NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568957139|ref|XP_006531228|]
View 

protein NLRC5 isoform X2 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Atypical_Card pfam18461
Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts ...
1-94 3.23e-46

Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts a six alpha-helix bundle with a general death fold. Structure and sequence analysis of the NLRC5-N indicate that it possesses a fold similar to the one of the death-fold domains; however, it displays significant differences in the number of core alpha-helices and their relative orientation. Hence, it is suggested that NLRC5 belongs to the caspase recruitment domain (CARD) subfamily as an atypical CARD.


:

Pssm-ID: 408254  Cd Length: 95  Bit Score: 161.32  E-value: 3.23e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139     1 MDAESIRLNNENLWAWLVRLLSKNPEWLSAKLRSFLPTMDLDCSYEPSNP-EVIHRQLNRLFAQGMATWKSFINDLCFEL 79
Cdd:pfam18461    1 MDPLSLQLGTENLWPWLVRLLSKDPEWLLAKVKFFLPNMDLSSVNEAPDPkQKVSLQLRRLEAQGLATWKSFIQCVCMEL 80
                           90
                   ....*....|....*
gi 568957139    80 DVPLDMEIPLVSIWG 94
Cdd:pfam18461   81 EVPLDLEVPLLSTWG 95
LRR_RI super family cl39015
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1490-1752 4.56e-31

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


The actual alignment was detected with superfamily member cd00116:

Pssm-ID: 423007 [Multi-domain]  Cd Length: 319  Bit Score: 125.55  E-value: 4.56e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1490 HHLEELDFSNNSLREEDTELLMGALQGTCRLKKLHLSFLPLGAS--SLALLIQGLSRMTLLQDLCLSHNQIGDVGTQCLA 1567
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLSDNALGPDGCGVLE 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1568 AILpKLPELRKFDLSHNQIGDVGTQCLAAILPKLPE-LRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRNQIGDVG 1646
Cdd:cd00116   103 SLL-RSSSLQELKLNNNGLGDRGLRLLAKGLKDLPPaLEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAG 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1647 TQCLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEPTALELAQRLP---PQLRVLCLPSSH 1723
Cdd:cd00116   182 IRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLspnISLLTLSLSCND 261
                         250       260
                  ....*....|....*....|....*....
gi 568957139 1724 LGPEGALGLAQALEQCPHIEEVSLAENNL 1752
Cdd:cd00116   262 ITDDGAKDLAEVLAEKESLLELDLRGNKF 290
NACHT pfam05729
NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in ...
223-385 1.22e-30

NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.


:

Pssm-ID: 399032  Cd Length: 166  Bit Score: 119.33  E-value: 1.22e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139   223 RVTVLLGKAGMGKTTLAYRLRWRWAQGQLDR-FQALFLFEFRQLNMITQLPTLPQLLFDLYLMPESEPDAVFQYLKENAQ 301
Cdd:pfam05729    1 RTVILQGEAGSGKTTLLQKIALLWAQGKLPQgFDFVFFLPCRELSRSGNARSLADLLFSQWPEPAAPVSEVWAVILELPE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139   302 EVLLIFDGLDEALHADSVgTDNAGSALTLFSELCHGNLLPGCWVMTTSRPG---KLPSCVPtEAATVHMWGFDGLRVEKY 378
Cdd:pfam05729   81 RLLLILDGLDELVSDLGQ-LDGPCPVLTLLSSLLRKKLLPGASLLLTVRPDalrDLRRGLE-EPRYLEVRGFSEDDRKQY 158

                   ....*..
gi 568957139   379 VTCFFSD 385
Cdd:pfam05729  159 VRKYFSD 165
LRR_RI super family cl39015
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
611-865 9.66e-13

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


The actual alignment was detected with superfamily member cd00116:

Pssm-ID: 423007 [Multi-domain]  Cd Length: 319  Bit Score: 71.23  E-value: 9.66e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  611 TGPKMIELYHCVAETQDLELARFtaQSLPSRLSFHNFPLTHADLaalanilehrdDPIHLDFDGCPLePHCPEAL--VGC 688
Cdd:cd00116    79 KGCGLQELDLSDNALGPDGCGVL--ESLLRSSSLQELKLNNNGL-----------GDRGLRLLAKGL-KDLPPALekLVL 144
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  689 GQvenlsfksRKCGDAFAEALCRSLPTMGSLKTLGLTGSRITAQGISHLIQTLPLCSQLEEVSLHDNQLKDPEVLSLVEL 768
Cdd:cd00116   145 GR--------NRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAET 216
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  769 LPSLPKLQKLEELDlifylSPVTETatqqsGASDVqgKDSLKEGQSRSLQLRLQKCQLRIRDAEALVELFQKSPQLEEVN 848
Cdd:cd00116   217 LASLKSLEVLNLGD-----NNLTDA-----GAAAL--ASALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELD 284
                         250
                  ....*....|....*..
gi 568957139  849 LSGNHLEDDGCRLVAEA 865
Cdd:cd00116   285 LRGNKFGEEGAQLLAES 301
LRR_RI super family cl39015
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
818-1088 3.15e-11

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


The actual alignment was detected with superfamily member cd00116:

Pssm-ID: 423007 [Multi-domain]  Cd Length: 319  Bit Score: 66.61  E-value: 3.15e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  818 QLRLQKCQLRIRDAEALVELFQKSPQLEEVNLSGNHLE--DDGCRLVAEAASQLHIAQKLDLSDNGLSQTGVTyVLKAMS 895
Cdd:cd00116    27 VLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGriPRGLQSLLQGLTKGCGLQELDLSDNALGPDGCG-VLESLL 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  896 TCGTLEDLHisLLNNTvvLTFAQEPREQEGSCKGRAPLISFV-----------SPVTSELS--QRSRRIRLTHCGFLAKH 962
Cdd:cd00116   106 RSSSLQELK--LNNNG--LGDRGLRLLAKGLKDLPPALEKLVlgrnrlegascEALAKALRanRDLKELNLANNGIGDAG 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  963 TETLCEALRASCqthNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMDAVFSLVQCLSSLQWVFhLDVSL 1042
Cdd:cd00116   182 IRALAEGLKANC---NLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNISL-LTLSL 257
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 568957139 1043 ESDCIFLRGAGTSRDALEPKFQtgVQVLELSQRYTSRSFCLQECQL 1088
Cdd:cd00116   258 SCNDITDDGAKDLAEVLAEKES--LLELDLRGNKFGEEGAQLLAES 301
NLRC4_HD2 super family cl39284
NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein ...
517-632 1.02e-09

NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein and NOD2 protein.


The actual alignment was detected with superfamily member pfam17776:

Pssm-ID: 407648  Cd Length: 122  Bit Score: 58.06  E-value: 1.02e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139   517 HLSLQEFFAALYLMASHTVDK-DTLVEYVTLNSHWVLRT------KGRLGLSDHLPAFLAGLASHTCHMFLCQLaQQDRA 589
Cdd:pfam17776    1 HLSFQEFFAALYYVLSFKEEKsNPLKEFLGLKKRESLKSaldkalKSKNGHLDLFLRFLFGLLNESNQRLLEGL-LGCKL 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
gi 568957139   590 WVGSRQaAVIQVLRKLASRKLTGPKMIELYHCVAETQDLELAR 632
Cdd:pfam17776   80 SSEIKQ-ELLQWLKELIQKELSSERFLNLFHCLYELQDESFVK 121
LRR_RI super family cl39015
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
977-1277 2.67e-06

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


The actual alignment was detected with superfamily member cd00116:

Pssm-ID: 423007 [Multi-domain]  Cd Length: 319  Bit Score: 51.59  E-value: 2.67e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  977 HNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMD--AVFSLVQCLSSLQWVFHLDVSlesDCIFLrgagt 1054
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLS---DNALG----- 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1055 srdalepkfQTGVQVLE-LSQRYTSRSFCLQECQLEPTSLTFLCAtlekspGPLEVQLSCKSLsddslkILLQCLpqlpq 1133
Cdd:cd00116    95 ---------PDGCGVLEsLLRSSSLQELKLNNNGLGDRGLRLLAK------GLKDLPPALEKL------VLGRNR----- 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1134 lsllqlrhtvLSSRSPFLLADIFNLCPRVRKVTL----------RSLCHAVLHFdsneeQEGVCCGFPGCSLSQEHMETL 1203
Cdd:cd00116   149 ----------LEGASCEALAKALRANRDLKELNLanngigdagiRALAEGLKAN-----CNLEVLDLNNNGLTDEGASAL 213
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568957139 1204 CCALSKCNALSQLDLTDNLLGDIGLRCLLECLPQLPIS-GWLDLSHNNISQEGILYLLETLPSYPNIQEVSVSLS 1277
Cdd:cd00116   214 AETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNISlLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGN 288
PPP1R42 super family cl40577
protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 ...
1736-1835 3.70e-03

protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 (PPP1R42), also known as leucine-rich repeat-containing protein 67 (lrrc67) or testis leucine-rich repeat (TLRR) protein, plays a role in centrosome separation. PPP1R42 has been shown to interact with the well-conserved signaling protein phosphatase-1 (PP1) and thereby increasing PP1's activity, which counters centrosome separation. Inhibition of PPP1R42 expression increases the number of centrosomes per cell while its depletion reduces the activity of PP1 leading to activation of NEK2, the kinase responsible for phosphorylation of centrosomal linker proteins promoting centrosome separation.


The actual alignment was detected with superfamily member cd21340:

Pssm-ID: 411060 [Multi-domain]  Cd Length: 220  Bit Score: 40.92  E-value: 3.70e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1736 LEQCPHIEEVSLAENNLAGGVP-RFSKR-----LPLLRQIDLEFCKIEDqaarhlAANLTLFPALEKLLLSGNLLGDevA 1809
Cdd:cd21340    86 LENLTNLEELHIENQRLPPGEKlTFDPRslaalSNSLRVLNISGNNIDS------LEPLAPLRNLEQLDASNNQISD--L 157
                          90       100
                  ....*....|....*....|....*.
gi 568957139 1810 AELAQVLPQMGQLKKVNLEWNRITAR 1835
Cdd:cd21340   158 EELLDLLSSWPSLRELDLTGNPVCKK 183
 
Name Accession Description Interval E-value
Atypical_Card pfam18461
Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts ...
1-94 3.23e-46

Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts a six alpha-helix bundle with a general death fold. Structure and sequence analysis of the NLRC5-N indicate that it possesses a fold similar to the one of the death-fold domains; however, it displays significant differences in the number of core alpha-helices and their relative orientation. Hence, it is suggested that NLRC5 belongs to the caspase recruitment domain (CARD) subfamily as an atypical CARD.


Pssm-ID: 408254  Cd Length: 95  Bit Score: 161.32  E-value: 3.23e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139     1 MDAESIRLNNENLWAWLVRLLSKNPEWLSAKLRSFLPTMDLDCSYEPSNP-EVIHRQLNRLFAQGMATWKSFINDLCFEL 79
Cdd:pfam18461    1 MDPLSLQLGTENLWPWLVRLLSKDPEWLLAKVKFFLPNMDLSSVNEAPDPkQKVSLQLRRLEAQGLATWKSFIQCVCMEL 80
                           90
                   ....*....|....*
gi 568957139    80 DVPLDMEIPLVSIWG 94
Cdd:pfam18461   81 EVPLDLEVPLLSTWG 95
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1490-1752 4.56e-31

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 125.55  E-value: 4.56e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1490 HHLEELDFSNNSLREEDTELLMGALQGTCRLKKLHLSFLPLGAS--SLALLIQGLSRMTLLQDLCLSHNQIGDVGTQCLA 1567
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLSDNALGPDGCGVLE 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1568 AILpKLPELRKFDLSHNQIGDVGTQCLAAILPKLPE-LRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRNQIGDVG 1646
Cdd:cd00116   103 SLL-RSSSLQELKLNNNGLGDRGLRLLAKGLKDLPPaLEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAG 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1647 TQCLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEPTALELAQRLP---PQLRVLCLPSSH 1723
Cdd:cd00116   182 IRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLspnISLLTLSLSCND 261
                         250       260
                  ....*....|....*....|....*....
gi 568957139 1724 LGPEGALGLAQALEQCPHIEEVSLAENNL 1752
Cdd:cd00116   262 ITDDGAKDLAEVLAEKESLLELDLRGNKF 290
NACHT pfam05729
NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in ...
223-385 1.22e-30

NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.


Pssm-ID: 399032  Cd Length: 166  Bit Score: 119.33  E-value: 1.22e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139   223 RVTVLLGKAGMGKTTLAYRLRWRWAQGQLDR-FQALFLFEFRQLNMITQLPTLPQLLFDLYLMPESEPDAVFQYLKENAQ 301
Cdd:pfam05729    1 RTVILQGEAGSGKTTLLQKIALLWAQGKLPQgFDFVFFLPCRELSRSGNARSLADLLFSQWPEPAAPVSEVWAVILELPE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139   302 EVLLIFDGLDEALHADSVgTDNAGSALTLFSELCHGNLLPGCWVMTTSRPG---KLPSCVPtEAATVHMWGFDGLRVEKY 378
Cdd:pfam05729   81 RLLLILDGLDELVSDLGQ-LDGPCPVLTLLSSLLRKKLLPGASLLLTVRPDalrDLRRGLE-EPRYLEVRGFSEDDRKQY 158

                   ....*..
gi 568957139   379 VTCFFSD 385
Cdd:pfam05729  159 VRKYFSD 165
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
611-865 9.66e-13

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 71.23  E-value: 9.66e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  611 TGPKMIELYHCVAETQDLELARFtaQSLPSRLSFHNFPLTHADLaalanilehrdDPIHLDFDGCPLePHCPEAL--VGC 688
Cdd:cd00116    79 KGCGLQELDLSDNALGPDGCGVL--ESLLRSSSLQELKLNNNGL-----------GDRGLRLLAKGL-KDLPPALekLVL 144
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  689 GQvenlsfksRKCGDAFAEALCRSLPTMGSLKTLGLTGSRITAQGISHLIQTLPLCSQLEEVSLHDNQLKDPEVLSLVEL 768
Cdd:cd00116   145 GR--------NRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAET 216
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  769 LPSLPKLQKLEELDlifylSPVTETatqqsGASDVqgKDSLKEGQSRSLQLRLQKCQLRIRDAEALVELFQKSPQLEEVN 848
Cdd:cd00116   217 LASLKSLEVLNLGD-----NNLTDA-----GAAAL--ASALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELD 284
                         250
                  ....*....|....*..
gi 568957139  849 LSGNHLEDDGCRLVAEA 865
Cdd:cd00116   285 LRGNKFGEEGAQLLAES 301
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
818-1088 3.15e-11

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 66.61  E-value: 3.15e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  818 QLRLQKCQLRIRDAEALVELFQKSPQLEEVNLSGNHLE--DDGCRLVAEAASQLHIAQKLDLSDNGLSQTGVTyVLKAMS 895
Cdd:cd00116    27 VLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGriPRGLQSLLQGLTKGCGLQELDLSDNALGPDGCG-VLESLL 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  896 TCGTLEDLHisLLNNTvvLTFAQEPREQEGSCKGRAPLISFV-----------SPVTSELS--QRSRRIRLTHCGFLAKH 962
Cdd:cd00116   106 RSSSLQELK--LNNNG--LGDRGLRLLAKGLKDLPPALEKLVlgrnrlegascEALAKALRanRDLKELNLANNGIGDAG 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  963 TETLCEALRASCqthNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMDAVFSLVQCLSSLQWVFhLDVSL 1042
Cdd:cd00116   182 IRALAEGLKANC---NLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNISL-LTLSL 257
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 568957139 1043 ESDCIFLRGAGTSRDALEPKFQtgVQVLELSQRYTSRSFCLQECQL 1088
Cdd:cd00116   258 SCNDITDDGAKDLAEVLAEKES--LLELDLRGNKFGEEGAQLLAES 301
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
1378-1706 4.33e-11

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 66.92  E-value: 4.33e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1378 LTELSISEIQRKLWLQLEFPHQ-EGNSDSMALRLAHCDLETehshlmIQLVETY--ARLQQLSLSQVSFNDNDGTSSKLL 1454
Cdd:COG4886    28 TTPQSINLNFPDSNLESVAVNRlALNLSSNTLLLLPSSLSR------LLSLDLLspSGISSLDGSENLLNLLPLPSLDLN 101
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1455 QNILLSSCEL-----KSFRLTFSQVSTKSLTHLAFGLGHchHLEELDFSNNSLREEDTELlmGALQGtcrLKKLHLSFLP 1529
Cdd:COG4886   102 LNRLRSNISElleltNLTSLDLDNNNITDIPPLIGLLKS--NLKELDLSDNKIESLPSPL--RNLPN---LKNLDLSFND 174
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1530 LgaSSLALLIQGLsrmTLLQDLCLSHNQIGDVgtQCLAAILPKLPELrkfDLSHNQIgdvgTQCLAAiLPKLPELRKFNL 1609
Cdd:COG4886   175 L--SDLPKLLSNL---SNLNNLDLSGNKISDL--PPEIELLSALEEL---DLSNNSI----IELLSS-LSNLKNLSGLEL 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1610 SHNQIghvgtQCLAAILPKLPELRKFDLSRNQIGDVGtqclaaILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLE 1689
Cdd:COG4886   240 SNNKL-----EDLPESIGNLSNLETLDLSNNQISSIS------SLGSLTNLRELDLSGNSLSNALPLIALLLLLLELLLN 308
                         330
                  ....*....|....*..
gi 568957139 1690 EIKLGNNALGEPTALEL 1706
Cdd:COG4886   309 LLLTLKALELKLNSILL 325
NLRC4_HD2 pfam17776
NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein ...
517-632 1.02e-09

NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein and NOD2 protein.


Pssm-ID: 407648  Cd Length: 122  Bit Score: 58.06  E-value: 1.02e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139   517 HLSLQEFFAALYLMASHTVDK-DTLVEYVTLNSHWVLRT------KGRLGLSDHLPAFLAGLASHTCHMFLCQLaQQDRA 589
Cdd:pfam17776    1 HLSFQEFFAALYYVLSFKEEKsNPLKEFLGLKKRESLKSaldkalKSKNGHLDLFLRFLFGLLNESNQRLLEGL-LGCKL 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
gi 568957139   590 WVGSRQaAVIQVLRKLASRKLTGPKMIELYHCVAETQDLELAR 632
Cdd:pfam17776   80 SSEIKQ-ELLQWLKELIQKELSSERFLNLFHCLYELQDESFVK 121
internalin_A NF033189
class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria ...
1471-1704 8.07e-08

class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.


Pssm-ID: 380193 [Multi-domain]  Cd Length: 799  Bit Score: 57.50  E-value: 8.07e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1471 FSQVSTKSLTHLAF----GLGHCHHLEELDFSNNSLRE----EDTELLMGALQGTCRLKKL----HLSFLplgaSSLALL 1538
Cdd:NF033189   74 LDQVTTLQADRLGIksidGLEYLNNLTQINFSNNQLTDitplKDLTKLVDILMNNNQIADItplaNLSNL----TGLTLF 149
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1539 ------IQGLSRMTLLQDLCLSHNQIGDV----GTQCLAAI-----------LPKLPELRKFDLSHNQIGDVgtqclaAI 1597
Cdd:NF033189  150 nnqitdIDPLKNLTNLNRLELSSNTISDIsalsGLTSLQQLsfgnqvtdlkpLANLTTLERLDISSNKVSDI------SV 223
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1598 LPKLPELRKFNLSHNQIGHVGTqclAAILPKLPELrkfDLSRNQIGDVGTqclaaiLPKLPELRKFDLSGNRIGPaggvq 1677
Cdd:NF033189  224 LAKLTNLESLIATNNQISDITP---LGILTNLDEL---SLNGNQLKDIGT------LASLTNLTDLDLANNQISN----- 286
                         250       260
                  ....*....|....*....|....*..
gi 568957139 1678 lVKSLTHFEHLEEIKLGNNALGEPTAL 1704
Cdd:NF033189  287 -LAPLSGLTKLTELKLGANQISNISPL 312
internalin_A NF033189
class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria ...
1437-1688 2.11e-06

class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.


Pssm-ID: 380193 [Multi-domain]  Cd Length: 799  Bit Score: 52.88  E-value: 2.11e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1437 SLSQVSFNDNDGTSSKLLQNIL-LSSCELKSFrlTFSQVST----KSLTHLAFG--------LGHCHHLEELDFSNNSLR 1503
Cdd:NF033189  142 NLTGLTLFNNQITDIDPLKNLTnLNRLELSSN--TISDISAlsglTSLQQLSFGnqvtdlkpLANLTTLERLDISSNKVS 219
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1504 EEDTELLMGALQGTCRLKKLHLSFLPLGAsslalliqglsrMTLLQDLCLSHNQIGDVGTqclaaiLPKLPELRKFDLSH 1583
Cdd:NF033189  220 DISVLAKLTNLESLIATNNQISDITPLGI------------LTNLDELSLNGNQLKDIGT------LASLTNLTDLDLAN 281
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1584 NQIGDVgtqclaAILPKLPELRKFNLSHNQIGHVGTqclaaiLPKLPELRKFDLSRNQIGDVGTqclaaiLPKLPELRKF 1663
Cdd:NF033189  282 NQISNL------APLSGLTKLTELKLGANQISNISP------LAGLTALTNLELNENQLEDISP------ISNLKNLTYL 343
                         250       260
                  ....*....|....*....|....*
gi 568957139 1664 DLSGNRIgpaGGVQLVKSLTHFEHL 1688
Cdd:NF033189  344 TLYFNNI---SDISPVSSLTKLQRL 365
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
977-1277 2.67e-06

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 51.59  E-value: 2.67e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  977 HNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMD--AVFSLVQCLSSLQWVFHLDVSlesDCIFLrgagt 1054
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLS---DNALG----- 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1055 srdalepkfQTGVQVLE-LSQRYTSRSFCLQECQLEPTSLTFLCAtlekspGPLEVQLSCKSLsddslkILLQCLpqlpq 1133
Cdd:cd00116    95 ---------PDGCGVLEsLLRSSSLQELKLNNNGLGDRGLRLLAK------GLKDLPPALEKL------VLGRNR----- 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1134 lsllqlrhtvLSSRSPFLLADIFNLCPRVRKVTL----------RSLCHAVLHFdsneeQEGVCCGFPGCSLSQEHMETL 1203
Cdd:cd00116   149 ----------LEGASCEALAKALRANRDLKELNLanngigdagiRALAEGLKAN-----CNLEVLDLNNNGLTDEGASAL 213
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568957139 1204 CCALSKCNALSQLDLTDNLLGDIGLRCLLECLPQLPIS-GWLDLSHNNISQEGILYLLETLPSYPNIQEVSVSLS 1277
Cdd:cd00116   214 AETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNISlLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGN 288
LRR_8 pfam13855
Leucine rich repeat;
1574-1642 2.60e-05

Leucine rich repeat;


Pssm-ID: 404697 [Multi-domain]  Cd Length: 61  Bit Score: 43.28  E-value: 2.60e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568957139  1574 PELRKFDLSHNQIGDVGTQCLAailpKLPELRKFNLSHNQIGHVGTQCLAailpKLPELRKFDLSRNQI 1642
Cdd:pfam13855    1 PNLRSLDLSNNRLTSLDDGAFK----GLSNLKVLDLSNNLLTTLSPGAFS----GLPSLRYLDLSGNRL 61
inl_like_NEAT_1 NF033190
NEAT domain-containing leucine-rich repeat protein; Members of this family have an N-terminal ...
1548-1724 4.50e-05

NEAT domain-containing leucine-rich repeat protein; Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.


Pssm-ID: 411101 [Multi-domain]  Cd Length: 754  Bit Score: 48.50  E-value: 4.50e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1548 LQDLCLSHNQIGDVGTqclaaiLPKLPELRKFDLSHNQIGDVgtqclaAILPKLPELRKFNLSHNQIGHVgtqclaAILP 1627
Cdd:NF033190  265 LNHLALRGNEFSDVTP------LVKMDNLESLDLSNNKITNV------APLTEMKNVKSLYLSGNQIEDV------TALA 326
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1628 KLPELRKFDLSRNQIGDVgtqclaAILPKLPELRKFDLSGNR---IGPAGGVQL---------VKSLTHFE---HLEEIK 1692
Cdd:NF033190  327 KMEQLDYLNLANNKITNV------APLSALKNVTYLTLAGNQiedIKPLYSLPLkdlvltrnkVKDLSGIDqmnQLEELW 400
                         170       180       190
                  ....*....|....*....|....*....|..
gi 568957139 1693 LGNNALGEPTALELAQrlppQLRVLCLPSSHL 1724
Cdd:NF033190  401 IGKNEIKDVTPLSKMT----QLKELDLPNNEL 428
COG5635 COG5635
Predicted NTPase, NACHT family domain [Signal transduction mechanisms];
226-533 5.92e-05

Predicted NTPase, NACHT family domain [Signal transduction mechanisms];


Pssm-ID: 227922 [Multi-domain]  Cd Length: 824  Bit Score: 48.25  E-value: 5.92e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  226 VLLGKAGMGKTTLAYRLRWRWAQGQL-----DRFQALFLFEF-----RQLNMItqlPTLPQLLFDLYLMPEsEPDAVFQY 295
Cdd:COG5635   226 LILGAPGSGKTTFLQRLALWLAQRTLepedvPIFLLLNAFALarkfeKQLSLI---DYLAEELFSQGIAKQ-LIEAHQEL 301
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  296 LKEnaQEVLLIFDGLDEALhadSVGTDNAGSALTLFSELCHGNLlpgcwVMTTSRPGKLPScVPTEAATVHMWGFDGLRV 375
Cdd:COG5635   302 LKT--GKLLLLLDGLDELE---PKNQRALIREINKFLQEYPDAQ-----VLLTCRPDTYKE-EFKGFAVFEIYKFLDLQI 370
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  376 EKYVTCFFSDL---------------LSQELALKEMRtnaRLRGMCAIPALCTVTC--FCLRRLLPGSSPGqsaallpti 438
Cdd:COG5635   371 NQFILYQWLDAfiedwfgdsrllakkLLERLKLPENR---RIKELALTPLLLALECliWQAQGDLPESRAE--------- 438
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  439 tqLYLQMVETFSPSEtllDTSILGFGKVALRGLDTG---KVVFS-----------------------VEDISPQLMSFGA 492
Cdd:COG5635   439 --LYEQAVDALLGRE---DETRGIKWSKTYAKLTTDqqdKWLLQllaallfekldeeftefllkddiVDYLLNQAEDEDD 513
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*...
gi 568957139  493 VHSL---LTSFCIHTRPG----HEEIGYAFVHLSLQEFFAALYLMASH 533
Cdd:COG5635   514 LIALalaLEALLKLLQHGllveRAKIVYAFAHATFQEYFAAKKIVASS 561
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
831-1066 1.97e-03

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 42.61  E-value: 1.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  831 AEALVELFQKSPQLEEVNLSG---NHLED---DGCRLVAEAASQLHIAQKLDLSDNGLSQTGVTYVLKAMSTCGTLEdlH 904
Cdd:COG5238    47 MEELCNVIANVRNLRVVNFSDaftGRDKDelySNLVMLLKALLKCPRLQKVDLSDNAFGSEFPEELGDLISSSTDLV--H 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  905 ISLLNNTV------VLTFAQEPREQEGSCKGRAPLISFV---------SPVTSELSQRSRR----IRLTHCGFLAKHTET 965
Cdd:COG5238   125 LKLNNNGLgpiaggRIGKALFHLAYNKKAADKPKLEVVIcgrnrlengSKELSAALLESHEnlkeVKIQQNGIRPEGVTM 204
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  966 LceALRASCQTHNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMDAVFSLVQCLSSLQWVFHLDVSLESD 1045
Cdd:COG5238   205 L--AFLGLFYSHSLEVLDLQDNTFTLEGSRYLADALCEWNLLRELRLNDCLLSNEGVKSVLRRFNEKFVPNLMPLPGDYN 282
                         250       260
                  ....*....|....*....|.
gi 568957139 1046 CIFLrgaGTSRDALEPKFQTG 1066
Cdd:COG5238   283 ERRG---GIILDISLNEFEQD 300
PPP1R42 cd21340
protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 ...
1736-1835 3.70e-03

protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 (PPP1R42), also known as leucine-rich repeat-containing protein 67 (lrrc67) or testis leucine-rich repeat (TLRR) protein, plays a role in centrosome separation. PPP1R42 has been shown to interact with the well-conserved signaling protein phosphatase-1 (PP1) and thereby increasing PP1's activity, which counters centrosome separation. Inhibition of PPP1R42 expression increases the number of centrosomes per cell while its depletion reduces the activity of PP1 leading to activation of NEK2, the kinase responsible for phosphorylation of centrosomal linker proteins promoting centrosome separation.


Pssm-ID: 411060 [Multi-domain]  Cd Length: 220  Bit Score: 40.92  E-value: 3.70e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1736 LEQCPHIEEVSLAENNLAGGVP-RFSKR-----LPLLRQIDLEFCKIEDqaarhlAANLTLFPALEKLLLSGNLLGDevA 1809
Cdd:cd21340    86 LENLTNLEELHIENQRLPPGEKlTFDPRslaalSNSLRVLNISGNNIDS------LEPLAPLRNLEQLDASNNQISD--L 157
                          90       100
                  ....*....|....*....|....*.
gi 568957139 1810 AELAQVLPQMGQLKKVNLEWNRITAR 1835
Cdd:cd21340   158 EELLDLLSSWPSLRELDLTGNPVCKK 183
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
1600-1871 7.59e-03

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 41.37  E-value: 7.59e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1600 KLPELRKFNLSHNQIGhvgTQCLAAILPKLPELRKFDLSRNQigdvgtqcLAAILPK--LPELRKFDLSGNRIGPaggvQ 1677
Cdd:PLN00113   91 RLPYIQTINLSNNQLS---GPIPDDIFTTSSSLRYLNLSNNN--------FTGSIPRgsIPNLETLDLSNNMLSG----E 155
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1678 LVKSLTHFEHLEEIKLGNNALGEPTALELAQRlpPQLRVLCLPSSHLgpegALGLAQALEQCPHIEEVSLAENNLAGGVP 1757
Cdd:PLN00113  156 IPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNL--TSLEFLTLASNQL----VGQIPRELGQMKSLKWIYLGYNNLSGEIP 229
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1758 RFSKRLPLLRQIDLEFCKIEDQAARHLaANLT----LFPALEKL-------------LLSGNLLGDEVAAELAQVLPQMG 1820
Cdd:PLN00113  230 YEIGGLTSLNHLDLVYNNLTGPIPSSL-GNLKnlqyLFLYQNKLsgpippsifslqkLISLDLSDNSLSGEIPELVIQLQ 308
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568957139 1821 QLKKVNLEWNRITARgaqlLAQGLVQGSCVPVIRLWNNPILNDVAQSLQSQ 1871
Cdd:PLN00113  309 NLEILHLFSNNFTGK----IPVALTSLPRLQVLQLWSNKFSGEIPKNLGKH 355
 
Name Accession Description Interval E-value
Atypical_Card pfam18461
Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts ...
1-94 3.23e-46

Atypical caspase recruitment domain; The N-terminal effector domain found in NLRC5. It adopts a six alpha-helix bundle with a general death fold. Structure and sequence analysis of the NLRC5-N indicate that it possesses a fold similar to the one of the death-fold domains; however, it displays significant differences in the number of core alpha-helices and their relative orientation. Hence, it is suggested that NLRC5 belongs to the caspase recruitment domain (CARD) subfamily as an atypical CARD.


Pssm-ID: 408254  Cd Length: 95  Bit Score: 161.32  E-value: 3.23e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139     1 MDAESIRLNNENLWAWLVRLLSKNPEWLSAKLRSFLPTMDLDCSYEPSNP-EVIHRQLNRLFAQGMATWKSFINDLCFEL 79
Cdd:pfam18461    1 MDPLSLQLGTENLWPWLVRLLSKDPEWLLAKVKFFLPNMDLSSVNEAPDPkQKVSLQLRRLEAQGLATWKSFIQCVCMEL 80
                           90
                   ....*....|....*
gi 568957139    80 DVPLDMEIPLVSIWG 94
Cdd:pfam18461   81 EVPLDLEVPLLSTWG 95
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1490-1752 4.56e-31

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 125.55  E-value: 4.56e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1490 HHLEELDFSNNSLREEDTELLMGALQGTCRLKKLHLSFLPLGAS--SLALLIQGLSRMTLLQDLCLSHNQIGDVGTQCLA 1567
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLSDNALGPDGCGVLE 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1568 AILpKLPELRKFDLSHNQIGDVGTQCLAAILPKLPE-LRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRNQIGDVG 1646
Cdd:cd00116   103 SLL-RSSSLQELKLNNNGLGDRGLRLLAKGLKDLPPaLEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAG 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1647 TQCLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEPTALELAQRLP---PQLRVLCLPSSH 1723
Cdd:cd00116   182 IRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLspnISLLTLSLSCND 261
                         250       260
                  ....*....|....*....|....*....
gi 568957139 1724 LGPEGALGLAQALEQCPHIEEVSLAENNL 1752
Cdd:cd00116   262 ITDDGAKDLAEVLAEKESLLELDLRGNKF 290
NACHT pfam05729
NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in ...
223-385 1.22e-30

NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.


Pssm-ID: 399032  Cd Length: 166  Bit Score: 119.33  E-value: 1.22e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139   223 RVTVLLGKAGMGKTTLAYRLRWRWAQGQLDR-FQALFLFEFRQLNMITQLPTLPQLLFDLYLMPESEPDAVFQYLKENAQ 301
Cdd:pfam05729    1 RTVILQGEAGSGKTTLLQKIALLWAQGKLPQgFDFVFFLPCRELSRSGNARSLADLLFSQWPEPAAPVSEVWAVILELPE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139   302 EVLLIFDGLDEALHADSVgTDNAGSALTLFSELCHGNLLPGCWVMTTSRPG---KLPSCVPtEAATVHMWGFDGLRVEKY 378
Cdd:pfam05729   81 RLLLILDGLDELVSDLGQ-LDGPCPVLTLLSSLLRKKLLPGASLLLTVRPDalrDLRRGLE-EPRYLEVRGFSEDDRKQY 158

                   ....*..
gi 568957139   379 VTCFFSD 385
Cdd:pfam05729  159 VRKYFSD 165
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1492-1738 3.86e-28

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 117.07  E-value: 3.86e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1492 LEELDFSNNSLREED--TELLMGALQGTCRLKKLHLSFLPLGASSLALLiQGLSRMTLLQDLCLSHNQIGDVGTQCLAAI 1569
Cdd:cd00116    53 LKELCLSLNETGRIPrgLQSLLQGLTKGCGLQELDLSDNALGPDGCGVL-ESLLRSSSLQELKLNNNGLGDRGLRLLAKG 131
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1570 LPKLPE-LRKFDLSHNQIGDVGTQCLAAILPKLPELRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRNQIGDVGTQ 1648
Cdd:cd00116   132 LKDLPPaLEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGAS 211
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1649 CLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEH-LEEIKLGNNALGEPTALELAQRLP--PQLRVLCLPSSHLG 1725
Cdd:cd00116   212 ALAETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNIsLLTLSLSCNDITDDGAKDLAEVLAekESLLELDLRGNKFG 291
                         250
                  ....*....|...
gi 568957139 1726 PEGALGLAQALEQ 1738
Cdd:cd00116   292 EEGAQLLAESLLE 304
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1548-1857 1.55e-27

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 115.15  E-value: 1.55e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1548 LQDLCLSHNQIGDVGTQCLAAILPKLPELRKFDLSHNQIG--DVGTQCLAAILPKLPELRKFNLSHNQIGHVGTQCLAAI 1625
Cdd:cd00116    25 LQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGriPRGLQSLLQGLTKGCGLQELDLSDNALGPDGCGVLESL 104
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1626 LpKLPELRKFDLSRNQIGDVGTQCLAAILPKLPE-LRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEPTAL 1704
Cdd:cd00116   105 L-RSSSLQELKLNNNGLGDRGLRLLAKGLKDLPPaLEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAGIR 183
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1705 ELAQRLP--PQLRVLCLPSSHLGPEGALGLAQALEQcphieevslaennlaggvprfskrLPLLRQIDLEFCKIEDQAAR 1782
Cdd:cd00116   184 ALAEGLKanCNLEVLDLNNNGLTDEGASALAETLAS------------------------LKSLEVLNLGDNNLTDAGAA 239
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568957139 1783 HLA-ANLTLFPALEKLLLSGNLLGDEVAAELAQVLPQMGQLKKVNLEWNRITARGAQLLAQGLVQGSCVPvIRLWN 1857
Cdd:cd00116   240 ALAsALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGNKFGEEGAQLLAESLLEPGNEL-ESLWV 314
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1407-1654 1.79e-25

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 109.37  E-value: 1.79e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1407 ALRLAHCDLETEHS----HLMIQLVETYARLQQLSLSQVSFNDndgTSSKLLQNILLSScELKSFRLTFSQVSTKSLTHL 1482
Cdd:cd00116    53 LKELCLSLNETGRIprglQSLLQGLTKGCGLQELDLSDNALGP---DGCGVLESLLRSS-SLQELKLNNNGLGDRGLRLL 128
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1483 AFGLGHC-HHLEELDFSNNSLREEDTELLMGALQGTCRLKKLHLSFLPLGASSLALLIQGLSRMTLLQDLCLSHNQIGDV 1561
Cdd:cd00116   129 AKGLKDLpPALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDE 208
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1562 GTQCLAAILPKLPELRKFDLSHNQIGDVGTQCLAAILPKL-PELRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRN 1640
Cdd:cd00116   209 GASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLSPnISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGN 288
                         250
                  ....*....|....
gi 568957139 1641 QIGDVGTQCLAAIL 1654
Cdd:cd00116   289 KFGEEGAQLLAESL 302
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
1597-1868 2.78e-21

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 97.04  E-value: 2.78e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1597 ILPKLPELRKFNLSHNQIGHVGTQCLAAILPKLPELRKFDLSRNQIG--DVGTQCLAAILPKLPELRKFDLSGNRIGPAG 1674
Cdd:cd00116    18 LLPKLLCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGriPRGLQSLLQGLTKGCGLQELDLSDNALGPDG 97
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1675 gVQLVKSLTHFEHLEEIKLGNNALGePTALELAQR----LPPQLRVLCLPSSHLGPEGALGLAQALEQCPHIEEVSLAEN 1750
Cdd:cd00116    98 -CGVLESLLRSSSLQELKLNNNGLG-DRGLRLLAKglkdLPPALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANN 175
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1751 NlaggvprfskrlpllrqidlefckIEDQAARHLAANLTLFPALEKLLLSGNLLGDEVAAELAQVLPQMGQLKKVNLEWN 1830
Cdd:cd00116   176 G------------------------IGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDN 231
                         250       260       270
                  ....*....|....*....|....*....|....*....
gi 568957139 1831 RITARGAQLLAQGLVQGS-CVPVIRLWNNPILNDVAQSL 1868
Cdd:cd00116   232 NLTDAGAAALASALLSPNiSLLTLSLSCNDITDDGAKDL 270
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
611-865 9.66e-13

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 71.23  E-value: 9.66e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  611 TGPKMIELYHCVAETQDLELARFtaQSLPSRLSFHNFPLTHADLaalanilehrdDPIHLDFDGCPLePHCPEAL--VGC 688
Cdd:cd00116    79 KGCGLQELDLSDNALGPDGCGVL--ESLLRSSSLQELKLNNNGL-----------GDRGLRLLAKGL-KDLPPALekLVL 144
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  689 GQvenlsfksRKCGDAFAEALCRSLPTMGSLKTLGLTGSRITAQGISHLIQTLPLCSQLEEVSLHDNQLKDPEVLSLVEL 768
Cdd:cd00116   145 GR--------NRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAET 216
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  769 LPSLPKLQKLEELDlifylSPVTETatqqsGASDVqgKDSLKEGQSRSLQLRLQKCQLRIRDAEALVELFQKSPQLEEVN 848
Cdd:cd00116   217 LASLKSLEVLNLGD-----NNLTDA-----GAAAL--ASALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELD 284
                         250
                  ....*....|....*..
gi 568957139  849 LSGNHLEDDGCRLVAEA 865
Cdd:cd00116   285 LRGNKFGEEGAQLLAES 301
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
818-1088 3.15e-11

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 66.61  E-value: 3.15e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  818 QLRLQKCQLRIRDAEALVELFQKSPQLEEVNLSGNHLE--DDGCRLVAEAASQLHIAQKLDLSDNGLSQTGVTyVLKAMS 895
Cdd:cd00116    27 VLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGriPRGLQSLLQGLTKGCGLQELDLSDNALGPDGCG-VLESLL 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  896 TCGTLEDLHisLLNNTvvLTFAQEPREQEGSCKGRAPLISFV-----------SPVTSELS--QRSRRIRLTHCGFLAKH 962
Cdd:cd00116   106 RSSSLQELK--LNNNG--LGDRGLRLLAKGLKDLPPALEKLVlgrnrlegascEALAKALRanRDLKELNLANNGIGDAG 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  963 TETLCEALRASCqthNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMDAVFSLVQCLSSLQWVFhLDVSL 1042
Cdd:cd00116   182 IRALAEGLKANC---NLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNISL-LTLSL 257
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 568957139 1043 ESDCIFLRGAGTSRDALEPKFQtgVQVLELSQRYTSRSFCLQECQL 1088
Cdd:cd00116   258 SCNDITDDGAKDLAEVLAEKES--LLELDLRGNKFGEEGAQLLAES 301
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
1378-1706 4.33e-11

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 66.92  E-value: 4.33e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1378 LTELSISEIQRKLWLQLEFPHQ-EGNSDSMALRLAHCDLETehshlmIQLVETY--ARLQQLSLSQVSFNDNDGTSSKLL 1454
Cdd:COG4886    28 TTPQSINLNFPDSNLESVAVNRlALNLSSNTLLLLPSSLSR------LLSLDLLspSGISSLDGSENLLNLLPLPSLDLN 101
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1455 QNILLSSCEL-----KSFRLTFSQVSTKSLTHLAFGLGHchHLEELDFSNNSLREEDTELlmGALQGtcrLKKLHLSFLP 1529
Cdd:COG4886   102 LNRLRSNISElleltNLTSLDLDNNNITDIPPLIGLLKS--NLKELDLSDNKIESLPSPL--RNLPN---LKNLDLSFND 174
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1530 LgaSSLALLIQGLsrmTLLQDLCLSHNQIGDVgtQCLAAILPKLPELrkfDLSHNQIgdvgTQCLAAiLPKLPELRKFNL 1609
Cdd:COG4886   175 L--SDLPKLLSNL---SNLNNLDLSGNKISDL--PPEIELLSALEEL---DLSNNSI----IELLSS-LSNLKNLSGLEL 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1610 SHNQIghvgtQCLAAILPKLPELRKFDLSRNQIGDVGtqclaaILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLE 1689
Cdd:COG4886   240 SNNKL-----EDLPESIGNLSNLETLDLSNNQISSIS------SLGSLTNLRELDLSGNSLSNALPLIALLLLLLELLLN 308
                         330
                  ....*....|....*..
gi 568957139 1690 EIKLGNNALGEPTALEL 1706
Cdd:COG4886   309 LLLTLKALELKLNSILL 325
PPP1R42 cd21340
protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 ...
1477-1670 1.37e-10

protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 (PPP1R42), also known as leucine-rich repeat-containing protein 67 (lrrc67) or testis leucine-rich repeat (TLRR) protein, plays a role in centrosome separation. PPP1R42 has been shown to interact with the well-conserved signaling protein phosphatase-1 (PP1) and thereby increasing PP1's activity, which counters centrosome separation. Inhibition of PPP1R42 expression increases the number of centrosomes per cell while its depletion reduces the activity of PP1 leading to activation of NEK2, the kinase responsible for phosphorylation of centrosomal linker proteins promoting centrosome separation.


Pssm-ID: 411060 [Multi-domain]  Cd Length: 220  Bit Score: 62.88  E-value: 1.37e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1477 KSLTHLAF---------GLGHCHHLEELDFSNNSLREedtellMGALQGTCRLKKLHLS--FLplgaSSlallIQGLSRM 1545
Cdd:cd21340     2 KRITHLYLndknitkidNLSLCKNLKVLYLYDNKITK------IENLEFLTNLTHLYLQnnQI----EK----IENLENL 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1546 TLLQDLCLSHNQIGDV-GtqclaaiLPKLPELRKFDLSHNQIGD-----VGTQCLAAIlpkLPELRKFNLSHNQIghvgt 1619
Cdd:cd21340    68 VNLKKLYLGGNRISVVeG-------LENLTNLEELHIENQRLPPgekltFDPRSLAAL---SNSLRVLNISGNNI----- 132
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568957139 1620 QCLAAILPkLPELRKFDLSRNQIGDVgtQCLAAILPKLPELRKFDLSGNRI 1670
Cdd:cd21340   133 DSLEPLAP-LRNLEQLDASNNQISDL--EELLDLLSSWPSLRELDLTGNPV 180
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
817-1126 7.12e-10

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 62.37  E-value: 7.12e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  817 LQLRLQKCQLRIRDAEalvELFQKSPQLEEVNLSGNHLEDDGCRLVAEAASQLHIAQKLDLSDN--GLSQTGVTYVLKAM 894
Cdd:cd00116     1 LQLSLKGELLKTERAT---ELLPKLLCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNetGRIPRGLQSLLQGL 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  895 STCGTLEdlHISLLNNTvvLTFAqepreqegsckGRAPLISFVSPVTSELSQrsrrirLTHCGFLAKHTETLCEALRaSC 974
Cdd:cd00116    78 TKGCGLQ--ELDLSDNA--LGPD-----------GCGVLESLLRSSSLQELK------LNNNGLGDRGLRLLAKGLK-DL 135
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  975 QtHNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMDAVFSLVQCLSSLQWVFHLDvsLESDCIFLRGAGT 1054
Cdd:cd00116   136 P-PALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNLEVLD--LNNNGLTDEGASA 212
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 568957139 1055 SRDALEPKFQtgVQVLELSQrytsrsfCLqeCQLEPTSlTFLCATLEKSPGPLEVQLSCKSLSDDSLKILLQ 1126
Cdd:cd00116   213 LAETLASLKS--LEVLNLGD-------NN--LTDAGAA-ALASALLSPNISLLTLSLSCNDITDDGAKDLAE 272
NLRC4_HD2 pfam17776
NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein ...
517-632 1.02e-09

NLRC4 helical domain HD2; This entry represents a helical domain found in the NLRC4 protein and NOD2 protein.


Pssm-ID: 407648  Cd Length: 122  Bit Score: 58.06  E-value: 1.02e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139   517 HLSLQEFFAALYLMASHTVDK-DTLVEYVTLNSHWVLRT------KGRLGLSDHLPAFLAGLASHTCHMFLCQLaQQDRA 589
Cdd:pfam17776    1 HLSFQEFFAALYYVLSFKEEKsNPLKEFLGLKKRESLKSaldkalKSKNGHLDLFLRFLFGLLNESNQRLLEGL-LGCKL 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
gi 568957139   590 WVGSRQaAVIQVLRKLASRKLTGPKMIELYHCVAETQDLELAR 632
Cdd:pfam17776   80 SSEIKQ-ELLQWLKELIQKELSSERFLNLFHCLYELQDESFVK 121
internalin_A NF033189
class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria ...
1471-1704 8.07e-08

class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.


Pssm-ID: 380193 [Multi-domain]  Cd Length: 799  Bit Score: 57.50  E-value: 8.07e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1471 FSQVSTKSLTHLAF----GLGHCHHLEELDFSNNSLRE----EDTELLMGALQGTCRLKKL----HLSFLplgaSSLALL 1538
Cdd:NF033189   74 LDQVTTLQADRLGIksidGLEYLNNLTQINFSNNQLTDitplKDLTKLVDILMNNNQIADItplaNLSNL----TGLTLF 149
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1539 ------IQGLSRMTLLQDLCLSHNQIGDV----GTQCLAAI-----------LPKLPELRKFDLSHNQIGDVgtqclaAI 1597
Cdd:NF033189  150 nnqitdIDPLKNLTNLNRLELSSNTISDIsalsGLTSLQQLsfgnqvtdlkpLANLTTLERLDISSNKVSDI------SV 223
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1598 LPKLPELRKFNLSHNQIGHVGTqclAAILPKLPELrkfDLSRNQIGDVGTqclaaiLPKLPELRKFDLSGNRIGPaggvq 1677
Cdd:NF033189  224 LAKLTNLESLIATNNQISDITP---LGILTNLDEL---SLNGNQLKDIGT------LASLTNLTDLDLANNQISN----- 286
                         250       260
                  ....*....|....*....|....*..
gi 568957139 1678 lVKSLTHFEHLEEIKLGNNALGEPTAL 1704
Cdd:NF033189  287 -LAPLSGLTKLTELKLGANQISNISPL 312
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
1568-1832 1.45e-07

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 55.70  E-value: 1.45e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1568 AILPKLPELRKFDLSHNQIGDVGTQCLAAILPKLPELRKFNLSHNQIGHVGTQC------LAAILPKLPELRKFDLSRNQ 1641
Cdd:COG5238    24 EELEMMDELVEVDLSGNTIGTEAMEELCNVIANVRNLRVVNFSDAFTGRDKDELysnlvmLLKALLKCPRLQKVDLSDNA 103
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1642 IGDVGTQCLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEH---------LEEIKLGNNALGEPTALELAQRLPP 1712
Cdd:COG5238   104 FGSEFPEELGDLISSSTDLVHLKLNNNGLGPIAGGRIGKALFHLAYnkkaadkpkLEVVICGRNRLENGSKELSAALLES 183
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1713 Q--LRVLCLPSSHLGPEGALGLA-QALEQCPHIEEVSLAENNLAGGVPRFSKRL----PLLRQIDLEFCKIEDQAARHL- 1784
Cdd:COG5238   184 HenLKEVKIQQNGIRPEGVTMLAfLGLFYSHSLEVLDLQDNTFTLEGSRYLADAlcewNLLRELRLNDCLLSNEGVKSVl 263
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 568957139 1785 -AANLTLFPALEKLLLSGNLLgdEVAAELAQVLPQMGQ-----LKKVNLEWNRI 1832
Cdd:COG5238   264 rRFNEKFVPNLMPLPGDYNER--RGGIILDISLNEFEQdavplLVDLERNGNRI 315
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
706-1015 2.85e-07

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 54.28  E-value: 2.85e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  706 AEALCRSLPTMGSLKTLGL----TGSRITAQGIshLIQTLPLCSQLEEVSLHDNQLKDpevlSLVELLPSLPKLQKLEEL 781
Cdd:cd00116    40 AKALASALRPQPSLKELCLslneTGRIPRGLQS--LLQGLTKGCGLQELDLSDNALGP----DGCGVLESLLRSSSLQEL 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  782 DLifylspvtetatQQSGASDVQGK---DSLKEGQSRSLQLRLQKCQLRIRDAEALVELFQKSPQLEEVNLSGNHL---- 854
Cdd:cd00116   114 KL------------NNNGLGDRGLRllaKGLKDLPPALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIgdag 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  855 ------------------------EDDGCRLVAEAASQLHIAQKLDLSDNGLSQTGVTYVLKAMSTcgtledlhisllnn 910
Cdd:cd00116   182 iralaeglkancnlevldlnnnglTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLS-------------- 247
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  911 tvvltfaqepreqegsckgraplisfvspvtseLSQRSRRIRLTHCGFLAKHTETLCEALRASCQthnLDHLDLSDNSLG 990
Cdd:cd00116   248 ---------------------------------PNISLLTLSLSCNDITDDGAKDLAEVLAEKES---LLELDLRGNKFG 291
                         330       340
                  ....*....|....*....|....*.
gi 568957139  991 GKGVILLTELLPGLGP-LKSLNLSRN 1015
Cdd:cd00116   292 EEGAQLLAESLLEPGNeLESLWVKDD 317
internalin_A NF033189
class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria ...
1437-1688 2.11e-06

class 1 internalin InlA; Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.


Pssm-ID: 380193 [Multi-domain]  Cd Length: 799  Bit Score: 52.88  E-value: 2.11e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1437 SLSQVSFNDNDGTSSKLLQNIL-LSSCELKSFrlTFSQVST----KSLTHLAFG--------LGHCHHLEELDFSNNSLR 1503
Cdd:NF033189  142 NLTGLTLFNNQITDIDPLKNLTnLNRLELSSN--TISDISAlsglTSLQQLSFGnqvtdlkpLANLTTLERLDISSNKVS 219
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1504 EEDTELLMGALQGTCRLKKLHLSFLPLGAsslalliqglsrMTLLQDLCLSHNQIGDVGTqclaaiLPKLPELRKFDLSH 1583
Cdd:NF033189  220 DISVLAKLTNLESLIATNNQISDITPLGI------------LTNLDELSLNGNQLKDIGT------LASLTNLTDLDLAN 281
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1584 NQIGDVgtqclaAILPKLPELRKFNLSHNQIGHVGTqclaaiLPKLPELRKFDLSRNQIGDVGTqclaaiLPKLPELRKF 1663
Cdd:NF033189  282 NQISNL------APLSGLTKLTELKLGANQISNISP------LAGLTALTNLELNENQLEDISP------ISNLKNLTYL 343
                         250       260
                  ....*....|....*....|....*
gi 568957139 1664 DLSGNRIgpaGGVQLVKSLTHFEHL 1688
Cdd:NF033189  344 TLYFNNI---SDISPVSSLTKLQRL 365
LRR_RI cd00116
Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 ...
977-1277 2.67e-06

Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).


Pssm-ID: 238064 [Multi-domain]  Cd Length: 319  Bit Score: 51.59  E-value: 2.67e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  977 HNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMD--AVFSLVQCLSSLQWVFHLDVSlesDCIFLrgagt 1054
Cdd:cd00116    23 LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIprGLQSLLQGLTKGCGLQELDLS---DNALG----- 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1055 srdalepkfQTGVQVLE-LSQRYTSRSFCLQECQLEPTSLTFLCAtlekspGPLEVQLSCKSLsddslkILLQCLpqlpq 1133
Cdd:cd00116    95 ---------PDGCGVLEsLLRSSSLQELKLNNNGLGDRGLRLLAK------GLKDLPPALEKL------VLGRNR----- 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1134 lsllqlrhtvLSSRSPFLLADIFNLCPRVRKVTL----------RSLCHAVLHFdsneeQEGVCCGFPGCSLSQEHMETL 1203
Cdd:cd00116   149 ----------LEGASCEALAKALRANRDLKELNLanngigdagiRALAEGLKAN-----CNLEVLDLNNNGLTDEGASAL 213
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568957139 1204 CCALSKCNALSQLDLTDNLLGDIGLRCLLECLPQLPIS-GWLDLSHNNISQEGILYLLETLPSYPNIQEVSVSLS 1277
Cdd:cd00116   214 AETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNISlLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGN 288
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
1492-1807 4.27e-06

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 51.08  E-value: 4.27e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1492 LEELDFSNNSLREEDTELLMGALQGTCRLKKLHLSFLPLG------ASSLALLIQGLSrmtllqdlclshnqigdvgtqc 1565
Cdd:COG5238    32 LVEVDLSGNTIGTEAMEELCNVIANVRNLRVVNFSDAFTGrdkdelYSNLVMLLKALL---------------------- 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1566 laailpKLPELRKFDLSHNQIGDVGTQCLAAILPKLPELRKFNLSHNQIGHVGTQCLAAILPKLPELRKfdlsrnqigdv 1645
Cdd:COG5238    90 ------KCPRLQKVDLSDNAFGSEFPEELGDLISSSTDLVHLKLNNNGLGPIAGGRIGKALFHLAYNKK----------- 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1646 gtqclAAILPKlpeLRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEPT----ALELAQRLpPQLRVLCLPS 1721
Cdd:COG5238   153 -----AADKPK---LEVVICGRNRLENGSKELSAALLESHENLKEVKIQQNGIRPEGvtmlAFLGLFYS-HSLEVLDLQD 223
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1722 SHLGPEGALGLAQALEQCPHIEEVSLAENNL-AGGVPRFSKRL-----PLLRQIDLEFCKIEDQAARHLAANLTL---FP 1792
Cdd:COG5238   224 NTFTLEGSRYLADALCEWNLLRELRLNDCLLsNEGVKSVLRRFnekfvPNLMPLPGDYNERRGGIILDISLNEFEqdaVP 303
                         330
                  ....*....|....*
gi 568957139 1793 ALEKLLLSGNLLGDE 1807
Cdd:COG5238   304 LLVDLERNGNRIKEL 318
LRR_8 pfam13855
Leucine rich repeat;
1574-1642 2.60e-05

Leucine rich repeat;


Pssm-ID: 404697 [Multi-domain]  Cd Length: 61  Bit Score: 43.28  E-value: 2.60e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568957139  1574 PELRKFDLSHNQIGDVGTQCLAailpKLPELRKFNLSHNQIGHVGTQCLAailpKLPELRKFDLSRNQI 1642
Cdd:pfam13855    1 PNLRSLDLSNNRLTSLDDGAFK----GLSNLKVLDLSNNLLTTLSPGAFS----GLPSLRYLDLSGNRL 61
inl_like_NEAT_1 NF033190
NEAT domain-containing leucine-rich repeat protein; Members of this family have an N-terminal ...
1548-1724 4.50e-05

NEAT domain-containing leucine-rich repeat protein; Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.


Pssm-ID: 411101 [Multi-domain]  Cd Length: 754  Bit Score: 48.50  E-value: 4.50e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1548 LQDLCLSHNQIGDVGTqclaaiLPKLPELRKFDLSHNQIGDVgtqclaAILPKLPELRKFNLSHNQIGHVgtqclaAILP 1627
Cdd:NF033190  265 LNHLALRGNEFSDVTP------LVKMDNLESLDLSNNKITNV------APLTEMKNVKSLYLSGNQIEDV------TALA 326
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1628 KLPELRKFDLSRNQIGDVgtqclaAILPKLPELRKFDLSGNR---IGPAGGVQL---------VKSLTHFE---HLEEIK 1692
Cdd:NF033190  327 KMEQLDYLNLANNKITNV------APLSALKNVTYLTLAGNQiedIKPLYSLPLkdlvltrnkVKDLSGIDqmnQLEELW 400
                         170       180       190
                  ....*....|....*....|....*....|..
gi 568957139 1693 LGNNALGEPTALELAQrlppQLRVLCLPSSHL 1724
Cdd:NF033190  401 IGKNEIKDVTPLSKMT----QLKELDLPNNEL 428
COG5635 COG5635
Predicted NTPase, NACHT family domain [Signal transduction mechanisms];
226-533 5.92e-05

Predicted NTPase, NACHT family domain [Signal transduction mechanisms];


Pssm-ID: 227922 [Multi-domain]  Cd Length: 824  Bit Score: 48.25  E-value: 5.92e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  226 VLLGKAGMGKTTLAYRLRWRWAQGQL-----DRFQALFLFEF-----RQLNMItqlPTLPQLLFDLYLMPEsEPDAVFQY 295
Cdd:COG5635   226 LILGAPGSGKTTFLQRLALWLAQRTLepedvPIFLLLNAFALarkfeKQLSLI---DYLAEELFSQGIAKQ-LIEAHQEL 301
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  296 LKEnaQEVLLIFDGLDEALhadSVGTDNAGSALTLFSELCHGNLlpgcwVMTTSRPGKLPScVPTEAATVHMWGFDGLRV 375
Cdd:COG5635   302 LKT--GKLLLLLDGLDELE---PKNQRALIREINKFLQEYPDAQ-----VLLTCRPDTYKE-EFKGFAVFEIYKFLDLQI 370
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  376 EKYVTCFFSDL---------------LSQELALKEMRtnaRLRGMCAIPALCTVTC--FCLRRLLPGSSPGqsaallpti 438
Cdd:COG5635   371 NQFILYQWLDAfiedwfgdsrllakkLLERLKLPENR---RIKELALTPLLLALECliWQAQGDLPESRAE--------- 438
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  439 tqLYLQMVETFSPSEtllDTSILGFGKVALRGLDTG---KVVFS-----------------------VEDISPQLMSFGA 492
Cdd:COG5635   439 --LYEQAVDALLGRE---DETRGIKWSKTYAKLTTDqqdKWLLQllaallfekldeeftefllkddiVDYLLNQAEDEDD 513
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*...
gi 568957139  493 VHSL---LTSFCIHTRPG----HEEIGYAFVHLSLQEFFAALYLMASH 533
Cdd:COG5635   514 LIALalaLEALLKLLQHGllveRAKIVYAFAHATFQEYFAAKKIVASS 561
LRR_8 pfam13855
Leucine rich repeat;
1602-1670 7.58e-05

Leucine rich repeat;


Pssm-ID: 404697 [Multi-domain]  Cd Length: 61  Bit Score: 42.13  E-value: 7.58e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568957139  1602 PELRKFNLSHNQIGHVGTQCLAailpKLPELRKFDLSRNQIGDVGTQCLAailpKLPELRKFDLSGNRI 1670
Cdd:pfam13855    1 PNLRSLDLSNNRLTSLDDGAFK----GLSNLKVLDLSNNLLTTLSPGAFS----GLPSLRYLDLSGNRL 61
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
1652-1841 1.63e-04

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 46.07  E-value: 1.63e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1652 AILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFEHLEEIKLGNNALGEptaleLAQRLPPQLRVLclpsshlgpegalg 1731
Cdd:COG5238    24 EELEMMDELVEVDLSGNTIGTEAMEELCNVIANVRNLRVVNFSDAFTGR-----DKDELYSNLVML-------------- 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1732 lAQALEQCPHIEEVSLAENNLAggvPRFSKRLP--LLRQIDLEFCKIED------------QAARHLAANLTLF--PALE 1795
Cdd:COG5238    85 -LKALLKCPRLQKVDLSDNAFG---SEFPEELGdlISSSTDLVHLKLNNnglgpiaggrigKALFHLAYNKKAAdkPKLE 160
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*.
gi 568957139 1796 KLLLSGNLLGDEVAAELAQVLPQMGQLKKVNLEWNRITARGAQLLA 1841
Cdd:COG5238   161 VVICGRNRLENGSKELSAALLESHENLKEVKIQQNGIRPEGVTMLA 206
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
1452-1670 6.57e-04

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 44.15  E-value: 6.57e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1452 KLLQNILLSSCELKSFRLTFSQVSTKSLTHLAFGLGHCHHLEELDFSNNSLREEDTELLMGALQGTCRLKKL-HLSFLP- 1529
Cdd:COG5238    82 VMLLKALLKCPRLQKVDLSDNAFGSEFPEELGDLISSSTDLVHLKLNNNGLGPIAGGRIGKALFHLAYNKKAaDKPKLEv 161
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1530 -------LGASSLALLIQGLSRMTLLQDLCLSHNQIGDVGTQCLAAI-LPKLPELRKFDLSHNQIGDVGTQCLAAILPKL 1601
Cdd:COG5238   162 vicgrnrLENGSKELSAALLESHENLKEVKIQQNGIRPEGVTMLAFLgLFYSHSLEVLDLQDNTFTLEGSRYLADALCEW 241
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 568957139 1602 PELRKFNLSHNQIGHVGTQCLAAILPKL--PELR--KFDLSRNQIGDVGTQCLAAILP-KLPELRKFDLSGNRI 1670
Cdd:COG5238   242 NLLRELRLNDCLLSNEGVKSVLRRFNEKfvPNLMplPGDYNERRGGIILDISLNEFEQdAVPLLVDLERNGNRI 315
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
1478-1686 1.18e-03

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 43.38  E-value: 1.18e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1478 SLTHLAFGLGHCHHLEELDFSNNSlreedtellmgalqgtcrlkklhlsflpLGASSLALLIQGLSRMTLLQDLCLSHNQ 1557
Cdd:COG5238    80 NLVMLLKALLKCPRLQKVDLSDNA----------------------------FGSEFPEELGDLISSSTDLVHLKLNNNG 131
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1558 IGDVGTQCLAAILPKL---------PELRKFDLSHNQIGDVGTQCLAAILPKLPELRKFNLSHNQIGHVGTQCLAAI-LP 1627
Cdd:COG5238   132 LGPIAGGRIGKALFHLaynkkaadkPKLEVVICGRNRLENGSKELSAALLESHENLKEVKIQQNGIRPEGVTMLAFLgLF 211
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 568957139 1628 KLPELRKFDLSRNQIGDVGTQCLAAILPKLPELRKFDLSGNRIGPAGGVQLVKSLTHFE 1686
Cdd:COG5238   212 YSHSLEVLDLQDNTFTLEGSRYLADALCEWNLLRELRLNDCLLSNEGVKSVLRRFNEKF 270
RNA1 COG5238
Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal ...
831-1066 1.97e-03

Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms, RNA processing and modification];


Pssm-ID: 227563 [Multi-domain]  Cd Length: 388  Bit Score: 42.61  E-value: 1.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  831 AEALVELFQKSPQLEEVNLSG---NHLED---DGCRLVAEAASQLHIAQKLDLSDNGLSQTGVTYVLKAMSTCGTLEdlH 904
Cdd:COG5238    47 MEELCNVIANVRNLRVVNFSDaftGRDKDelySNLVMLLKALLKCPRLQKVDLSDNAFGSEFPEELGDLISSSTDLV--H 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  905 ISLLNNTV------VLTFAQEPREQEGSCKGRAPLISFV---------SPVTSELSQRSRR----IRLTHCGFLAKHTET 965
Cdd:COG5238   125 LKLNNNGLgpiaggRIGKALFHLAYNKKAADKPKLEVVIcgrnrlengSKELSAALLESHEnlkeVKIQQNGIRPEGVTM 204
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139  966 LceALRASCQTHNLDHLDLSDNSLGGKGVILLTELLPGLGPLKSLNLSRNGLSMDAVFSLVQCLSSLQWVFHLDVSLESD 1045
Cdd:COG5238   205 L--AFLGLFYSHSLEVLDLQDNTFTLEGSRYLADALCEWNLLRELRLNDCLLSNEGVKSVLRRFNEKFVPNLMPLPGDYN 282
                         250       260
                  ....*....|....*....|.
gi 568957139 1046 CIFLrgaGTSRDALEPKFQTG 1066
Cdd:COG5238   283 ERRG---GIILDISLNEFEQD 300
LRR_8 pfam13855
Leucine rich repeat;
1548-1614 2.15e-03

Leucine rich repeat;


Pssm-ID: 404697 [Multi-domain]  Cd Length: 61  Bit Score: 37.89  E-value: 2.15e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568957139  1548 LQDLCLSHNQIGDVGTQCLAailpKLPELRKFDLSHNQIGDVGTQCLAailpKLPELRKFNLSHNQI 1614
Cdd:pfam13855    3 LRSLDLSNNRLTSLDDGAFK----GLSNLKVLDLSNNLLTTLSPGAFS----GLPSLRYLDLSGNRL 61
PPP1R42 cd21340
protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 ...
1736-1835 3.70e-03

protein phosphatase 1 regulatory subunit 42; Protein phosphatase 1 regulatory subunit 42 (PPP1R42), also known as leucine-rich repeat-containing protein 67 (lrrc67) or testis leucine-rich repeat (TLRR) protein, plays a role in centrosome separation. PPP1R42 has been shown to interact with the well-conserved signaling protein phosphatase-1 (PP1) and thereby increasing PP1's activity, which counters centrosome separation. Inhibition of PPP1R42 expression increases the number of centrosomes per cell while its depletion reduces the activity of PP1 leading to activation of NEK2, the kinase responsible for phosphorylation of centrosomal linker proteins promoting centrosome separation.


Pssm-ID: 411060 [Multi-domain]  Cd Length: 220  Bit Score: 40.92  E-value: 3.70e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1736 LEQCPHIEEVSLAENNLAGGVP-RFSKR-----LPLLRQIDLEFCKIEDqaarhlAANLTLFPALEKLLLSGNLLGDevA 1809
Cdd:cd21340    86 LENLTNLEELHIENQRLPPGEKlTFDPRslaalSNSLRVLNISGNNIDS------LEPLAPLRNLEQLDASNNQISD--L 157
                          90       100
                  ....*....|....*....|....*.
gi 568957139 1810 AELAQVLPQMGQLKKVNLEWNRITAR 1835
Cdd:cd21340   158 EELLDLLSSWPSLRELDLTGNPVCKK 183
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
1600-1871 7.59e-03

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 41.37  E-value: 7.59e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1600 KLPELRKFNLSHNQIGhvgTQCLAAILPKLPELRKFDLSRNQigdvgtqcLAAILPK--LPELRKFDLSGNRIGPaggvQ 1677
Cdd:PLN00113   91 RLPYIQTINLSNNQLS---GPIPDDIFTTSSSLRYLNLSNNN--------FTGSIPRgsIPNLETLDLSNNMLSG----E 155
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1678 LVKSLTHFEHLEEIKLGNNALGEPTALELAQRlpPQLRVLCLPSSHLgpegALGLAQALEQCPHIEEVSLAENNLAGGVP 1757
Cdd:PLN00113  156 IPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNL--TSLEFLTLASNQL----VGQIPRELGQMKSLKWIYLGYNNLSGEIP 229
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568957139 1758 RFSKRLPLLRQIDLEFCKIEDQAARHLaANLT----LFPALEKL-------------LLSGNLLGDEVAAELAQVLPQMG 1820
Cdd:PLN00113  230 YEIGGLTSLNHLDLVYNNLTGPIPSSL-GNLKnlqyLFLYQNKLsgpippsifslqkLISLDLSDNSLSGEIPELVIQLQ 308
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568957139 1821 QLKKVNLEWNRITARgaqlLAQGLVQGSCVPVIRLWNNPILNDVAQSLQSQ 1871
Cdd:PLN00113  309 NLEILHLFSNNFTGK----IPVALTSLPRLQVLQLWSNKFSGEIPKNLGKH 355
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH