.83e-32

threonine dehydratase; Validated


Pssm-ID: 236318 [Multi-domain]  Cd Length: 420  Bit Score: 125.30  E-value: 1.83e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  27 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHL-CKMKAKQGCRHFVCSSAGNAGMATAYAAR 102
Cdd:PRK08639  14 KAAKRLKdvvPETPLQRNDYLSEKYGANVYLKREDLQPVRSYKLRGAYNAiSQLSDEELAAGVVCASAGNHAQGVAYACR 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 103 RLGIPATIVVPNTTPALTIERLK---NEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 179
Cdd:PRK08639  94 HLGIPGVIFMPVTTPQQKIDQVRffgGEFVEIVLVGDTFDDSAAAAQEYAEET-GATFIPPFDDPDVIAGQGTVAVEILE 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 180 TLS--AKPGAIVLSVGGGGLLCGVVQGLREVGWEdVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQT 257
Cdd:PRK08639 173 QLEkeGSPDYVFVPVGGGGLISGVTTYLKERSPK-TKIIGVEPAGAASMKAALEAGKPVTLEKIDKFVDGAAVARVGDLT 251
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 568937136 258 LKLFYEHPifSEVIS-DQEAVSA--LEKFvDDEKILVEPACGAALAAVysrvvcrlqDEGRLQTPLASLVVIVCGGSN 332
Cdd:PRK08639 252 FEILKDVV--DDVVLvPEGAVCTtiLELY-NKEGIVAEPAGALSIAAL---------ELYKDEIKGKTVVCVISGGNN 317
PRK12483 PRK12483
threonine dehydratase; Reviewed
34-346 6.08e-32

threonine dehydratase; Reviewed


Pssm-ID: 237111 [Multi-domain]  Cd Length: 521  Bit Score: 125.29  E-value: 6.08e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  34 VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGI-GHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVV 112
Cdd:PRK12483  36 RETPLQRAPNLSARLGNQVLLKREDLQPVFSFKIRGAyNKMARLPAEQLARGVITASAGNHAQGVALAAARLGVKAVIVM 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 113 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELketLSAKPGAIVLS- 191
Cdd:PRK12483 116 PRTTPQLKVDGVRAHGGEVVLHGESFPDALAHALKLAEEE-GLTFVPPFDDPDVIAGQGTVAMEI---LRQHPGPLDAIf 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 192 -----VGGGGLLCGVVQGLRevgwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHpi 266
Cdd:PRK12483 192 vpvggGGLIAGIAAYVKYVR----PEIKVIGVEPDDSNCLQAALAAGERVVLGQVGLFADGVAVAQIGEHTFELCRHY-- 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 267 FSEVI--SDQEAVSALEKFVDDEKILVEPACGAALAAVySRVVCRLQDEGRlqtplaSLVVIVcGGSNISLAQLQ--ALK 342
Cdd:PRK12483 266 VDEVVtvSTDELCAAIKDIYDDTRSITEPAGALAVAGI-KKYAEREGIEGQ------TLVAID-SGANVNFDRLRhvAER 337

                 ....
gi 568937136 343 VQLG 346
Cdd:PRK12483 338 AELG 341
PRK09224 PRK09224
threonine ammonia-lyase IlvA;
34-329 2.87e-30

threonine ammonia-lyase IlvA;


Pssm-ID: 236417 [Multi-domain]  Cd Length: 504  Bit Score: 120.24  E-value: 2.87e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  34 VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQGCrhfVCSSAGNAGMATAYAARRLGIPAT 109
Cdd:PRK09224  19 QETPLEKAPKLSARLGNQVLLKREDLQPVFSFKLRGaynkMAQLTEEQLARGV---ITASAGNHAQGVALSAARLGIKAV 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 110 IVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIV 189
Cdd:PRK09224  96 IVMPVTTPDIKVDAVRAFGGEVVLHGDSFDEAYAHAIELAEEE-GLTFIHPFDDPDVIAGQGTIAMEILQQHPHPLDAVF 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 190 LSvggggllcgvvqglreVG---------------WEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVG 254
Cdd:PRK09224 175 VP----------------VGgggliagvaayikqlRPEIKVIGVEPEDSACLKAALEAGERVDLPQVGLFADGVAVKRIG 238
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 568937136 255 AQTLKLFYEHpiFSEVIS-DQEAVSALEKFV-DDEKILVEPAcGA-ALAAVySRVVCRLQDEGRlqtplaSLVVIVCG 329
Cdd:PRK09224 239 EETFRLCQEY--VDDVITvDTDEICAAIKDVfEDTRSIAEPA-GAlALAGL-KKYVAQHGIEGE------TLVAILSG 306
PRK07334 PRK07334
threonine dehydratase; Provisional
26-302 4.76e-30

threonine dehydratase; Provisional


Pssm-ID: 235994 [Multi-domain]  Cd Length: 403  Bit Score: 118.46  E-value: 4.76e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  26 MAAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG-IGHLCKMKAKQGCRHFVCSSAGNAGMATAYAA 101
Cdd:PRK07334  11 RAAAARLAgqvLRTPCVHSRTLSQITGAEVWLKFENLQFTASFKERGaLNKLLLLTEEERARGVIAMSAGNHAQGVAYHA 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 102 RRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELketL 181
Cdd:PRK07334  91 QRLGIPATIVMPRFTPTVKVERTRGFGAEVVLHGETLDEARAHARELAEEE-GLTFVHPYDDPAVIAGQGTVALEM---L 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 182 SAKP------------GAIvlsvgggGLLCGVVQGLRevgwEDVPIIAMETFGAHSFHAAIKEgklVTLPKITS-VAKAL 248
Cdd:PRK07334 167 EDAPdldtlvvpigggGLI-------SGMATAAKALK----PDIEIIGVQTELYPSMYAAIKG---VALPCGGStIAEGI 232
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 568937136 249 GVNTVGAQTLKLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAV 302
Cdd:PRK07334 233 AVKQPGQLTLEIVRRLVDDILLVSEADIEQAVSLLLEIEKTVVEGAGAAGLAAL 286
PRK08246 PRK08246
serine/threonine dehydratase;
47-330 1.05e-29

serine/threonine dehydratase;


Pssm-ID: 181319  Cd Length: 310  Bit Score: 115.82  E-value: 1.05e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  47 LAGTSVFLKMDSSQPSGSFKIRGIGHLCkMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTPALTIERLKN 126
Cdd:PRK08246  34 FGPAPVWLKLEHLQHTGSFKARGAFNRL-LAAPVPAAGVVAASGGNAGLAVAYAAAALGVPATVFVPETAPPAKVARLRA 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 127 EGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLsAKPGAIvlsvggggllcgvvqgLR 206
Cdd:PRK08246 113 LGAEVVVVGAEYADALEAAQAFAAET-GALLCHAYDQPEVLAGAGTLGLEIEEQA-PGVDTV----------------LV 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 207 EVG-----------WED-VPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEVISDQ 274
Cdd:PRK08246 175 AVGgggliagiaawFEGrARVVAVEPEGAPTLHAALAAGEPVDVPVSGIAADSLGARRVGEIAFALARAHVVTSVLVSDE 254
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 568937136 275 EAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEgrlqtplaSLVVIVCGG 330
Cdd:PRK08246 255 AIIAARRALWEELRLAVEPGAATALAALLSGAYVPAPGE--------RVAVVLCGA 302
PRK06815 PRK06815
threonine/serine dehydratase;
36-340 1.11e-29

threonine/serine dehydratase;


Pssm-ID: 180709  Cd Length: 317  Bit Score: 115.95  E-value: 1.11e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGH-LCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPN 114
Cdd:PRK06815  21 TPLEHSPLLSQHTGCEVYLKCEHLQHTGSFKFRGASNkLRLLNEAQRQQGVITASSGNHGQGVALAAKLAGIPVTVYAPE 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 115 TTPALTIERLKNEGATVEVVG-EMLDEAIQVAKALEKNnpGWVYISPFDDPLIWEGHTSLVKELKETLsAKPGAIVLSVG 193
Cdd:PRK06815 101 QASAIKLDAIRALGAEVRLYGgDALNAELAARRAAEQQ--GKVYISPYNDPQVIAGQGTIGMELVEQQ-PDLDAVFVAVG 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 194 GGGLLCGVVQGLREVGwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAK--ALGVNTvGAQTLKLFYEHPIFSEVI 271
Cdd:PRK06815 178 GGGLISGIATYLKTLS-PKTEIIGCWPANSPSLYTSLEAGEIVEVAEQPTLSDgtAGGVEP-GAITFPLCQQLIDQKVLV 255
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568937136 272 SDQEAVSALEKFVDDEKILVEPACGAALAAvYSRVVCRLQdeGRlqtplaSLVVIVCgGSNISLAQLQA 340
Cdd:PRK06815 256 SEEEIKEAMRLIAETDRWLIEGAAGVALAA-ALKLAPRYQ--GK------KVAVVLC-GKNIVLEKYLE 314
eutB PRK07476
threonine dehydratase; Provisional
34-181 9.51e-29

threonine dehydratase; Provisional


Pssm-ID: 236025  Cd Length: 322  Bit Score: 113.14  E-value: 9.51e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  34 VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGH-LCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVV 112
Cdd:PRK07476  18 RRTPLVASASLSARAGVPVWLKLETLQPTGSFKLRGATNaLLSLSAQERARGVVTASTGNHGRALAYAARALGIRATICM 97
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568937136 113 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETL 181
Cdd:PRK07476  98 SRLVPANKVDAIRALGAEVRIVGRSQDDAQAEVERLVREE-GLTMVPPFDDPRIIAGQGTIGLEILEAL 165
PLN02550 PLN02550
threonine dehydratase
34-339 1.25e-28

threonine dehydratase


Pssm-ID: 178165 [Multi-domain]  Cd Length: 591  Bit Score: 116.56  E-value: 1.25e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  34 VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGI-GHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVV 112
Cdd:PLN02550 108 IESPLQLAKKLSERLGVKVLLKREDLQPVFSFKLRGAyNMMAKLPKEQLDKGVICSSAGNHAQGVALSAQRLGCDAVIAM 187
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 113 PNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSV 192
Cdd:PLN02550 188 PVTTPEIKWQSVERLGATVVLVGDSYDEAQAYAKQRALEE-GRTFIPPFDHPDVIAGQGTVGMEIVRQHQGPLHAIFVPV 266
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 193 GGGGLLCGVVQGLREVGWEdVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEVIS 272
Cdd:PLN02550 267 GGGGLIAGIAAYVKRVRPE-VKIIGVEPSDANAMALSLHHGERVMLDQVGGFADGVAVKEVGEETFRLCRELVDGVVLVS 345
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 273 DQEAVSALEKFVDDEKILVEPACGAALAAvySRVVCR---LQDEGrlqtplaslVVIVCGGSNISLAQLQ 339
Cdd:PLN02550 346 RDAICASIKDMFEEKRSILEPAGALALAG--AEAYCKyygLKDEN---------VVAITSGANMNFDRLR 404
PRK08526 PRK08526
threonine dehydratase; Provisional
34-338 3.33e-27

threonine dehydratase; Provisional


Pssm-ID: 181457 [Multi-domain]  Cd Length: 403  Bit Score: 110.57  E-value: 3.33e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  34 VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQGCrhfVCSSAGNAGMATAYAARRLGIPAT 109
Cdd:PRK08526  19 NKTPFAYAPFLSKISGAEVYLKKENLQITGAYKIRGaynkIANLSEEQKQHGV---IAASAGNHAQGVAISAKKFGIKAV 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 110 IVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLSaKPGAIV 189
Cdd:PRK08526  96 IVMPEATPLLKVSGTKALGAEVILKGDNYDEAYAFALEYAKEN-NLTFIHPFEDEEVMAGQGTIALEMLDEIS-DLDMVV 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 190 LSVGGGGLLCGVVQGLREVGwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEhpIFSE 269
Cdd:PRK08526 174 VPVGGGGLISGIASAAKQIN-PNIKIIGVGAKGAPAMYESFHAKKIINSKSVRTIADGIAVRDASPINLAIILE--CVDD 250
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568937136 270 VIS--DQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcrlqdEGRLQTPLASLVVIVCGGSNISLAQL 338
Cdd:PRK08526 251 FVQvdDEEIANAILFLLEKQKIVVEGAGAASVAALL---------HQKIDLKKGKKIGVVLSGGNIDVQML 312
Thr-synth_1 cd01563
Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last ...
36-329 7.71e-27

Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate. It proceeds by converting O-phospho-L-homoserine (OPH) into threonine and inorganic phosphate. In plants, OPH is an intermediate between the methionine and threonine/isoleucine pathways. Thus threonine synthase competes for OPH with cystathionine-gamma-synthase, the first enzyme in the methionine pathway. These enzymes are in general dimers. Members of this CD, Thr-synth_1, are widely distributed in bacteria, archaea and higher plants.


Pssm-ID: 107206  Cd Length: 324  Bit Score: 108.06  E-value: 7.71e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSK-LAGTSVFLKMDSSQPSGSFKIRGighlckM-----KAKQ-GCRHFVCSSAGNAGMATAYAARRLGIPA 108
Cdd:cd01563   23 TPLVRAPRLGErLGGKNLYVKDEGLNPTGSFKDRG------MtvavsKAKElGVKAVACASTGNTSASLAAYAARAGIKC 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 109 TIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpgWVYISPFDDPLIWEGHTSLVKELKETLSAK-PGA 187
Cdd:cd01563   97 VVFLPAGKALGKLAQALAYGATVLAVEGNFDDALRLVRELAEEN--WIYLSNSLNPYRLEGQKTIAFEIAEQLGWEvPDY 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 188 IVLSVGGGGLLCGVVQG---LREVGW-EDVP-IIAMETFGAHSFHAAIKEGKLVTLP--KITSVAKALGV-NTVGA-QTL 258
Cdd:cd01563  175 VVVPVGNGGNITAIWKGfkeLKELGLiDRLPrMVGVQAEGAAPIVRAFKEGKDDIEPveNPETIATAIRIgNPASGpKAL 254
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568937136 259 KLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcRLQDEGRLQTPlASLVVIVCG 329
Cdd:cd01563  255 RAVRESGGTAVAVSDEEILEAQKLLARTEGIFVEPASAASLAGLK-----KLREEGIIDKG-ERVVVVLTG 319
PLN02970 PLN02970
serine racemase
35-338 7.25e-25

serine racemase


Pssm-ID: 215524  Cd Length: 328  Bit Score: 102.83  E-value: 7.25e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  35 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQGCrhfVCSSAGNAGMATAYAARRLGIPATI 110
Cdd:PLN02970  27 RTPVLTSSSLDALAGRSLFFKCECFQKGGAFKFRGacnaIFSLSDDQAEKGV---VTHSSGNHAAALALAAKLRGIPAYI 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 111 VVPNTTPALTIERLKNEGATVeVVGEMLDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLsakPG--AI 188
Cdd:PLN02970 104 VVPKNAPACKVDAVIRYGGII-TWCEPTVESREAVAARVQQETGAVLIHPYNDGRVISGQGTIALEFLEQV---PEldVI 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 189 VLSVGGGGLLCGVVQGLREVGwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVnTVGAQTLklfyehPIFS 268
Cdd:PLN02970 180 IVPISGGGLISGIALAAKAIK-PSIKIIAAEPKGADDAAQSKAAGEIITLPVTNTIADGLRA-SLGDLTW------PVVR 251
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 269 E------VISDQEAVSALEKFVDDEKILVEPACGAALAAVYSrvvcrlqdEGRLQTPLAS----LVVIVCGGsNISLAQL 338
Cdd:PLN02970 252 DlvddviTVDDKEIIEAMKLCYERLKVVVEPSGAIGLAAALS--------DSFRSNPAWKgcknVGIVLSGG-NVDLGVL 322
PRK06608 PRK06608
serine/threonine dehydratase;
35-341 2.93e-24

serine/threonine dehydratase;


Pssm-ID: 235842  Cd Length: 338  Bit Score: 101.39  E-value: 2.93e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  35 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGI-GHLCKMKaKQGCR--HFVCSSAGNAGMATAYAARRLGIPATIV 111
Cdd:PRK06608  23 LTPIVHSESLNEMLGHEIFFKVESLQKTGAFKVRGVlNHLLELK-EQGKLpdKIVAYSTGNHGQAVAYASKLFGIKTRIY 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 112 VPNTTPALTIERLKNEGATVEVVgEMLDEAIQvaKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLS 191
Cdd:PRK06608 102 LPLNTSKVKQQAALYYGGEVILT-NTRQEAEE--KAKEDEEQGFYYIHPSDSDSTIAGAGTLCYEALQQLGFSPDAIFAS 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 192 VGGGGLLCGVVQGLREVGwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKI-TSVAKALGVNTVGAQTLKL------FYEH 264
Cdd:PRK06608 179 CGGGGLISGTYLAKELIS-PTSLLIGSEPLNANDAYLSLKNNKIYRLNYSpNTIADGLKTLSVSARTFEYlkklddFYLV 257
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568937136 265 PIFSEVISDQEAVSALekfvddeKILVEPACGAALAAVYSRVvcrlqdegRLQTPLASLVVIVCGGsNISLAQLQAL 341
Cdd:PRK06608 258 EEYEIYYWTAWLTHLL-------KVICEPSSAINMVAVVNWL--------KTQSKPQKLLVILSGG-NIDPILYNEL 318
PRK06382 PRK06382
threonine dehydratase; Provisional
35-334 2.97e-21

threonine dehydratase; Provisional


Pssm-ID: 180550 [Multi-domain]  Cd Length: 406  Bit Score: 93.80  E-value: 2.97e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  35 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG-IGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVP 113
Cdd:PRK06382  25 RTPLIHSTTFGDEYGGDIYFKLENFQKTGSFKSRGaVFKFSKLSEDELRNGVITASAGNHAQGVAYAASINGIDAKIVMP 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 114 -NTTPAlTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLS---------A 183
Cdd:PRK06382 105 eYTIPQ-KVNAVEAYGAHVILTGRDYDEAHRYADKIAMDE-NRTFIEAFNDRWVISGQGTIGLEIMEDLPdldqiivpvG 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 184 KPGAIVLSVGGGGLLCgvvqglrevgwEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYE 263
Cdd:PRK06382 183 GGGLISGIALAAKHIN-----------PNVKIIGIESELSDSMKASLREGKIVAHTSGVSICDGISVKYPGDLTFDIAKN 251
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568937136 264 HPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcrlqdEGRLQTPLASLVVIVCGGsNIS 334
Cdd:PRK06382 252 YVDDIVTVTEESVSKAIYKLFEREKIVAEPSGAVGLAAIM---------EGKVDVKGKKVAIVVSGG-NIN 312
PRK08638 PRK08638
bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB;
27-181 9.16e-21

bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB;


Pssm-ID: 236317  Cd Length: 333  Bit Score: 91.34  E-value: 9.16e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  27 AAQESLH---VKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG----IGHLCKMKAKQGcrhFVCSSAGNAGMATAY 99
Cdd:PRK08638  16 EAKQRLAgriRKTPLPRSNYLSERCKGEIFLKLENMQRTGSFKIRGafnkLSSLTDAEKRKG---VVACSAGNHAQGVAL 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 100 AARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE 179
Cdd:PRK08638  93 SCALLGIDGKVVMPKGAPKSKVAATCGYGAEVVLHGDNFNDTIAKVEEIVEEE-GRTFIPPYDDPKVIAGQGTIGLEILE 171

                 ..
gi 568937136 180 TL 181
Cdd:PRK08638 172 DL 173
PRK08813 PRK08813
threonine dehydratase; Provisional
52-301 6.45e-20

threonine dehydratase; Provisional


Pssm-ID: 236339  Cd Length: 349  Bit Score: 89.30  E-value: 6.45e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  52 VFLKMDSSQPSGSFKIRG-IGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTPALTIERLKNEGAT 130
Cdd:PRK08813  50 VWLKLENLQRTGSYKVRGaLNALLAGLERGDERPVICASAGNHAQGVAWSAYRLGVQAITVMPHGAPQTKIAGVAHWGAT 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 131 VEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKetlSAKPGAIVLSVGGGGLLCGVVQGLREVGw 210
Cdd:PRK08813 130 VRQHGNSYDEAYAFARELADQN-GYRFLSAFDDPDVIAGQGTVGIELA---AHAPDVVIVPIGGGGLASGVALALKSQG- 204
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 211 edVPIIAMETFGAHSFHAAIKeGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEVISDQEAVSALEKFVDDEKIL 290
Cdd:PRK08813 205 --VRVVGAQVEGVDSMARAIR-GDLREIAPVATLADGVKVKIPGFLTRRLCSSLLDDVVIVREAELRETLVRLALEEHVI 281
                        250
                 ....*....|.
gi 568937136 291 VEPACGAALAA 301
Cdd:PRK08813 282 AEGAGALALAA 292
PRK06352 PRK06352
threonine synthase; Validated
36-306 9.26e-19

threonine synthase; Validated


Pssm-ID: 180539  Cd Length: 351  Bit Score: 85.88  E-value: 9.26e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNT 115
Cdd:PRK06352  29 TPLIPLPNLSKELGVTLYGKYEGLNPTGSFKDRGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEG 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 116 TPAL-TIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPgwVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSVGG 194
Cdd:PRK06352 109 KVALgKLAQAVMYGADIISIQGNFDEALKSVRELAETEA--VTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVLAIPVGN 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 195 GGLLCGVVQGLREvgWEDVPIIAMETFgaHSFH----AAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEV 270
Cdd:PRK06352 187 AGNISAYWKGFKE--WNEAKASGLPRM--HGFEaegaAAIVQGKPIDNPETIATAIRIGNPASWGLAEAARDESGGYIHS 262
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 568937136 271 ISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRV 306
Cdd:PRK06352 263 VTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHV 298
PRK08197 PRK08197
threonine synthase; Validated
36-329 1.14e-18

threonine synthase; Validated


Pssm-ID: 181283 [Multi-domain]  Cd Length: 394  Bit Score: 86.21  E-value: 1.14e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSK-LAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMA-TAYAArRLGIPATIVVP 113
Cdd:PRK08197  80 TPLLPLPRLGKaLGIGRLWVKDEGLNPTGSFKARGLAVGVSRAKELGVKHLAMPTNGNAGAAwAAYAA-RAGIRATIFMP 158
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 114 NTTPALTIERLKNEGATVEVV-GEMLDEAIQVAKALEKNnpGWVYISPFDDPLIWEGHTSLVKELKETLSAK-PGAIVLS 191
Cdd:PRK08197 159 ADAPEITRLECALAGAELYLVdGLISDAGKIVAEAVAEY--GWFDVSTLKEPYRIEGKKTMGLELAEQLGWRlPDVILYP 236
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 192 VGGGGLLCGVVQGLRE---VGW--EDVP-IIAMETFG----AHSFHAAIKEGKL----VTLPKITSVAKALGVNTVgaqt 257
Cdd:PRK08197 237 TGGGVGLIGIWKAFDEleaLGWigGKRPrLVAVQAEGcapiVKAWEEGKEESEFwedaHTVAFGIRVPKALGDFLV---- 312
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 568937136 258 LKLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcRLQDEGRLQtPLASLVVIVCG 329
Cdd:PRK08197 313 LDAVRETGGCAIAVSDDAILAAQRELAREEGLFACPEGAATFAAAR-----QLRESGWLK-GDERVVLFNTG 378
PRK07048 PRK07048
threo-3-hydroxy-L-aspartate ammonia-lyase;
27-341 8.15e-18

threo-3-hydroxy-L-aspartate ammonia-lyase;


Pssm-ID: 235918  Cd Length: 321  Bit Score: 82.76  E-value: 8.15e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  27 AAQESL----HvKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRG-IGHLCKMKAKQGCRHFVCSSAGNAGMATAYAA 101
Cdd:PRK07048  13 AAAARLagvaH-RTPVLTSRTADARTGAQVFFKCENFQRMGAFKFRGaYNALSQFSPEQRRAGVVTFSSGNHAQAIALSA 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 102 RRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKE-- 179
Cdd:PRK07048  92 RLLGIPATIVMPQDAPAAKVAATRGYGGEVVTYDRYTEDREEIGRRLAEER-GLTLIPPYDHPHVIAGQGTAAKELFEev 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 180 ----TLSAKPGAIVLSVGGGGLLCGVVQGLREVGWEdvPIIAMEtfGAHSFHAaikeGKLVTLPKITSVAKalgvntvGA 255
Cdd:PRK07048 171 gpldALFVCLGGGGLLSGCALAARALSPGCKVYGVE--PEAGND--GQQSFRS----GEIVHIDTPRTIAD-------GA 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 256 QTLKL-FYEHPIFSE------VISDQEAVSALEKFVDDEKILVEPACGAALAAVYsrvvcrlqdEGRLQTPLASLVVIVC 328
Cdd:PRK07048 236 QTQHLgNYTFPIIRRlvddivTVSDAELVDAMRFFAERMKIVVEPTGCLGAAAAL---------RGKVPLKGKRVGVIIS 306
                        330
                 ....*....|...
gi 568937136 329 GGsNISLAQLQAL 341
Cdd:PRK07048 307 GG-NVDLARFAAL 318
PRK05638 PRK05638
threonine synthase; Validated
36-301 2.28e-17

threonine synthase; Validated


Pssm-ID: 235539 [Multi-domain]  Cd Length: 442  Bit Score: 82.55  E-value: 2.28e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSKLaGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNT 115
Cdd:PRK05638  67 TPLIRARISEKL-GENVYIKDETRNPTGSFRDRLATVAVSYGLPYAANGFIVASDGNAAASVAAYSARAGKEAFVVVPRK 145
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 116 TPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLSakPGAIVLSVGGG 195
Cdd:PRK05638 146 VDKGKLIQMIAFGAKIIRYGESVDEAIEYAEELARLN-GLYNVTPEYNIIGLEGQKTIAFELWEEIN--PTHVIVPTGSG 222
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 196 GLLCGVVQGLREV----GWEDVP-IIAMETFGAHSFHAAIkegklVTLPKITSVAKALGvntvgaqtlkLFYEHPIFSE- 269
Cdd:PRK05638 223 SYLYSIYKGFKELleigVIEEIPkLIAVQTERCNPIASEI-----LGNKTKCNETKALG----------LYVKNPVMKEy 287
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 568937136 270 ------------VISDQEAVSALEKFVDDEKILVEPACGAALAA 301
Cdd:PRK05638 288 vseaikesggtaVVVNEEEIMAGEKLLAKEGIFAELSSAVVMPA 331
CBS_like cd01561
CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS ...
35-315 4.47e-17

CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine. Deficiency of CBS leads to homocystinuria, an inherited disease of sulfur metabolism characterized by increased levels of the toxic metabolite homocysteine. Cysteine synthase on the other hand catalyzes the last step of cysteine biosynthesis. This subgroup also includes an O-Phosphoserine sulfhydrylase found in hyperthermophilic archaea which produces L-cysteine from sulfide and the more thermostable O-phospho-L-serine.


Pssm-ID: 107204  Cd Length: 291  Bit Score: 80.25  E-value: 4.47e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  35 KTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGC----RHFVCSSAGNAGMATAYAARRLGIPATI 110
Cdd:cd01561    2 NTPLVRLNRLSPGTGAEIYAKLEFFNPGGSVKDRIALYMIEDAEKRGLlkpgTTIIEPTSGNTGIGLAMVAAAKGYRFII 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 111 VVPNTTPALTIERLKNEGATVEVVGEMLDE----AIQVAKALEKNNPGWVYISPFDDPLIWEGH-TSLVKELKETLSAKP 185
Cdd:cd01561   82 VMPETMSEEKRKLLRALGAEVILTPEAEADgmkgAIAKARELAAETPNAFWLNQFENPANPEAHyETTAPEIWEQLDGKV 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 186 GAIVLSVGGGGLLCGVVQGLREVgWEDVPIIAMETFGAHSF-----HAAIKEGklvtlpkitsvakaLGVNTVGAqtlkl 260
Cdd:cd01561  162 DAFVAGVGTGGTITGVARYLKEK-NPNVRIVGVDPVGSVLFsggppGPHKIEG--------------IGAGFIPE----- 221
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568937136 261 FYEHPIFSEV--ISDQEAVSALEKFVDDEKILVEPACGAALAAVY---------SRVVCRLQDEGR 315
Cdd:cd01561  222 NLDRSLIDEVvrVSDEEAFAMARRLAREEGLLVGGSSGAAVAAALklakrlgpgKTIVTILPDSGE 287
CysK COG0031
Cysteine synthase [Amino acid transport and metabolism];
36-328 3.36e-15

Cysteine synthase [Amino acid transport and metabolism];


Pssm-ID: 223110  Cd Length: 300  Bit Score: 74.88  E-value: 3.36e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRgIGH------LCKMKAKQGcRHFVCSSAGNAGMATAYAARRLGIPAT 109
Cdd:COG0031   12 TPLVRLNRLSPGTGVEIYAKLESFNPGGSVKDR-IALymiedaEKRGLLKPG-GTIVEATSGNTGIALAMVAAAKGYRLI 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 110 IVVPNTTPALTIERLKNEGATVEVV---GEMLDEAIQVAKALEKNNPGWVYISP-FDDPLIWEGH-TSLVKELKETLSAK 184
Cdd:COG0031   90 IVMPETMSQERRKLLRALGAEVILTpgaPGNMKGAIERAKELAAEIPGYAVWLNqFENPANPEAHyETTGPEIWQQTDGK 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 185 PGAIVLSVGGGGLLCGVVQGLREVgWEDVPIIAMETFGAHSFHAAIKEGKLvtlpkitsvaKALGVNTVgaqTLKLFYEH 264
Cdd:COG0031  170 VDAFVAGVGTGGTITGVARYLKER-NPNVRIVAVDPEGSVLLSGGEGPHKI----------EGIGAGFV---PENLDLDL 235
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 568937136 265 PIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVysRVVCRLQDEGrlqtplASLVVIVC 328
Cdd:COG0031  236 IDEVIRVSDEEAIATARRLAREEGLLVGISSGAALAAA--LKLAKELPAG------KTIVTILP 291
ThrC COG0498
Threonine synthase [Amino acid transport and metabolism];
36-301 4.28e-14

Threonine synthase [Amino acid transport and metabolism];


Pssm-ID: 223572 [Multi-domain]  Cd Length: 411  Bit Score: 72.74  E-value: 4.28e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALS---KLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVV 112
Cdd:COG0498   77 TPLYKAPALAaplGVLNDNLYVKELGHNPTGSFKDRGMTVLVSLAKELGAKTILCASSGNTGASAAAYAARAGLKVFVLY 156
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 113 PNT-TPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFDDPLIWEGHTSLVKELKETLSAK------- 184
Cdd:COG0498  157 PKGkVSPGKLAQMLTLGAHVIAVDGNFDDAQELVKEAANRE-GLLSAVNSINPYRLEGQKTYAFEIAEQLGWKapdhvvv 235
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 185 P----GAIVLSVGGGGLlcgvvqgLREVGW-EDVP-IIAMETFGAHSFHAAIKEGKLVtlPKITSVAKALGVNTVGAQTL 258
Cdd:COG0498  236 PvgngGNLLAIYKGFKE-------GLPIGKiDKAPnMNGVQAEGFSPGVYAWKEGRET--PETIAPAMDIGNPSNWERAL 306
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 568937136 259 KLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAA 301
Cdd:COG0498  307 FALRESGGLAVAVSDEEILEAIKLLAEREGILIEPHSAVAVAA 349
PRK06721 PRK06721
threonine synthase; Reviewed
36-306 1.32e-12

threonine synthase; Reviewed


Pssm-ID: 136018  Cd Length: 352  Bit Score: 67.79  E-value: 1.32e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNT 115
Cdd:PRK06721  29 TPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEG 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 116 TPAL-TIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPgwVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSVGG 194
Cdd:PRK06721 109 KIAHgKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEP--ITLVNSVNPYRIEGQKTAAFEICDQLQRAPDVLAIPVGN 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 195 GGLLCGVVQGL----REVGWEDVPIIAMETFGAhsfhAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEV 270
Cdd:PRK06721 187 AGNITAYWKGFceyeKEKGYKKPRIHGFEAEGA----AAIVKGHVIDEPETIATAIRIGNPASWSYAVEAAEQSHGEIDM 262
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 568937136 271 ISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRV 306
Cdd:PRK06721 263 VSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHV 298
PRK07409 PRK07409
threonine synthase; Validated
36-114 1.84e-10

threonine synthase; Validated


Pssm-ID: 236013  Cd Length: 353  Bit Score: 61.37  E-value: 1.84e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGighlckM-----KAK-QGCRHFVCSSAGN-AGMATAYAArRLGIPA 108
Cdd:PRK07409  32 TPLIPAPNLSELLGVEVYVKYEGLNPTGSFKDRG------MtmavtKAKeEGAKAVICASTGNtSASAAAYAA-RAGLKA 104

                 ....*.
gi 568937136 109 TIVVPN 114
Cdd:PRK07409 105 FVLIPE 110
PRK06450 PRK06450
threonine synthase; Validated
49-301 3.24e-10

threonine synthase; Validated


Pssm-ID: 180565 [Multi-domain]  Cd Length: 338  Bit Score: 60.52  E-value: 3.24e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  49 GTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTPALTIERLKNEG 128
Cdd:PRK06450  64 KGNIWFKLDFLNPTGSYKDRGSVTLISYLAEKGIKQISEDSSGNAGASIAAYGAAAGIEVKIFVPETASGGKLKQIESYG 143
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 129 ATVEVVGEMLDEaiqVAKALEknNPGWVYISPFDDPLIWEGHTSLVKELKETLSAK-PGAIVLSVGGGGLLCGVVQGLR- 206
Cdd:PRK06450 144 AEVVRVRGSRED---VAKAAE--NSGYYYASHVLQPQFRDGIRTLAYEIAKDLDWKiPNYVFIPVSAGTLLLGVYSGFKh 218
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 207 --EVG-WEDVP-IIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALgvntVGAQTLKLFYEHPIFSE-----VISDQEAV 277
Cdd:PRK06450 219 llDSGvISEMPkIVAVQTEQVSPLCAKFKGISYTPPDKVTSIADAL----VSTRPFLLDYMVKALSEygeciVVSDNEIV 294
                        250       260
                 ....*....|....*....|....
gi 568937136 278 SAlEKFVDDEKILVEPACGAALAA 301
Cdd:PRK06450 295 EA-WKELAKKGLLVEYSSATVYAA 317
PRK06110 PRK06110
threonine dehydratase;
44-338 3.75e-10

threonine dehydratase;


Pssm-ID: 235699  Cd Length: 322  Bit Score: 60.39  E-value: 3.75e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  44 LSKLAGTSVFLKMDSSQPSGSFKIRG-IGHLCKMKAKQ-GCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTpalTI 121
Cdd:PRK06110  30 LAERLGCEVWVKHENHTPTGAFKVRGgLVYFDRLARRGpRVRGVISATRGNHGQSVAFAARRHGLAATIVVPHGN---SV 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 122 ErlKNE-----GATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFddpliwegHTSLVKELK----ETLSAKP------- 185
Cdd:PRK06110 107 E--KNAamralGAELIEHGEDFQAAREEAARLAAER-GLHMVPSF--------HPDLVRGVAtyalELFRAVPdldvvyv 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 186 ---------GAIVLSvggggllcgvvqglREVGWeDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQ 256
Cdd:PRK06110 176 pigmgsgicGAIAAR--------------DALGL-KTRIVGVVSAHAPAYALSFEAGRVVTTPVATTLADGMACRTPDPE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 257 TLKLFYEHpiFSEVI--SDQEAVSALEKFVDDEKILVEPACGAALAAVysrvvcrLQDEGRLQtplASLVVIVCGGSNIS 334
Cdd:PRK06110 241 ALEVIRAG--ADRIVrvTDDEVAAAMRAYFTDTHNVAEGAGAAALAAA-------LQERERLA---GKRVGLVLSGGNID 308

                 ....
gi 568937136 335 LAQL 338
Cdd:PRK06110 309 RAVF 312
PRK08329 PRK08329
threonine synthase; Validated
49-335 6.80e-09

threonine synthase; Validated


Pssm-ID: 236244 [Multi-domain]  Cd Length: 347  Bit Score: 56.37  E-value: 6.80e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  49 GTSVFLKMDSSQPSGSFKIRGIG-HLCKMKaKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTPALTIERLKNE 127
Cdd:PRK08329  71 SIKVYFKLDYLQPTGSFKDRGTYvTVAKLK-EEGINEVVIDSSGNAALSLALYSLSEGIKVHVFVSYNASKEKISLLSRL 149
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 128 GATVEVVG----EMLDEAIQVAKaleknNPGWVYISPFDDPLIWEGHTSLVKELKETLSAkPGAIVLSVGGGGLLCGVVQ 203
Cdd:PRK08329 150 GAELHFVEgdrmEVHEEAVKFSK-----RNNIPYVSHWLNPYFLEGTKTIAYEIYEQIGV-PDYAFVPVGSGTLFLGIWK 223
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 204 G---LREVG-WEDVP-IIAMETFGAHSF-HAAIKEGKLVTLPKITSVAKAlgvntvgAQTLKLFYEHPIFSEVISDQEAV 277
Cdd:PRK08329 224 GfkeLHEMGeISKMPkLVAVQAEGYESLcKRSKSENKLADGIAIPEPPRK-------EEMLRALEESNGFCISVGEEETR 296
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 568937136 278 SALEKFVdDEKILVEPACGAALAAVYSrvvcrLQDEGRLQTplASLVVIVCGGSNISL 335
Cdd:PRK08329 297 AALHWLR-RMGFLVEPTSAVALAAYWK-----LLEEGLIEG--GSKVLLPLSGSGLKN 346
PRK08206 PRK08206
diaminopropionate ammonia-lyase; Provisional
19-159 6.11e-08

diaminopropionate ammonia-lyase; Provisional


Pssm-ID: 236186  Cd Length: 399  Bit Score: 53.73  E-value: 6.11e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  19 REPLFTAMAAQESL--------HVKTPLRDSMALSKLAGT-SVFLKmDSSQPSG--SFKIRG-----IGHLCKM------ 76
Cdd:PRK08206  20 DLPLLSQEEAKKARafhqsfpgYAPTPLVALPDLAAELGVgSILVK-DESYRFGlnAFKALGgayavARLLAEKlgldis 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  77 ------------KAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTpalTIERLKN---EGATVEVVGEMLDEA 141
Cdd:PRK08206  99 elsfeeltsgevREKLGDITFATATDGNHGRGVAWAAQQLGQKAVIYMPKGS---SEERVDAiraLGAECIITDGNYDDS 175
                        170
                 ....*....|....*...
gi 568937136 142 IQVAKALEKNNpGWVYIS 159
Cdd:PRK08206 176 VRLAAQEAQEN-GWVVVQ 192
PRK06381 PRK06381
threonine synthase; Validated
36-188 7.41e-07

threonine synthase; Validated


Pssm-ID: 235789  Cd Length: 319  Bit Score: 50.09  E-value: 7.41e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSKLAGTS-VFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPN 114
Cdd:PRK06381  16 TPLLRARKLEEELGLRkIYLKFEGANPTGTQKDRIAEAHVRRAMRLGYSGITVGTCGNYGASIAYFARLYGLKAVIFIPR 95
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568937136 115 TTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNpGWVYISPFD--DPLIWEGHTSLVKELKETLSAKPGAI 188
Cdd:PRK06381  96 SYSNSRVKEMEKYGAEIIYVDGKYEEAVERSRKFAKEN-GIYDANPGSvnSVVDIEAYSAIAYEIYEALGDVPDAV 170
PRK07591 PRK07591
threonine synthase; Validated
36-329 3.29e-06

threonine synthase; Validated


Pssm-ID: 236065 [Multi-domain]  Cd Length: 421  Bit Score: 48.42  E-value: 3.29e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSKLAG-TSVFLKMDSSQPSGSFKIRGIGhLCKMKAKQ-GCRHFVCSSAGNAGMATAYAARRLGIPATIVVP 113
Cdd:PRK07591  90 TPLVKADRLARELGlKNLYIKDDSVNPTHSFKDRVVS-VALTAARElGFTTVACASTGNLANSVAAHAARAGLDSCVFIP 168
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 114 -NTTPALTIERLKNEGATVEVVGEMlDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAK-PGAIVLS 191
Cdd:PRK07591 169 aDLEAGKIVGTLVYGPTLVAVDGNY-DDVNRLCSELANEHEGWGFVNINLRPYYAEGSKTLGYEVAEQLGWRlPDQVVAP 247
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 192 VGGGGLLCGVVQGLRE---VGW-EDVPIiamETFGAHS-----FHAAIKEGKLVTLP-KITSVAK--ALGVNTVGAQTLK 259
Cdd:PRK07591 248 LASGSLLTKIDKGFQElikVGLvEDKPV---RVFGAQAegcspIAQAFKEGRDVVKPvKPNTIAKslAIGNPADGPYALD 324
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 260 LFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAavysrVVCRLQDEGRLQtPLASLVVIVCG 329
Cdd:PRK07591 325 IARRTGGAIEDVTDEEIIEGIKLLARTEGIFTETAGGVTVA-----VLKKLVEAGKID-PDEETVVYITG 388
PRK06260 PRK06260
threonine synthase; Validated
36-301 4.53e-06

threonine synthase; Validated


Pssm-ID: 235757 [Multi-domain]  Cd Length: 397  Bit Score: 48.00  E-value: 4.53e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSKLAG-TSVFLKMDSSQPSGSFKIRGighlckM-----KAKQ-GCRHFVCSSAGN--AGMAtAYAARRlGI 106
Cdd:PRK06260  68 TPLYRCPNLEKELGvKELYVKHEGANPTGSFKDRG------MtvgvtKALElGVKTVACASTGNtsASLA-AYAARA-GL 139
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 107 PATIVVPNTTPAL-TIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPgwVY----ISPFD------------DPLIWE- 168
Cdd:PRK06260 140 KCYVLLPAGKVALgKLAQALLHGAKVLEVDGNFDDALDMVVELAKEGK--IYllnsINPFRlegqktigfeiaDQLGWEv 217
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136 169 -----------GHTSLV----KELKETlsakpGAIvlsvggggllcgvvqglrevgwEDVP-IIAMETFGAHSFHAAIKE 232
Cdd:PRK06260 218 pdrvvlpvgnaGNISAIwkgfKELVEL-----GII----------------------DKLPkMTGIQAEGAAPIVEAIKK 270
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568937136 233 GKLVTLP--KITSVAKA--LG--VNTVGAqtLKLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAA 301
Cdd:PRK06260 271 GKDEIEPveNPETVATAirIGnpVNAPKA--LRAIRESGGTAEAVSDEEILDAQKLLARKEGIGVEPASAASVAG 343
PLN02569 PLN02569
threonine synthase
61-131 2.47e-03

threonine synthase


Pssm-ID: 178182 [Multi-domain]  Cd Length: 484  Bit Score: 39.41  E-value: 2.47e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568937136  61 PSGSFKIRGIGHLCKM-----KAKQGCRHFVCSSAGNAGMA-TAYAARrLGIPATIVVPNTTPALT--IERLKNeGATV 131
Cdd:PLN02569 161 HTGSFKDLGMTVLVSQvnrlrKMAKPVVGVGCASTGDTSAAlSAYCAA-AGIPSIVFLPADKISIAqlVQPIAN-GALV 237
PRK13803 PRK13803
bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional
36-145 2.99e-03

bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional


Pssm-ID: 237513 [Multi-domain]  Cd Length: 610  Bit Score: 39.41  E-value: 2.99e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568937136  36 TPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIR---GIGHLCKMKAKQgcRHFVCSSAGNAGMATAYAARRLGIPATIVV 112
Cdd:PRK13803 272 TPLTEAKRLSDIYGARIYLKREDLNHTGSHKINnalGQALLAKRMGKT--RIIAETGAGQHGVATATACALFGLKCTIFM 349
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 568937136 113 PNTT---PALTIERLKNEGATVEVV---GEMLDEAIQVA 145
Cdd:PRK13803 350 GEEDikrQALNVERMKLLGANVIPVlsgSKTLKDAVNEA 388
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH