NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568957135|ref|XP_006531226|]
View 

protein NLRC5 isoform X1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Atypical_Card pfam18461
Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts ...
1-94 2.98e-46

Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts a six alpha-helix bundle with a general death fold. Structure and sequence analysis of the NLRC5-N indicate that it possesses a fold similar to the one of the death-fold domains; however, it displays significant differences in the number of core alpha-helices and their relative orientation. Hence, it is suggested that NLRC5 belongs to the caspase recruitment domain (CARD) subfamily as an atypical CARD.


:

Pssm-ID: 408254  Cd Length: 95  Bit Score: 161.32  E-value: 2.98e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135     1 MDAESIRLNNENLWAWLVRLLSKNPEWLSAKLRSFLPTMDLDCSYEPSNP-EVIHRQLNRLFAQGMATWKSFINDLCFEL 79
Cdd:pfam18461    1 MDPLSLQLGTENLWPWLVRLLSKDPEWLLAKVKFFLPNMDLSSVNEAPDPkQKVSLQLRRLEAQGLATWKSFIQCVCMEL 80
                           90
                   ....*....|....*
gi 568957135    80 DVPLDMEIPLVSIWG 94
Cdd:pfam18461   81 EVPLDLEVPLLSTWG 95
LRR_RI super family cl39015
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1520-1782 4.42e-31

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


The actual alignment was detected with superfamily member cd00116:

Pssm-ID: 423007 [Multi-domain]  Cd Length: 319  Bit Score: 125.55  E-value: 4.42e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1520 HHLEELDFSNNSLREEDTELLMGALQGTCRLKKLHLSFLPLGAS--SLALLIQGLSRMTLLQDLCLSHNQIGDVGTQCLA 1597
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLSDNALGPDGCGVLE 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1598 AILpKLPELRKFDLSHNQIGDVGTQCLAAILPKLPE-LRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRNQIGDVG 1676
Cdd:cd00116   103 SLL-RSSSLQELKLNNNGLGDRGLRLLAKGLKDLPPaLEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAG 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1677 TQCLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEPTALELAQRLP---PQLRVLCLPSSH 1753
Cdd:cd00116   182 IRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLspnISLLTLSLSCND 261
                         250       260
                  ....*....|....*....|....*....
gi 568957135 1754 LGPEGALGLAQALEQCPHIEEVSLAENNL 1782
Cdd:cd00116   262 ITDDGAKDLAEVLAEKESLLELDLRGNKF 290
NACHT pfam05729
NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in ...
223-385 1.35e-30

NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.


:

Pssm-ID: 399032  Cd Length: 166  Bit Score: 119.33  E-value: 1.35e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135   223 RVTVLLGKAGMGKTTLAYRLRWRWAQGQLDR-FQALFLFEFRQLNMITQLPTLPQLLFDLYLMPESEPDAVFQYLKENAQ 301
Cdd:pfam05729    1 RTVILQGEAGSGKTTLLQKIALLWAQGKLPQgFDFVFFLPCRELSRSGNARSLADLLFSQWPEPAAPVSEVWAVILELPE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135   302 EVLLIFDGLDEALHADSVgTDNAGSALTLFSELCHGNLLPGCWVMTTSRPG---KLPSCVPtEAATVHMWGFDGLRVEKY 378
Cdd:pfam05729   81 RLLLILDGLDELVSDLGQ-LDGPCPVLTLLSSLLRKKLLPGASLLLTVRPDalrDLRRGLE-EPRYLEVRGFSEDDRKQY 158

                   ....*..
gi 568957135   379 VTCFFSD 385
Cdd:pfam05729  159 VRKYFSD 165
LRR_RI super family cl39015
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
735-1045 1.52e-13

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


The actual alignment was detected with superfamily member cd00116:

Pssm-ID: 423007 [Multi-domain]  Cd Length: 319  Bit Score: 73.54  E-value: 1.52e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  735 SHLIQTLPLCSQLEEVSLHDNQLKDPEVLSLVELLPSLPKLQKLDLSRNSFSRS--ILLSLVKVAITCPTVRKLQVRELD 812
Cdd:cd00116    13 ERATELLPKLLCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLSDNA 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  813 LIFYLSPVTETATQ----------QSGASDVQGK---DSLKEGQSRSLQLRLQKCQLRIRDAEALVELFQKSPQLEEVNL 879
Cdd:cd00116    93 LGPDGCGVLESLLRssslqelklnNNGLGDRGLRllaKGLKDLPPALEKLVLGRNRLEGASCEALAKALRANRDLKELNL 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  880 SGNHLEDDGCRLVAEAASQLHIAQKLDLSDNGLSQTGVTYVLKAMSTCGTLEDLHIsllnntvvltfaqepreqeGSCKG 959
Cdd:cd00116   173 ANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNL-------------------GDNNL 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  960 RAPLISFVSPVTSELSQRSRRIRLTHCGFLAKHTETLCEALRASCQthnLDHLDLSDNSLGGKGVILLTELLPGLGP-LK 1038
Cdd:cd00116   234 TDAGAAALASALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKES---LLELDLRGNKFGEEGAQLLAESLLEPGNeLE 310

                  ....*..
gi 568957135 1039 SLNLSRN 1045
Cdd:cd00116   311 SLWVKDD 317
LRR_RI super family cl39015
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
611-895 3.02e-12

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


The actual alignment was detected with superfamily member cd00116:

Pssm-ID: 423007 [Multi-domain]  Cd Length: 319  Bit Score: 69.69  E-value: 3.02e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  611 TGPKMIELYHCVAETQDLELARFtaQSLPSRLSFHNFPLTHADLaalanilehrdDPIHLDFDGCPLePHCPEAL--VGC 688
Cdd:cd00116    79 KGCGLQELDLSDNALGPDGCGVL--ESLLRSSSLQELKLNNNGL-----------GDRGLRLLAKGL-KDLPPALekLVL 144
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  689 GQvenlsfksRKCGDAFAEALCRSLPTMGSLKTLGLTGSRITAQGISHLIQTLPLCSQLEEVSLHDNQLKDPEVLSLVEL 768
Cdd:cd00116   145 GR--------NRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAET 216
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  769 LPSLPKLQKLDLSRNSFSRSILLSLvkvaitcptvrklqvreldlifylspvtetatqqsgasdvqgKDSLKEGQSRSLQ 848
Cdd:cd00116   217 LASLKSLEVLNLGDNNLTDAGAAAL------------------------------------------ASALLSPNISLLT 254
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*..
gi 568957135  849 LRLQKCQLRIRDAEALVELFQKSPQLEEVNLSGNHLEDDGCRLVAEA 895
Cdd:cd00116   255 LSLSCNDITDDGAKDLAEVLAEKESLLELDLRGNKFGEEGAQLLAES 301
NLRC4_HD2 super family cl39284
NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein ...
517-632 1.00e-09

NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein and NOD2 protein.


The actual alignment was detected with superfamily member pfam17776:

Pssm-ID: 407648  Cd Length: 122  Bit Score: 58.06  E-value: 1.00e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135   517 HLSLQEFFAALYLMASHTVDK-DTLVEYVTLNSHWVLRT------KGRLGLSDHLPAFLAGLASHTCHMFLCQLaQQDRA 589
Cdd:pfam17776    1 HLSFQEFFAALYYVLSFKEEKsNPLKEFLGLKKRESLKSaldkalKSKNGHLDLFLRFLFGLLNESNQRLLEGL-LGCKL 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
gi 568957135   590 WVGSRQaAVIQVLRKLASRKLTGPKMIELYHCVAETQDLELAR 632
Cdd:pfam17776   80 SSEIKQ-ELLQWLKELIQKELSSERFLNLFHCLYELQDESFVK 121
LRR_RI super family cl39015
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1007-1307 2.70e-06

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


The actual alignment was detected with superfamily member cd00116:

Pssm-ID: 423007 [Multi-domain]  Cd Length: 319  Bit Score: 51.59  E-value: 2.70e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1007 HNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMD--AVFSLVQCLSSLQWVFHLDVSlesDCIFLrgagt 1084
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLS---DNALG----- 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1085 srdalepkfQTGVQVLE-LSQRYTSRSFCLQECQLEPTSLTFLCAtlekspGPLEVQLSCKSLsddslkILLQCLpqlpq 1163
Cdd:cd00116    95 ---------PDGCGVLEsLLRSSSLQELKLNNNGLGDRGLRLLAK------GLKDLPPALEKL------VLGRNR----- 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1164 lsllqlrhtvLSSRSPFLLADIFNLCPRVRKVTL----------RSLCHAVLHFdsneeQEGVCCGFPGCSLSQEHMETL 1233
Cdd:cd00116   149 ----------LEGASCEALAKALRANRDLKELNLanngigdagiRALAEGLKAN-----CNLEVLDLNNNGLTDEGASAL 213
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568957135 1234 CCALSKCNALSQLDLTDNLLGDIGLRCLLECLPQLPIS-GWLDLSHNNISQEGILYLLETLPSYPNIQEVSVSLS 1307
Cdd:cd00116   214 AETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNISlLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGN 288
PPP1R42 super family cl40577
protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 ...
1766-1865 3.83e-03

protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 (PPP1R42), also known as leucine-rich repeat-containing protein 67 (lrrc67) or testis leucine-rich repeat (TLRR) protein, plays a role in centrosome separation. PPP1R42 has been shown to interact with the well-conserved signaling protein phosphatase-1 (PP1) and thereby increasing PP1's activity, which counters centrosome separation. Inhibition of PPP1R42 expression increases the number of centrosomes per cell while its depletion reduces the activity of PP1 leading to activation of NEK2, the kinase responsible for phosphorylation of centrosomal linker proteins promoting centrosome separation.


The actual alignment was detected with superfamily member cd21340:

Pssm-ID: 411060 [Multi-domain]  Cd Length: 220  Bit Score: 40.92  E-value: 3.83e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1766 LEQCPHIEEVSLAENNLAGGVP-RFSKR-----LPLLRQIDLEFCKIEDqaarhlAANLTLFPALEKLLLSGNLLGDevA 1839
Cdd:cd21340    86 LENLTNLEELHIENQRLPPGEKlTFDPRslaalSNSLRVLNISGNNIDS------LEPLAPLRNLEQLDASNNQISD--L 157
                          90       100
                  ....*....|....*....|....*.
gi 568957135 1840 AELAQVLPQMGQLKKVNLEWNRITAR 1865
Cdd:cd21340   158 EELLDLLSSWPSLRELDLTGNPVCKK 183
 
Name Accession Description Interval E-value
Atypical_Card pfam18461
Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts ...
1-94 2.98e-46

Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts a six alpha-helix bundle with a general death fold. Structure and sequence analysis of the NLRC5-N indicate that it possesses a fold similar to the one of the death-fold domains; however, it displays significant differences in the number of core alpha-helices and their relative orientation. Hence, it is suggested that NLRC5 belongs to the caspase recruitment domain (CARD) subfamily as an atypical CARD.


Pssm-ID: 408254  Cd Length: 95  Bit Score: 161.32  E-value: 2.98e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135     1 MDAESIRLNNENLWAWLVRLLSKNPEWLSAKLRSFLPTMDLDCSYEPSNP-EVIHRQLNRLFAQGMATWKSFINDLCFEL 79
Cdd:pfam18461    1 MDPLSLQLGTENLWPWLVRLLSKDPEWLLAKVKFFLPNMDLSSVNEAPDPkQKVSLQLRRLEAQGLATWKSFIQCVCMEL 80
                           90
                   ....*....|....*
gi 568957135    80 DVPLDMEIPLVSIWG 94
Cdd:pfam18461   81 EVPLDLEVPLLSTWG 95
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1520-1782 4.42e-31

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 125.55  E-value: 4.42e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1520 HHLEELDFSNNSLREEDTELLMGALQGTCRLKKLHLSFLPLGAS--SLALLIQGLSRMTLLQDLCLSHNQIGDVGTQCLA 1597
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLSDNALGPDGCGVLE 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1598 AILpKLPELRKFDLSHNQIGDVGTQCLAAILPKLPE-LRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRNQIGDVG 1676
Cdd:cd00116   103 SLL-RSSSLQELKLNNNGLGDRGLRLLAKGLKDLPPaLEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAG 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1677 TQCLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEPTALELAQRLP---PQLRVLCLPSSH 1753
Cdd:cd00116   182 IRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLspnISLLTLSLSCND 261
                         250       260
                  ....*....|....*....|....*....
gi 568957135 1754 LGPEGALGLAQALEQCPHIEEVSLAENNL 1782
Cdd:cd00116   262 ITDDGAKDLAEVLAEKESLLELDLRGNKF 290
NACHT pfam05729
NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in ...
223-385 1.35e-30

NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.


Pssm-ID: 399032  Cd Length: 166  Bit Score: 119.33  E-value: 1.35e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135   223 RVTVLLGKAGMGKTTLAYRLRWRWAQGQLDR-FQALFLFEFRQLNMITQLPTLPQLLFDLYLMPESEPDAVFQYLKENAQ 301
Cdd:pfam05729    1 RTVILQGEAGSGKTTLLQKIALLWAQGKLPQgFDFVFFLPCRELSRSGNARSLADLLFSQWPEPAAPVSEVWAVILELPE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135   302 EVLLIFDGLDEALHADSVgTDNAGSALTLFSELCHGNLLPGCWVMTTSRPG---KLPSCVPtEAATVHMWGFDGLRVEKY 378
Cdd:pfam05729   81 RLLLILDGLDELVSDLGQ-LDGPCPVLTLLSSLLRKKLLPGASLLLTVRPDalrDLRRGLE-EPRYLEVRGFSEDDRKQY 158

                   ....*..
gi 568957135   379 VTCFFSD 385
Cdd:pfam05729  159 VRKYFSD 165
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
735-1045 1.52e-13

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 73.54  E-value: 1.52e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  735 SHLIQTLPLCSQLEEVSLHDNQLKDPEVLSLVELLPSLPKLQKLDLSRNSFSRS--ILLSLVKVAITCPTVRKLQVRELD 812
Cdd:cd00116    13 ERATELLPKLLCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLSDNA 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  813 LIFYLSPVTETATQ----------QSGASDVQGK---DSLKEGQSRSLQLRLQKCQLRIRDAEALVELFQKSPQLEEVNL 879
Cdd:cd00116    93 LGPDGCGVLESLLRssslqelklnNNGLGDRGLRllaKGLKDLPPALEKLVLGRNRLEGASCEALAKALRANRDLKELNL 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  880 SGNHLEDDGCRLVAEAASQLHIAQKLDLSDNGLSQTGVTYVLKAMSTCGTLEDLHIsllnntvvltfaqepreqeGSCKG 959
Cdd:cd00116   173 ANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNL-------------------GDNNL 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  960 RAPLISFVSPVTSELSQRSRRIRLTHCGFLAKHTETLCEALRASCQthnLDHLDLSDNSLGGKGVILLTELLPGLGP-LK 1038
Cdd:cd00116   234 TDAGAAALASALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKES---LLELDLRGNKFGEEGAQLLAESLLEPGNeLE 310

                  ....*..
gi 568957135 1039 SLNLSRN 1045
Cdd:cd00116   311 SLWVKDD 317
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
611-895 3.02e-12

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 69.69  E-value: 3.02e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  611 TGPKMIELYHCVAETQDLELARFtaQSLPSRLSFHNFPLTHADLaalanilehrdDPIHLDFDGCPLePHCPEAL--VGC 688
Cdd:cd00116    79 KGCGLQELDLSDNALGPDGCGVL--ESLLRSSSLQELKLNNNGL-----------GDRGLRLLAKGL-KDLPPALekLVL 144
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  689 GQvenlsfksRKCGDAFAEALCRSLPTMGSLKTLGLTGSRITAQGISHLIQTLPLCSQLEEVSLHDNQLKDPEVLSLVEL 768
Cdd:cd00116   145 GR--------NRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAET 216
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  769 LPSLPKLQKLDLSRNSFSRSILLSLvkvaitcptvrklqvreldlifylspvtetatqqsgasdvqgKDSLKEGQSRSLQ 848
Cdd:cd00116   217 LASLKSLEVLNLGDNNLTDAGAAAL------------------------------------------ASALLSPNISLLT 254
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*..
gi 568957135  849 LRLQKCQLRIRDAEALVELFQKSPQLEEVNLSGNHLEDDGCRLVAEA 895
Cdd:cd00116   255 LSLSCNDITDDGAKDLAEVLAEKESLLELDLRGNKFGEEGAQLLAES 301
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
1408-1736 5.31e-11

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 66.92  E-value: 5.31e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1408 LTELSISEIQRKLWLQLEFPHQ-EGNSDSMALRLAHCDLETehshlmIQLVETY--ARLQQLSLSQVSFNDNDGTSSKLL 1484
Cdd:COG4886    28 TTPQSINLNFPDSNLESVAVNRlALNLSSNTLLLLPSSLSR------LLSLDLLspSGISSLDGSENLLNLLPLPSLDLN 101
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1485 QNILLSSCEL-----KSFRLTFSQVSTKSLTHLAFGLGHchHLEELDFSNNSLREEDTELlmGALQGtcrLKKLHLSFLP 1559
Cdd:COG4886   102 LNRLRSNISElleltNLTSLDLDNNNITDIPPLIGLLKS--NLKELDLSDNKIESLPSPL--RNLPN---LKNLDLSFND 174
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1560 LgaSSLALLIQGLsrmTLLQDLCLSHNQIGDVgtQCLAAILPKLPELrkfDLSHNQIgdvgTQCLAAiLPKLPELRKFNL 1639
Cdd:COG4886   175 L--SDLPKLLSNL---SNLNNLDLSGNKISDL--PPEIELLSALEEL---DLSNNSI----IELLSS-LSNLKNLSGLEL 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1640 SHNQIghvgtQCLAAILPKLPELRKFDLSRNQIGDVGtqclaaILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLE 1719
Cdd:COG4886   240 SNNKL-----EDLPESIGNLSNLETLDLSNNQISSIS------SLGSLTNLRELDLSGNSLSNALPLIALLLLLLELLLN 308
                         330
                  ....*....|....*..
gi 568957135 1720 EIKLGNNALGEPTALEL 1736
Cdd:COG4886   309 LLLTLKALELKLNSILL 325
NLRC4_HD2 pfam17776
NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein ...
517-632 1.00e-09

NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein and NOD2 protein.


Pssm-ID: 407648  Cd Length: 122  Bit Score: 58.06  E-value: 1.00e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135   517 HLSLQEFFAALYLMASHTVDK-DTLVEYVTLNSHWVLRT------KGRLGLSDHLPAFLAGLASHTCHMFLCQLaQQDRA 589
Cdd:pfam17776    1 HLSFQEFFAALYYVLSFKEEKsNPLKEFLGLKKRESLKSaldkalKSKNGHLDLFLRFLFGLLNESNQRLLEGL-LGCKL 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
gi 568957135   590 WVGSRQaAVIQVLRKLASRKLTGPKMIELYHCVAETQDLELAR 632
Cdd:pfam17776   80 SSEIKQ-ELLQWLKELIQKELSSERFLNLFHCLYELQDESFVK 121
internalin_A NF033189
class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria ...
1501-1734 8.22e-08

class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.


Pssm-ID: 380193 [Multi-domain]  Cd Length: 799  Bit Score: 57.50  E-value: 8.22e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1501 FSQVSTKSLTHLAF----GLGHCHHLEELDFSNNSLRE----EDTELLMGALQGTCRLKKL----HLSFLplgaSSLALL 1568
Cdd:NF033189   74 LDQVTTLQADRLGIksidGLEYLNNLTQINFSNNQLTDitplKDLTKLVDILMNNNQIADItplaNLSNL----TGLTLF 149
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1569 ------IQGLSRMTLLQDLCLSHNQIGDV----GTQCLAAI-----------LPKLPELRKFDLSHNQIGDVgtqclaAI 1627
Cdd:NF033189  150 nnqitdIDPLKNLTNLNRLELSSNTISDIsalsGLTSLQQLsfgnqvtdlkpLANLTTLERLDISSNKVSDI------SV 223
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1628 LPKLPELRKFNLSHNQIGHVGTqclAAILPKLPELrkfDLSRNQIGDVGTqclaaiLPKLPELRKFDLSGNRIGPaggvq 1707
Cdd:NF033189  224 LAKLTNLESLIATNNQISDITP---LGILTNLDEL---SLNGNQLKDIGT------LASLTNLTDLDLANNQISN----- 286
                         250       260
                  ....*....|....*....|....*..
gi 568957135 1708 lVKSLTHFEHLEEIKLGNNALGEPTAL 1734
Cdd:NF033189  287 -LAPLSGLTKLTELKLGANQISNISPL 312
internalin_A NF033189
class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria ...
1467-1718 2.15e-06

class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.


Pssm-ID: 380193 [Multi-domain]  Cd Length: 799  Bit Score: 52.88  E-value: 2.15e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1467 SLSQVSFNDNDGTSSKLLQNIL-LSSCELKSFrlTFSQVST----KSLTHLAFG--------LGHCHHLEELDFSNNSLR 1533
Cdd:NF033189  142 NLTGLTLFNNQITDIDPLKNLTnLNRLELSSN--TISDISAlsglTSLQQLSFGnqvtdlkpLANLTTLERLDISSNKVS 219
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1534 EEDTELLMGALQGTCRLKKLHLSFLPLGAsslalliqglsrMTLLQDLCLSHNQIGDVGTqclaaiLPKLPELRKFDLSH 1613
Cdd:NF033189  220 DISVLAKLTNLESLIATNNQISDITPLGI------------LTNLDELSLNGNQLKDIGT------LASLTNLTDLDLAN 281
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1614 NQIGDVgtqclaAILPKLPELRKFNLSHNQIGHVGTqclaaiLPKLPELRKFDLSRNQIGDVGTqclaaiLPKLPELRKF 1693
Cdd:NF033189  282 NQISNL------APLSGLTKLTELKLGANQISNISP------LAGLTALTNLELNENQLEDISP------ISNLKNLTYL 343
                         250       260
                  ....*....|....*....|....*
gi 568957135 1694 DLSGNRIgpaGGVQLVKSLTHFEHL 1718
Cdd:NF033189  344 TLYFNNI---SDISPVSSLTKLQRL 365
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1007-1307 2.70e-06

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 51.59  E-value: 2.70e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1007 HNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMD--AVFSLVQCLSSLQWVFHLDVSlesDCIFLrgagt 1084
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLS---DNALG----- 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1085 srdalepkfQTGVQVLE-LSQRYTSRSFCLQECQLEPTSLTFLCAtlekspGPLEVQLSCKSLsddslkILLQCLpqlpq 1163
Cdd:cd00116    95 ---------PDGCGVLEsLLRSSSLQELKLNNNGLGDRGLRLLAK------GLKDLPPALEKL------VLGRNR----- 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1164 lsllqlrhtvLSSRSPFLLADIFNLCPRVRKVTL----------RSLCHAVLHFdsneeQEGVCCGFPGCSLSQEHMETL 1233
Cdd:cd00116   149 ----------LEGASCEALAKALRANRDLKELNLanngigdagiRALAEGLKAN-----CNLEVLDLNNNGLTDEGASAL 213
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568957135 1234 CCALSKCNALSQLDLTDNLLGDIGLRCLLECLPQLPIS-GWLDLSHNNISQEGILYLLETLPSYPNIQEVSVSLS 1307
Cdd:cd00116   214 AETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNISlLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGN 288
LRR_8 pfam13855
Leucine rich repeat;
1604-1672 2.80e-05

Leucine rich repeat;


Pssm-ID: 404697 [Multi-domain]  Cd Length: 61  Bit Score: 43.28  E-value: 2.80e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568957135  1604 PELRKFDLSHNQIGDVGTQCLAailpKLPELRKFNLSHNQIGHVGTQCLAailpKLPELRKFDLSRNQI 1672
Cdd:pfam13855    1 PNLRSLDLSNNRLTSLDDGAFK----GLSNLKVLDLSNNLLTTLSPGAFS----GLPSLRYLDLSGNRL 61
inl_like_NEAT_1 NF033190
NEAT domain-containing leucine-rich repeat protein; Members of this family have an N-terminal ...
1578-1754 4.58e-05

NEAT domain-containing leucine-rich repeat protein; Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.


Pssm-ID: 411101 [Multi-domain]  Cd Length: 754  Bit Score: 48.50  E-value: 4.58e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1578 LQDLCLSHNQIGDVGTqclaaiLPKLPELRKFDLSHNQIGDVgtqclaAILPKLPELRKFNLSHNQIGHVgtqclaAILP 1657
Cdd:NF033190  265 LNHLALRGNEFSDVTP------LVKMDNLESLDLSNNKITNV------APLTEMKNVKSLYLSGNQIEDV------TALA 326
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1658 KLPELRKFDLSRNQIGDVgtqclaAILPKLPELRKFDLSGNR---IGPAGGVQL---------VKSLTHFE---HLEEIK 1722
Cdd:NF033190  327 KMEQLDYLNLANNKITNV------APLSALKNVTYLTLAGNQiedIKPLYSLPLkdlvltrnkVKDLSGIDqmnQLEELW 400
                         170       180       190
                  ....*....|....*....|....*....|..
gi 568957135 1723 LGNNALGEPTALELAQrlppQLRVLCLPSSHL 1754
Cdd:NF033190  401 IGKNEIKDVTPLSKMT----QLKELDLPNNEL 428
COG5635 COG5635
Predicted NTPase, NACHT family domain [Signal transduction mechanisms];
226-533 5.30e-05

Predicted NTPase, NACHT family domain [Signal transduction mechanisms];


Pssm-ID: 227922 [Multi-domain]  Cd Length: 824  Bit Score: 48.25  E-value: 5.30e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  226 VLLGKAGMGKTTLAYRLRWRWAQGQL-----DRFQALFLFEF-----RQLNMItqlPTLPQLLFDLYLMPEsEPDAVFQY 295
Cdd:COG5635   226 LILGAPGSGKTTFLQRLALWLAQRTLepedvPIFLLLNAFALarkfeKQLSLI---DYLAEELFSQGIAKQ-LIEAHQEL 301
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  296 LKEnaQEVLLIFDGLDEALhadSVGTDNAGSALTLFSELCHGNLlpgcwVMTTSRPGKLPScVPTEAATVHMWGFDGLRV 375
Cdd:COG5635   302 LKT--GKLLLLLDGLDELE---PKNQRALIREINKFLQEYPDAQ-----VLLTCRPDTYKE-EFKGFAVFEIYKFLDLQI 370
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  376 EKYVTCFFSDL---------------LSQELALKEMRtnaRLRGMCAIPALCTVTC--FCLRRLLPGSSPGqsaallpti 438
Cdd:COG5635   371 NQFILYQWLDAfiedwfgdsrllakkLLERLKLPENR---RIKELALTPLLLALECliWQAQGDLPESRAE--------- 438
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  439 tqLYLQMVETFSPSEtllDTSILGFGKVALRGLDTG---KVVFS-----------------------VEDISPQLMSFGA 492
Cdd:COG5635   439 --LYEQAVDALLGRE---DETRGIKWSKTYAKLTTDqqdKWLLQllaallfekldeeftefllkddiVDYLLNQAEDEDD 513
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*...
gi 568957135  493 VHSL---LTSFCIHTRPG----HEEIGYAFVHLSLQEFFAALYLMASH 533
Cdd:COG5635   514 LIALalaLEALLKLLQHGllveRAKIVYAFAHATFQEYFAAKKIVASS 561
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
713-933 1.31e-04

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 46.46  E-value: 1.31e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  713 LPTMGSLKTLGLTGSRITAQGISHLIQTLPLCSQLEEVSLHD---NQLKDPEVLSLVELLPSL---PKLQKLDLSRNSFS 786
Cdd:COG5238    26 LEMMDELVEVDLSGNTIGTEAMEELCNVIANVRNLRVVNFSDaftGRDKDELYSNLVMLLKALlkcPRLQKVDLSDNAFG 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  787 RSILLSLVkvaitcptvrklqvrelDLIFYLSPVTETATQQSG----ASDVQGKDSLKEGQSRSLQ----LRLQKC-QLR 857
Cdd:COG5238   106 SEFPEELG-----------------DLISSSTDLVHLKLNNNGlgpiAGGRIGKALFHLAYNKKAAdkpkLEVVICgRNR 168
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568957135  858 IRD--AEALVELFQKSPQLEEVNLSGNHLEDDGCR-LVAEAASQLHIAQKLDLSDNGLSQTGVTYVLKAMSTCGTLEDL 933
Cdd:COG5238   169 LENgsKELSAALLESHENLKEVKIQQNGIRPEGVTmLAFLGLFYSHSLEVLDLQDNTFTLEGSRYLADALCEWNLLREL 247
PPP1R42 cd21340
protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 ...
1766-1865 3.83e-03

protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 (PPP1R42), also known as leucine-rich repeat-containing protein 67 (lrrc67) or testis leucine-rich repeat (TLRR) protein, plays a role in centrosome separation. PPP1R42 has been shown to interact with the well-conserved signaling protein phosphatase-1 (PP1) and thereby increasing PP1's activity, which counters centrosome separation. Inhibition of PPP1R42 expression increases the number of centrosomes per cell while its depletion reduces the activity of PP1 leading to activation of NEK2, the kinase responsible for phosphorylation of centrosomal linker proteins promoting centrosome separation.


Pssm-ID: 411060 [Multi-domain]  Cd Length: 220  Bit Score: 40.92  E-value: 3.83e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1766 LEQCPHIEEVSLAENNLAGGVP-RFSKR-----LPLLRQIDLEFCKIEDqaarhlAANLTLFPALEKLLLSGNLLGDevA 1839
Cdd:cd21340    86 LENLTNLEELHIENQRLPPGEKlTFDPRslaalSNSLRVLNISGNNIDS------LEPLAPLRNLEQLDASNNQISD--L 157
                          90       100
                  ....*....|....*....|....*.
gi 568957135 1840 AELAQVLPQMGQLKKVNLEWNRITAR 1865
Cdd:cd21340   158 EELLDLLSSWPSLRELDLTGNPVCKK 183
LRR_4 pfam12799
Leucine Rich repeats (2 copies); Leucine rich repeats are short sequence motifs present in a ...
746-789 7.11e-03

Leucine Rich repeats (2 copies); Leucine rich repeats are short sequence motifs present in a number of proteins with diverse functions and cellular locations. These repeats are usually involved in protein-protein interactions. Each Leucine Rich Repeat is composed of a beta-alpha unit. These units form elongated non-globular structures. Leucine Rich Repeats are often flanked by cysteine rich domains.


Pssm-ID: 403873 [Multi-domain]  Cd Length: 44  Bit Score: 36.07  E-value: 7.11e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....
gi 568957135   746 QLEEVSLHDNQLKDpevlslVELLPSLPKLQKLDLSRNSFSRSI 789
Cdd:pfam12799    2 NLEVLDLSNNQITD------LPPLAKLPNLETLDLSGNNKITDL 39
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
1630-1901 7.59e-03

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 41.37  E-value: 7.59e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1630 KLPELRKFNLSHNQIGhvgTQCLAAILPKLPELRKFDLSRNQigdvgtqcLAAILPK--LPELRKFDLSGNRIGPaggvQ 1707
Cdd:PLN00113   91 RLPYIQTINLSNNQLS---GPIPDDIFTTSSSLRYLNLSNNN--------FTGSIPRgsIPNLETLDLSNNMLSG----E 155
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1708 LVKSLTHFEHLEEIKLGNNALGEPTALELAQRlpPQLRVLCLPSSHLgpegALGLAQALEQCPHIEEVSLAENNLAGGVP 1787
Cdd:PLN00113  156 IPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNL--TSLEFLTLASNQL----VGQIPRELGQMKSLKWIYLGYNNLSGEIP 229
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1788 RFSKRLPLLRQIDLEFCKIEDQAARHLaANLT----LFPALEKL-------------LLSGNLLGDEVAAELAQVLPQMG 1850
Cdd:PLN00113  230 YEIGGLTSLNHLDLVYNNLTGPIPSSL-GNLKnlqyLFLYQNKLsgpippsifslqkLISLDLSDNSLSGEIPELVIQLQ 308
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568957135 1851 QLKKVNLEWNRITARgaqlLAQGLVQGSCVPVIRLWNNPILNDVAQSLQSQ 1901
Cdd:PLN00113  309 NLEILHLFSNNFTGK----IPVALTSLPRLQVLQLWSNKFSGEIPKNLGKH 355
 
Name Accession Description Interval E-value
Atypical_Card pfam18461
Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts ...
1-94 2.98e-46

Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts a six alpha-helix bundle with a general death fold. Structure and sequence analysis of the NLRC5-N indicate that it possesses a fold similar to the one of the death-fold domains; however, it displays significant differences in the number of core alpha-helices and their relative orientation. Hence, it is suggested that NLRC5 belongs to the caspase recruitment domain (CARD) subfamily as an atypical CARD.


Pssm-ID: 408254  Cd Length: 95  Bit Score: 161.32  E-value: 2.98e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135     1 MDAESIRLNNENLWAWLVRLLSKNPEWLSAKLRSFLPTMDLDCSYEPSNP-EVIHRQLNRLFAQGMATWKSFINDLCFEL 79
Cdd:pfam18461    1 MDPLSLQLGTENLWPWLVRLLSKDPEWLLAKVKFFLPNMDLSSVNEAPDPkQKVSLQLRRLEAQGLATWKSFIQCVCMEL 80
                           90
                   ....*....|....*
gi 568957135    80 DVPLDMEIPLVSIWG 94
Cdd:pfam18461   81 EVPLDLEVPLLSTWG 95
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1520-1782 4.42e-31

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 125.55  E-value: 4.42e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1520 HHLEELDFSNNSLREEDTELLMGALQGTCRLKKLHLSFLPLGAS--SLALLIQGLSRMTLLQDLCLSHNQIGDVGTQCLA 1597
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLSDNALGPDGCGVLE 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1598 AILpKLPELRKFDLSHNQIGDVGTQCLAAILPKLPE-LRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRNQIGDVG 1676
Cdd:cd00116   103 SLL-RSSSLQELKLNNNGLGDRGLRLLAKGLKDLPPaLEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAG 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1677 TQCLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEPTALELAQRLP---PQLRVLCLPSSH 1753
Cdd:cd00116   182 IRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLspnISLLTLSLSCND 261
                         250       260
                  ....*....|....*....|....*....
gi 568957135 1754 LGPEGALGLAQALEQCPHIEEVSLAENNL 1782
Cdd:cd00116   262 ITDDGAKDLAEVLAEKESLLELDLRGNKF 290
NACHT pfam05729
NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in ...
223-385 1.35e-30

NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.


Pssm-ID: 399032  Cd Length: 166  Bit Score: 119.33  E-value: 1.35e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135   223 RVTVLLGKAGMGKTTLAYRLRWRWAQGQLDR-FQALFLFEFRQLNMITQLPTLPQLLFDLYLMPESEPDAVFQYLKENAQ 301
Cdd:pfam05729    1 RTVILQGEAGSGKTTLLQKIALLWAQGKLPQgFDFVFFLPCRELSRSGNARSLADLLFSQWPEPAAPVSEVWAVILELPE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135   302 EVLLIFDGLDEALHADSVgTDNAGSALTLFSELCHGNLLPGCWVMTTSRPG---KLPSCVPtEAATVHMWGFDGLRVEKY 378
Cdd:pfam05729   81 RLLLILDGLDELVSDLGQ-LDGPCPVLTLLSSLLRKKLLPGASLLLTVRPDalrDLRRGLE-EPRYLEVRGFSEDDRKQY 158

                   ....*..
gi 568957135   379 VTCFFSD 385
Cdd:pfam05729  159 VRKYFSD 165
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1522-1768 3.61e-28

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 117.07  E-value: 3.61e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1522 LEELDFSNNSLREED--TELLMGALQGTCRLKKLHLSFLPLGASSLALLiQGLSRMTLLQDLCLSHNQIGDVGTQCLAAI 1599
Cdd:cd00116    53 LKELCLSLNETGRIPrgLQSLLQGLTKGCGLQELDLSDNALGPDGCGVL-ESLLRSSSLQELKLNNNGLGDRGLRLLAKG 131
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1600 LPKLPE-LRKFDLSHNQIGDVGTQCLAAILPKLPELRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRNQIGDVGTQ 1678
Cdd:cd00116   132 LKDLPPaLEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGAS 211
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1679 CLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEH-LEEIKLGNNALGEPTALELAQRLP--PQLRVLCLPSSHLG 1755
Cdd:cd00116   212 ALAETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNIsLLTLSLSCNDITDDGAKDLAEVLAekESLLELDLRGNKFG 291
                         250
                  ....*....|...
gi 568957135 1756 PEGALGLAQALEQ 1768
Cdd:cd00116   292 EEGAQLLAESLLE 304
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1578-1887 1.49e-27

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 115.53  E-value: 1.49e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1578 LQDLCLSHNQIGDVGTQCLAAILPKLPELRKFDLSHNQIG--DVGTQCLAAILPKLPELRKFNLSHNQIGHVGTQCLAAI 1655
Cdd:cd00116    25 LQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGriPRGLQSLLQGLTKGCGLQELDLSDNALGPDGCGVLESL 104
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1656 LpKLPELRKFDLSRNQIGDVGTQCLAAILPKLPE-LRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEPTAL 1734
Cdd:cd00116   105 L-RSSSLQELKLNNNGLGDRGLRLLAKGLKDLPPaLEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAGIR 183
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1735 ELAQRLP--PQLRVLCLPSSHLGPEGALGLAQALEQcphieevslaennlaggvprfskrLPLLRQIDLEFCKIEDQAAR 1812
Cdd:cd00116   184 ALAEGLKanCNLEVLDLNNNGLTDEGASALAETLAS------------------------LKSLEVLNLGDNNLTDAGAA 239
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568957135 1813 HLA-ANLTLFPALEKLLLSGNLLGDEVAAELAQVLPQMGQLKKVNLEWNRITARGAQLLAQGLVQGSCVPvIRLWN 1887
Cdd:cd00116   240 ALAsALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGNKFGEEGAQLLAESLLEPGNEL-ESLWV 314
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1437-1684 1.76e-25

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 109.37  E-value: 1.76e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1437 ALRLAHCDLETEHS----HLMIQLVETYARLQQLSLSQVSFNDndgTSSKLLQNILLSScELKSFRLTFSQVSTKSLTHL 1512
Cdd:cd00116    53 LKELCLSLNETGRIprglQSLLQGLTKGCGLQELDLSDNALGP---DGCGVLESLLRSS-SLQELKLNNNGLGDRGLRLL 128
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1513 AFGLGHC-HHLEELDFSNNSLREEDTELLMGALQGTCRLKKLHLSFLPLGASSLALLIQGLSRMTLLQDLCLSHNQIGDV 1591
Cdd:cd00116   129 AKGLKDLpPALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDE 208
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1592 GTQCLAAILPKLPELRKFDLSHNQIGDVGTQCLAAILPKL-PELRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRN 1670
Cdd:cd00116   209 GASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLSPnISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGN 288
                         250
                  ....*....|....
gi 568957135 1671 QIGDVGTQCLAAIL 1684
Cdd:cd00116   289 KFGEEGAQLLAESL 302
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1627-1898 2.76e-21

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 97.04  E-value: 2.76e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1627 ILPKLPELRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRNQIG--DVGTQCLAAILPKLPELRKFDLSGNRIGPAG 1704
Cdd:cd00116    18 LLPKLLCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGriPRGLQSLLQGLTKGCGLQELDLSDNALGPDG 97
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1705 gVQLVKSLTHFEHLEEIKLGNNALGePTALELAQR----LPPQLRVLCLPSSHLGPEGALGLAQALEQCPHIEEVSLAEN 1780
Cdd:cd00116    98 -CGVLESLLRSSSLQELKLNNNGLG-DRGLRLLAKglkdLPPALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANN 175
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1781 NlaggvprfskrlpllrqidlefckIEDQAARHLAANLTLFPALEKLLLSGNLLGDEVAAELAQVLPQMGQLKKVNLEWN 1860
Cdd:cd00116   176 G------------------------IGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDN 231
                         250       260       270
                  ....*....|....*....|....*....|....*....
gi 568957135 1861 RITARGAQLLAQGLVQGS-CVPVIRLWNNPILNDVAQSL 1898
Cdd:cd00116   232 NLTDAGAAALASALLSPNiSLLTLSLSCNDITDDGAKDL 270
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
735-1045 1.52e-13

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 73.54  E-value: 1.52e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  735 SHLIQTLPLCSQLEEVSLHDNQLKDPEVLSLVELLPSLPKLQKLDLSRNSFSRS--ILLSLVKVAITCPTVRKLQVRELD 812
Cdd:cd00116    13 ERATELLPKLLCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLSDNA 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  813 LIFYLSPVTETATQ----------QSGASDVQGK---DSLKEGQSRSLQLRLQKCQLRIRDAEALVELFQKSPQLEEVNL 879
Cdd:cd00116    93 LGPDGCGVLESLLRssslqelklnNNGLGDRGLRllaKGLKDLPPALEKLVLGRNRLEGASCEALAKALRANRDLKELNL 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  880 SGNHLEDDGCRLVAEAASQLHIAQKLDLSDNGLSQTGVTYVLKAMSTCGTLEDLHIsllnntvvltfaqepreqeGSCKG 959
Cdd:cd00116   173 ANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNL-------------------GDNNL 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  960 RAPLISFVSPVTSELSQRSRRIRLTHCGFLAKHTETLCEALRASCQthnLDHLDLSDNSLGGKGVILLTELLPGLGP-LK 1038
Cdd:cd00116   234 TDAGAAALASALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKES---LLELDLRGNKFGEEGAQLLAESLLEPGNeLE 310

                  ....*..
gi 568957135 1039 SLNLSRN 1045
Cdd:cd00116   311 SLWVKDD 317
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
611-895 3.02e-12

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 69.69  E-value: 3.02e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  611 TGPKMIELYHCVAETQDLELARFtaQSLPSRLSFHNFPLTHADLaalanilehrdDPIHLDFDGCPLePHCPEAL--VGC 688
Cdd:cd00116    79 KGCGLQELDLSDNALGPDGCGVL--ESLLRSSSLQELKLNNNGL-----------GDRGLRLLAKGL-KDLPPALekLVL 144
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  689 GQvenlsfksRKCGDAFAEALCRSLPTMGSLKTLGLTGSRITAQGISHLIQTLPLCSQLEEVSLHDNQLKDPEVLSLVEL 768
Cdd:cd00116   145 GR--------NRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAET 216
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  769 LPSLPKLQKLDLSRNSFSRSILLSLvkvaitcptvrklqvreldlifylspvtetatqqsgasdvqgKDSLKEGQSRSLQ 848
Cdd:cd00116   217 LASLKSLEVLNLGDNNLTDAGAAAL------------------------------------------ASALLSPNISLLT 254
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*..
gi 568957135  849 LRLQKCQLRIRDAEALVELFQKSPQLEEVNLSGNHLEDDGCRLVAEA 895
Cdd:cd00116   255 LSLSCNDITDDGAKDLAEVLAEKESLLELDLRGNKFGEEGAQLLAES 301
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
848-1118 3.03e-11

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 66.61  E-value: 3.03e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  848 QLRLQKCQLRIRDAEALVELFQKSPQLEEVNLSGNHLE--DDGCRLVAEAASQLHIAQKLDLSDNGLSQTGVTyVLKAMS 925
Cdd:cd00116    27 VLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGriPRGLQSLLQGLTKGCGLQELDLSDNALGPDGCG-VLESLL 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  926 TCGTLEDLHisLLNNTvvLTFAQEPREQEGSCKGRAPLISFV-----------SPVTSELS--QRSRRIRLTHCGFLAKH 992
Cdd:cd00116   106 RSSSLQELK--LNNNG--LGDRGLRLLAKGLKDLPPALEKLVlgrnrlegascEALAKALRanRDLKELNLANNGIGDAG 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  993 TETLCEALRASCqthNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMDAVFSLVQCLSSLQWVFhLDVSL 1072
Cdd:cd00116   182 IRALAEGLKANC---NLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNISL-LTLSL 257
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 568957135 1073 ESDCIFLRGAGTSRDALEPKFQtgVQVLELSQRYTSRSFCLQECQL 1118
Cdd:cd00116   258 SCNDITDDGAKDLAEVLAEKES--LLELDLRGNKFGEEGAQLLAES 301
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
1408-1736 5.31e-11

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 66.92  E-value: 5.31e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1408 LTELSISEIQRKLWLQLEFPHQ-EGNSDSMALRLAHCDLETehshlmIQLVETY--ARLQQLSLSQVSFNDNDGTSSKLL 1484
Cdd:COG4886    28 TTPQSINLNFPDSNLESVAVNRlALNLSSNTLLLLPSSLSR------LLSLDLLspSGISSLDGSENLLNLLPLPSLDLN 101
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1485 QNILLSSCEL-----KSFRLTFSQVSTKSLTHLAFGLGHchHLEELDFSNNSLREEDTELlmGALQGtcrLKKLHLSFLP 1559
Cdd:COG4886   102 LNRLRSNISElleltNLTSLDLDNNNITDIPPLIGLLKS--NLKELDLSDNKIESLPSPL--RNLPN---LKNLDLSFND 174
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1560 LgaSSLALLIQGLsrmTLLQDLCLSHNQIGDVgtQCLAAILPKLPELrkfDLSHNQIgdvgTQCLAAiLPKLPELRKFNL 1639
Cdd:COG4886   175 L--SDLPKLLSNL---SNLNNLDLSGNKISDL--PPEIELLSALEEL---DLSNNSI----IELLSS-LSNLKNLSGLEL 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1640 SHNQIghvgtQCLAAILPKLPELRKFDLSRNQIGDVGtqclaaILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLE 1719
Cdd:COG4886   240 SNNKL-----EDLPESIGNLSNLETLDLSNNQISSIS------SLGSLTNLRELDLSGNSLSNALPLIALLLLLLELLLN 308
                         330
                  ....*....|....*..
gi 568957135 1720 EIKLGNNALGEPTALEL 1736
Cdd:COG4886   309 LLLTLKALELKLNSILL 325
PPP1R42 cd21340
protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 ...
1507-1700 1.46e-10

protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 (PPP1R42), also known as leucine-rich repeat-containing protein 67 (lrrc67) or testis leucine-rich repeat (TLRR) protein, plays a role in centrosome separation. PPP1R42 has been shown to interact with the well-conserved signaling protein phosphatase-1 (PP1) and thereby increasing PP1's activity, which counters centrosome separation. Inhibition of PPP1R42 expression increases the number of centrosomes per cell while its depletion reduces the activity of PP1 leading to activation of NEK2, the kinase responsible for phosphorylation of centrosomal linker proteins promoting centrosome separation.


Pssm-ID: 411060 [Multi-domain]  Cd Length: 220  Bit Score: 62.88  E-value: 1.46e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1507 KSLTHLAF---------GLGHCHHLEELDFSNNSLREedtellMGALQGTCRLKKLHLS--FLplgaSSlallIQGLSRM 1575
Cdd:cd21340     2 KRITHLYLndknitkidNLSLCKNLKVLYLYDNKITK------IENLEFLTNLTHLYLQnnQI----EK----IENLENL 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1576 TLLQDLCLSHNQIGDV-GtqclaaiLPKLPELRKFDLSHNQIGD-----VGTQCLAAIlpkLPELRKFNLSHNQIghvgt 1649
Cdd:cd21340    68 VNLKKLYLGGNRISVVeG-------LENLTNLEELHIENQRLPPgekltFDPRSLAAL---SNSLRVLNISGNNI----- 132
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568957135 1650 QCLAAILPkLPELRKFDLSRNQIGDVgtQCLAAILPKLPELRKFDLSGNRI 1700
Cdd:cd21340   133 DSLEPLAP-LRNLEQLDASNNQISDL--EELLDLLSSWPSLRELDLTGNPV 180
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
847-1156 6.99e-10

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 62.37  E-value: 6.99e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  847 LQLRLQKCQLRIRDAEalvELFQKSPQLEEVNLSGNHLEDDGCRLVAEAASQLHIAQKLDLSDN--GLSQTGVTYVLKAM 924
Cdd:cd00116     1 LQLSLKGELLKTERAT---ELLPKLLCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNetGRIPRGLQSLLQGL 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  925 STCGTLEdlHISLLNNTvvLTFAqepreqegsckGRAPLISFVSPVTSELSQrsrrirLTHCGFLAKHTETLCEALRaSC 1004
Cdd:cd00116    78 TKGCGLQ--ELDLSDNA--LGPD-----------GCGVLESLLRSSSLQELK------LNNNGLGDRGLRLLAKGLK-DL 135
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1005 QtHNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMDAVFSLVQCLSSLQWVFHLDvsLESDCIFLRGAGT 1084
Cdd:cd00116   136 P-PALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLD--LNNNGLTDEGASA 212
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 568957135 1085 SRDALEPKFQtgVQVLELSQrytsrsfCLqeCQLEPTSlTFLCATLEKSPGPLEVQLSCKSLSDDSLKILLQ 1156
Cdd:cd00116   213 LAETLASLKS--LEVLNLGD-------NN--LTDAGAA-ALASALLSPNISLLTLSLSCNDITDDGAKDLAE 272
NLRC4_HD2 pfam17776
NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein ...
517-632 1.00e-09

NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein and NOD2 protein.


Pssm-ID: 407648  Cd Length: 122  Bit Score: 58.06  E-value: 1.00e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135   517 HLSLQEFFAALYLMASHTVDK-DTLVEYVTLNSHWVLRT------KGRLGLSDHLPAFLAGLASHTCHMFLCQLaQQDRA 589
Cdd:pfam17776    1 HLSFQEFFAALYYVLSFKEEKsNPLKEFLGLKKRESLKSaldkalKSKNGHLDLFLRFLFGLLNESNQRLLEGL-LGCKL 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
gi 568957135   590 WVGSRQaAVIQVLRKLASRKLTGPKMIELYHCVAETQDLELAR 632
Cdd:pfam17776   80 SSEIKQ-ELLQWLKELIQKELSSERFLNLFHCLYELQDESFVK 121
internalin_A NF033189
class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria ...
1501-1734 8.22e-08

class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.


Pssm-ID: 380193 [Multi-domain]  Cd Length: 799  Bit Score: 57.50  E-value: 8.22e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1501 FSQVSTKSLTHLAF----GLGHCHHLEELDFSNNSLRE----EDTELLMGALQGTCRLKKL----HLSFLplgaSSLALL 1568
Cdd:NF033189   74 LDQVTTLQADRLGIksidGLEYLNNLTQINFSNNQLTDitplKDLTKLVDILMNNNQIADItplaNLSNL----TGLTLF 149
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1569 ------IQGLSRMTLLQDLCLSHNQIGDV----GTQCLAAI-----------LPKLPELRKFDLSHNQIGDVgtqclaAI 1627
Cdd:NF033189  150 nnqitdIDPLKNLTNLNRLELSSNTISDIsalsGLTSLQQLsfgnqvtdlkpLANLTTLERLDISSNKVSDI------SV 223
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1628 LPKLPELRKFNLSHNQIGHVGTqclAAILPKLPELrkfDLSRNQIGDVGTqclaaiLPKLPELRKFDLSGNRIGPaggvq 1707
Cdd:NF033189  224 LAKLTNLESLIATNNQISDITP---LGILTNLDEL---SLNGNQLKDIGT------LASLTNLTDLDLANNQISN----- 286
                         250       260
                  ....*....|....*....|....*..
gi 568957135 1708 lVKSLTHFEHLEEIKLGNNALGEPTAL 1734
Cdd:NF033189  287 -LAPLSGLTKLTELKLGANQISNISPL 312
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
1598-1862 1.37e-07

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 56.09  E-value: 1.37e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1598 AILPKLPELRKFDLSHNQIGDVGTQCLAAILPKLPELRKFNLSHNQIGHVGTQC------LAAILPKLPELRKFDLSRNQ 1671
Cdd:COG5238    24 EELEMMDELVEVDLSGNTIGTEAMEELCNVIANVRNLRVVNFSDAFTGRDKDELysnlvmLLKALLKCPRLQKVDLSDNA 103
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1672 IGDVGTQCLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEH---------LEEIKLGNNALGEPTALELAQRLPP 1742
Cdd:COG5238   104 FGSEFPEELGDLISSSTDLVHLKLNNNGLGPIAGGRIGKALFHLAYnkkaadkpkLEVVICGRNRLENGSKELSAALLES 183
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1743 Q--LRVLCLPSSHLGPEGALGLA-QALEQCPHIEEVSLAENNLAGGVPRFSKRL----PLLRQIDLEFCKIEDQAARHL- 1814
Cdd:COG5238   184 HenLKEVKIQQNGIRPEGVTMLAfLGLFYSHSLEVLDLQDNTFTLEGSRYLADAlcewNLLRELRLNDCLLSNEGVKSVl 263
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 568957135 1815 -AANLTLFPALEKLLLSGNLLgdEVAAELAQVLPQMGQ-----LKKVNLEWNRI 1862
Cdd:COG5238   264 rRFNEKFVPNLMPLPGDYNER--RGGIILDISLNEFEQdavplLVDLERNGNRI 315
internalin_A NF033189
class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria ...
1467-1718 2.15e-06

class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.


Pssm-ID: 380193 [Multi-domain]  Cd Length: 799  Bit Score: 52.88  E-value: 2.15e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1467 SLSQVSFNDNDGTSSKLLQNIL-LSSCELKSFrlTFSQVST----KSLTHLAFG--------LGHCHHLEELDFSNNSLR 1533
Cdd:NF033189  142 NLTGLTLFNNQITDIDPLKNLTnLNRLELSSN--TISDISAlsglTSLQQLSFGnqvtdlkpLANLTTLERLDISSNKVS 219
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1534 EEDTELLMGALQGTCRLKKLHLSFLPLGAsslalliqglsrMTLLQDLCLSHNQIGDVGTqclaaiLPKLPELRKFDLSH 1613
Cdd:NF033189  220 DISVLAKLTNLESLIATNNQISDITPLGI------------LTNLDELSLNGNQLKDIGT------LASLTNLTDLDLAN 281
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1614 NQIGDVgtqclaAILPKLPELRKFNLSHNQIGHVGTqclaaiLPKLPELRKFDLSRNQIGDVGTqclaaiLPKLPELRKF 1693
Cdd:NF033189  282 NQISNL------APLSGLTKLTELKLGANQISNISP------LAGLTALTNLELNENQLEDISP------ISNLKNLTYL 343
                         250       260
                  ....*....|....*....|....*
gi 568957135 1694 DLSGNRIgpaGGVQLVKSLTHFEHL 1718
Cdd:NF033189  344 TLYFNNI---SDISPVSSLTKLQRL 365
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1007-1307 2.70e-06

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 51.59  E-value: 2.70e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1007 HNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMD--AVFSLVQCLSSLQWVFHLDVSlesDCIFLrgagt 1084
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLS---DNALG----- 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1085 srdalepkfQTGVQVLE-LSQRYTSRSFCLQECQLEPTSLTFLCAtlekspGPLEVQLSCKSLsddslkILLQCLpqlpq 1163
Cdd:cd00116    95 ---------PDGCGVLEsLLRSSSLQELKLNNNGLGDRGLRLLAK------GLKDLPPALEKL------VLGRNR----- 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1164 lsllqlrhtvLSSRSPFLLADIFNLCPRVRKVTL----------RSLCHAVLHFdsneeQEGVCCGFPGCSLSQEHMETL 1233
Cdd:cd00116   149 ----------LEGASCEALAKALRANRDLKELNLanngigdagiRALAEGLKAN-----CNLEVLDLNNNGLTDEGASAL 213
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568957135 1234 CCALSKCNALSQLDLTDNLLGDIGLRCLLECLPQLPIS-GWLDLSHNNISQEGILYLLETLPSYPNIQEVSVSLS 1307
Cdd:cd00116   214 AETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNISlLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGN 288
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
1522-1837 4.27e-06

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 51.08  E-value: 4.27e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1522 LEELDFSNNSLREEDTELLMGALQGTCRLKKLHLSFLPLG------ASSLALLIQGLSrmtllqdlclshnqigdvgtqc 1595
Cdd:COG5238    32 LVEVDLSGNTIGTEAMEELCNVIANVRNLRVVNFSDAFTGrdkdelYSNLVMLLKALL---------------------- 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1596 laailpKLPELRKFDLSHNQIGDVGTQCLAAILPKLPELRKFNLSHNQIGHVGTQCLAAILPKLPELRKfdlsrnqigdv 1675
Cdd:COG5238    90 ------KCPRLQKVDLSDNAFGSEFPEELGDLISSSTDLVHLKLNNNGLGPIAGGRIGKALFHLAYNKK----------- 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1676 gtqclAAILPKlpeLRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEPT----ALELAQRLpPQLRVLCLPS 1751
Cdd:COG5238   153 -----AADKPK---LEVVICGRNRLENGSKELSAALLESHENLKEVKIQQNGIRPEGvtmlAFLGLFYS-HSLEVLDLQD 223
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1752 SHLGPEGALGLAQALEQCPHIEEVSLAENNL-AGGVPRFSKRL-----PLLRQIDLEFCKIEDQAARHLAANLTL---FP 1822
Cdd:COG5238   224 NTFTLEGSRYLADALCEWNLLRELRLNDCLLsNEGVKSVLRRFnekfvPNLMPLPGDYNERRGGIILDISLNEFEqdaVP 303
                         330
                  ....*....|....*
gi 568957135 1823 ALEKLLLSGNLLGDE 1837
Cdd:COG5238   304 LLVDLERNGNRIKEL 318
LRR_8 pfam13855
Leucine rich repeat;
1604-1672 2.80e-05

Leucine rich repeat;


Pssm-ID: 404697 [Multi-domain]  Cd Length: 61  Bit Score: 43.28  E-value: 2.80e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568957135  1604 PELRKFDLSHNQIGDVGTQCLAailpKLPELRKFNLSHNQIGHVGTQCLAailpKLPELRKFDLSRNQI 1672
Cdd:pfam13855    1 PNLRSLDLSNNRLTSLDDGAFK----GLSNLKVLDLSNNLLTTLSPGAFS----GLPSLRYLDLSGNRL 61
inl_like_NEAT_1 NF033190
NEAT domain-containing leucine-rich repeat protein; Members of this family have an N-terminal ...
1578-1754 4.58e-05

NEAT domain-containing leucine-rich repeat protein; Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.


Pssm-ID: 411101 [Multi-domain]  Cd Length: 754  Bit Score: 48.50  E-value: 4.58e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1578 LQDLCLSHNQIGDVGTqclaaiLPKLPELRKFDLSHNQIGDVgtqclaAILPKLPELRKFNLSHNQIGHVgtqclaAILP 1657
Cdd:NF033190  265 LNHLALRGNEFSDVTP------LVKMDNLESLDLSNNKITNV------APLTEMKNVKSLYLSGNQIEDV------TALA 326
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1658 KLPELRKFDLSRNQIGDVgtqclaAILPKLPELRKFDLSGNR---IGPAGGVQL---------VKSLTHFE---HLEEIK 1722
Cdd:NF033190  327 KMEQLDYLNLANNKITNV------APLSALKNVTYLTLAGNQiedIKPLYSLPLkdlvltrnkVKDLSGIDqmnQLEELW 400
                         170       180       190
                  ....*....|....*....|....*....|..
gi 568957135 1723 LGNNALGEPTALELAQrlppQLRVLCLPSSHL 1754
Cdd:NF033190  401 IGKNEIKDVTPLSKMT----QLKELDLPNNEL 428
COG5635 COG5635
Predicted NTPase, NACHT family domain [Signal transduction mechanisms];
226-533 5.30e-05

Predicted NTPase, NACHT family domain [Signal transduction mechanisms];


Pssm-ID: 227922 [Multi-domain]  Cd Length: 824  Bit Score: 48.25  E-value: 5.30e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  226 VLLGKAGMGKTTLAYRLRWRWAQGQL-----DRFQALFLFEF-----RQLNMItqlPTLPQLLFDLYLMPEsEPDAVFQY 295
Cdd:COG5635   226 LILGAPGSGKTTFLQRLALWLAQRTLepedvPIFLLLNAFALarkfeKQLSLI---DYLAEELFSQGIAKQ-LIEAHQEL 301
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  296 LKEnaQEVLLIFDGLDEALhadSVGTDNAGSALTLFSELCHGNLlpgcwVMTTSRPGKLPScVPTEAATVHMWGFDGLRV 375
Cdd:COG5635   302 LKT--GKLLLLLDGLDELE---PKNQRALIREINKFLQEYPDAQ-----VLLTCRPDTYKE-EFKGFAVFEIYKFLDLQI 370
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  376 EKYVTCFFSDL---------------LSQELALKEMRtnaRLRGMCAIPALCTVTC--FCLRRLLPGSSPGqsaallpti 438
Cdd:COG5635   371 NQFILYQWLDAfiedwfgdsrllakkLLERLKLPENR---RIKELALTPLLLALECliWQAQGDLPESRAE--------- 438
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  439 tqLYLQMVETFSPSEtllDTSILGFGKVALRGLDTG---KVVFS-----------------------VEDISPQLMSFGA 492
Cdd:COG5635   439 --LYEQAVDALLGRE---DETRGIKWSKTYAKLTTDqqdKWLLQllaallfekldeeftefllkddiVDYLLNQAEDEDD 513
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*...
gi 568957135  493 VHSL---LTSFCIHTRPG----HEEIGYAFVHLSLQEFFAALYLMASH 533
Cdd:COG5635   514 LIALalaLEALLKLLQHGllveRAKIVYAFAHATFQEYFAAKKIVASS 561
LRR_8 pfam13855
Leucine rich repeat;
1632-1700 8.25e-05

Leucine rich repeat;


Pssm-ID: 404697 [Multi-domain]  Cd Length: 61  Bit Score: 42.13  E-value: 8.25e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568957135  1632 PELRKFNLSHNQIGHVGTQCLAailpKLPELRKFDLSRNQIGDVGTQCLAailpKLPELRKFDLSGNRI 1700
Cdd:pfam13855    1 PNLRSLDLSNNRLTSLDDGAFK----GLSNLKVLDLSNNLLTTLSPGAFS----GLPSLRYLDLSGNRL 61
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
713-933 1.31e-04

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 46.46  E-value: 1.31e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  713 LPTMGSLKTLGLTGSRITAQGISHLIQTLPLCSQLEEVSLHD---NQLKDPEVLSLVELLPSL---PKLQKLDLSRNSFS 786
Cdd:COG5238    26 LEMMDELVEVDLSGNTIGTEAMEELCNVIANVRNLRVVNFSDaftGRDKDELYSNLVMLLKALlkcPRLQKVDLSDNAFG 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  787 RSILLSLVkvaitcptvrklqvrelDLIFYLSPVTETATQQSG----ASDVQGKDSLKEGQSRSLQ----LRLQKC-QLR 857
Cdd:COG5238   106 SEFPEELG-----------------DLISSSTDLVHLKLNNNGlgpiAGGRIGKALFHLAYNKKAAdkpkLEVVICgRNR 168
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568957135  858 IRD--AEALVELFQKSPQLEEVNLSGNHLEDDGCR-LVAEAASQLHIAQKLDLSDNGLSQTGVTYVLKAMSTCGTLEDL 933
Cdd:COG5238   169 LENgsKELSAALLESHENLKEVKIQQNGIRPEGVTmLAFLGLFYSHSLEVLDLQDNTFTLEGSRYLADALCEWNLLREL 247
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
1682-1871 1.55e-04

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 46.07  E-value: 1.55e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1682 AILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEptaleLAQRLPPQLRVLclpsshlgpegalg 1761
Cdd:COG5238    24 EELEMMDELVEVDLSGNTIGTEAMEELCNVIANVRNLRVVNFSDAFTGR-----DKDELYSNLVML-------------- 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1762 lAQALEQCPHIEEVSLAENNLAggvPRFSKRLP--LLRQIDLEFCKIED------------QAARHLAANLTLF--PALE 1825
Cdd:COG5238    85 -LKALLKCPRLQKVDLSDNAFG---SEFPEELGdlISSSTDLVHLKLNNnglgpiaggrigKALFHLAYNKKAAdkPKLE 160
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*.
gi 568957135 1826 KLLLSGNLLGDEVAAELAQVLPQMGQLKKVNLEWNRITARGAQLLA 1871
Cdd:COG5238   161 VVICGRNRLENGSKELSAALLESHENLKEVKIQQNGIRPEGVTMLA 206
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
1482-1700 6.29e-04

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 44.15  E-value: 6.29e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1482 KLLQNILLSSCELKSFRLTFSQVSTKSLTHLAFGLGHCHHLEELDFSNNSLREEDTELLMGALQGTCRLKKL-HLSFLP- 1559
Cdd:COG5238    82 VMLLKALLKCPRLQKVDLSDNAFGSEFPEELGDLISSSTDLVHLKLNNNGLGPIAGGRIGKALFHLAYNKKAaDKPKLEv 161
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1560 -------LGASSLALLIQGLSRMTLLQDLCLSHNQIGDVGTQCLAAI-LPKLPELRKFDLSHNQIGDVGTQCLAAILPKL 1631
Cdd:COG5238   162 vicgrnrLENGSKELSAALLESHENLKEVKIQQNGIRPEGVTMLAFLgLFYSHSLEVLDLQDNTFTLEGSRYLADALCEW 241
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 568957135 1632 PELRKFNLSHNQIGHVGTQCLAAILPKL--PELR--KFDLSRNQIGDVGTQCLAAILP-KLPELRKFDLSGNRI 1700
Cdd:COG5238   242 NLLRELRLNDCLLSNEGVKSVLRRFNEKfvPNLMplPGDYNERRGGIILDISLNEFEQdAVPLLVDLERNGNRI 315
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
1508-1716 1.18e-03

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 43.38  E-value: 1.18e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1508 SLTHLAFGLGHCHHLEELDFSNNSlreedtellmgalqgtcrlkklhlsflpLGASSLALLIQGLSRMTLLQDLCLSHNQ 1587
Cdd:COG5238    80 NLVMLLKALLKCPRLQKVDLSDNA----------------------------FGSEFPEELGDLISSSTDLVHLKLNNNG 131
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1588 IGDVGTQCLAAILPKL---------PELRKFDLSHNQIGDVGTQCLAAILPKLPELRKFNLSHNQIGHVGTQCLAAI-LP 1657
Cdd:COG5238   132 LGPIAGGRIGKALFHLaynkkaadkPKLEVVICGRNRLENGSKELSAALLESHENLKEVKIQQNGIRPEGVTMLAFLgLF 211
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 568957135 1658 KLPELRKFDLSRNQIGDVGTQCLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFE 1716
Cdd:COG5238   212 YSHSLEVLDLQDNTFTLEGSRYLADALCEWNLLRELRLNDCLLSNEGVKSVLRRFNEKF 270
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
861-1096 1.95e-03

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 42.61  E-value: 1.95e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  861 AEALVELFQKSPQLEEVNLSG---NHLED---DGCRLVAEAASQLHIAQKLDLSDNGLSQTGVTYVLKAMSTCGTLEdlH 934
Cdd:COG5238    47 MEELCNVIANVRNLRVVNFSDaftGRDKDelySNLVMLLKALLKCPRLQKVDLSDNAFGSEFPEELGDLISSSTDLV--H 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  935 ISLLNNTV------VLTFAQEPREQEGSCKGRAPLISFV---------SPVTSELSQRSRR----IRLTHCGFLAKHTET 995
Cdd:COG5238   125 LKLNNNGLgpiaggRIGKALFHLAYNKKAADKPKLEVVIcgrnrlengSKELSAALLESHEnlkeVKIQQNGIRPEGVTM 204
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135  996 LceALRASCQTHNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMDAVFSLVQCLSSLQWVFHLDVSLESD 1075
Cdd:COG5238   205 L--AFLGLFYSHSLEVLDLQDNTFTLEGSRYLADALCEWNLLRELRLNDCLLSNEGVKSVLRRFNEKFVPNLMPLPGDYN 282
                         250       260
                  ....*....|....*....|.
gi 568957135 1076 CIFLrgaGTSRDALEPKFQTG 1096
Cdd:COG5238   283 ERRG---GIILDISLNEFEQD 300
LRR_8 pfam13855
Leucine rich repeat;
1578-1644 2.27e-03

Leucine rich repeat;


Pssm-ID: 404697 [Multi-domain]  Cd Length: 61  Bit Score: 37.89  E-value: 2.27e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568957135  1578 LQDLCLSHNQIGDVGTQCLAailpKLPELRKFDLSHNQIGDVGTQCLAailpKLPELRKFNLSHNQI 1644
Cdd:pfam13855    3 LRSLDLSNNRLTSLDDGAFK----GLSNLKVLDLSNNLLTTLSPGAFS----GLPSLRYLDLSGNRL 61
PPP1R42 cd21340
protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 ...
1766-1865 3.83e-03

protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 (PPP1R42), also known as leucine-rich repeat-containing protein 67 (lrrc67) or testis leucine-rich repeat (TLRR) protein, plays a role in centrosome separation. PPP1R42 has been shown to interact with the well-conserved signaling protein phosphatase-1 (PP1) and thereby increasing PP1's activity, which counters centrosome separation. Inhibition of PPP1R42 expression increases the number of centrosomes per cell while its depletion reduces the activity of PP1 leading to activation of NEK2, the kinase responsible for phosphorylation of centrosomal linker proteins promoting centrosome separation.


Pssm-ID: 411060 [Multi-domain]  Cd Length: 220  Bit Score: 40.92  E-value: 3.83e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1766 LEQCPHIEEVSLAENNLAGGVP-RFSKR-----LPLLRQIDLEFCKIEDqaarhlAANLTLFPALEKLLLSGNLLGDevA 1839
Cdd:cd21340    86 LENLTNLEELHIENQRLPPGEKlTFDPRslaalSNSLRVLNISGNNIDS------LEPLAPLRNLEQLDASNNQISD--L 157
                          90       100
                  ....*....|....*....|....*.
gi 568957135 1840 AELAQVLPQMGQLKKVNLEWNRITAR 1865
Cdd:cd21340   158 EELLDLLSSWPSLRELDLTGNPVCKK 183
PPP1R42 cd21340
protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 ...
710-787 4.16e-03

protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 (PPP1R42), also known as leucine-rich repeat-containing protein 67 (lrrc67) or testis leucine-rich repeat (TLRR) protein, plays a role in centrosome separation. PPP1R42 has been shown to interact with the well-conserved signaling protein phosphatase-1 (PP1) and thereby increasing PP1's activity, which counters centrosome separation. Inhibition of PPP1R42 expression increases the number of centrosomes per cell while its depletion reduces the activity of PP1 leading to activation of NEK2, the kinase responsible for phosphorylation of centrosomal linker proteins promoting centrosome separation.


Pssm-ID: 411060 [Multi-domain]  Cd Length: 220  Bit Score: 40.54  E-value: 4.16e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568957135  710 CRSLPTMG-SLKTLGLTGSRITAqgishlIQTLPLCSQLEEVSLHDNQLKDPEVLSlvELLPSLPKLQKLDLSRNSFSR 787
Cdd:cd21340   112 PRSLAALSnSLRVLNISGNNIDS------LEPLAPLRNLEQLDASNNQISDLEELL--DLLSSWPSLRELDLTGNPVCK 182
LRR_4 pfam12799
Leucine Rich repeats (2 copies); Leucine rich repeats are short sequence motifs present in a ...
746-789 7.11e-03

Leucine Rich repeats (2 copies); Leucine rich repeats are short sequence motifs present in a number of proteins with diverse functions and cellular locations. These repeats are usually involved in protein-protein interactions. Each Leucine Rich Repeat is composed of a beta-alpha unit. These units form elongated non-globular structures. Leucine Rich Repeats are often flanked by cysteine rich domains.


Pssm-ID: 403873 [Multi-domain]  Cd Length: 44  Bit Score: 36.07  E-value: 7.11e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....
gi 568957135   746 QLEEVSLHDNQLKDpevlslVELLPSLPKLQKLDLSRNSFSRSI 789
Cdd:pfam12799    2 NLEVLDLSNNQITD------LPPLAKLPNLETLDLSGNNKITDL 39
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
1630-1901 7.59e-03

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 41.37  E-value: 7.59e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1630 KLPELRKFNLSHNQIGhvgTQCLAAILPKLPELRKFDLSRNQigdvgtqcLAAILPK--LPELRKFDLSGNRIGPaggvQ 1707
Cdd:PLN00113   91 RLPYIQTINLSNNQLS---GPIPDDIFTTSSSLRYLNLSNNN--------FTGSIPRgsIPNLETLDLSNNMLSG----E 155
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1708 LVKSLTHFEHLEEIKLGNNALGEPTALELAQRlpPQLRVLCLPSSHLgpegALGLAQALEQCPHIEEVSLAENNLAGGVP 1787
Cdd:PLN00113  156 IPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNL--TSLEFLTLASNQL----VGQIPRELGQMKSLKWIYLGYNNLSGEIP 229
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957135 1788 RFSKRLPLLRQIDLEFCKIEDQAARHLaANLT----LFPALEKL-------------LLSGNLLGDEVAAELAQVLPQMG 1850
Cdd:PLN00113  230 YEIGGLTSLNHLDLVYNNLTGPIPSSL-GNLKnlqyLFLYQNKLsgpippsifslqkLISLDLSDNSLSGEIPELVIQLQ 308
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568957135 1851 QLKKVNLEWNRITARgaqlLAQGLVQGSCVPVIRLWNNPILNDVAQSLQSQ 1901
Cdd:PLN00113  309 NLEILHLFSNNFTGK----IPVALTSLPRLQVLQLWSNKFSGEIPKNLGKH 355
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH