NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568926925|ref|XP_006538097|]
View 

FK506-binding protein 15 isoform X1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
192-285 4.51e-28

FKBP-type peptidyl-prolyl cis-trans isomerase;


:

Pssm-ID: 395196  Cd Length: 94  Bit Score: 108.83  E-value: 4.51e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   192 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGW 271
Cdd:pfam00254    4 KAKKGDRVTVHYTGRLED----GTVFDSSYDRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGG 79
                           90
                   ....*....|....
gi 568926925   272 TQPTDSILVFEVEV 285
Cdd:pfam00254   80 VIPPNATLVFEVEL 93
Smc super family cl34174
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
561-890 9.53e-21

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


The actual alignment was detected with superfamily member COG1196:

Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 99.02  E-value: 9.53e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  561 IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVT 640
Cdd:COG1196   679 LEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEEL--------KRELAALEEELEQLQSRLEELEEELEELE 750
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  641 EELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 720
Cdd:COG1196   751 EELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEI 830
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  721 TSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIR------KSHQEELDRLRQLLKKARVSTDQaaAEQLTL 794
Cdd:COG1196   831 EELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEeledelKELEEEKEELEEELRELESELAE--LKEEIE 908
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  795 AQAELQSQWEAKCEQLLASARDEHLQQYRE-VCAQRDAHQQKLALLQDECLALQA-QIAAFTEQKEHMQRLEKTKSQapa 872
Cdd:COG1196   909 KLRERLEELEAKLERLEVELPELEEELEEEyEDTLETELEREIERLEEEIEALGPvNLRAIEEYEEVEERYEELKSQ--- 985
                         330
                  ....*....|....*...
gi 568926925  873 graAADPSEKVKKIMNQV 890
Cdd:COG1196   986 ---REDLEEAKEKLLEVI 1000
PHA03247 super family cl33720
large tegument protein UL36; Provisional
944-1129 1.10e-04

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.86  E-value: 1.10e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  944 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 1023
Cdd:PHA03247 2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925 1024 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 1101
Cdd:PHA03247 2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                         170       180
                  ....*....|....*....|....*....
gi 568926925 1102 PalDPESQGGEAQPPECKQAEDVSSS-GP 1129
Cdd:PHA03247 3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
PHA03247 super family cl33720
large tegument protein UL36; Provisional
302-495 6.95e-03

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 40.69  E-value: 6.95e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  302 SSRDSAAPSPIPASDSLSADPVVTPLPLPLKPGEPGlrskSNSLSEQLTVNSNPDTVKAKLISRMAKMGQPMLPILPPQ- 380
Cdd:PHA03247 2607 DPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHP----PPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQr 2682
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  381 ----------------LDSNDSETEDATVLRGAGQSLVTPSIQPSLQPAHPVLPqmASQAPQPSGSGLQTPSAALMQAvs 444
Cdd:PHA03247 2683 prrraarptvgsltslADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALP--AAPAPPAVPAGPATPGGPARPA-- 2758
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568926925  445 ldSHSAVSGNAQNFQPYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAPH 495
Cdd:PHA03247 2759 --RPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADP 2807
 
Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
192-285 4.51e-28

FKBP-type peptidyl-prolyl cis-trans isomerase;


Pssm-ID: 395196  Cd Length: 94  Bit Score: 108.83  E-value: 4.51e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   192 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGW 271
Cdd:pfam00254    4 KAKKGDRVTVHYTGRLED----GTVFDSSYDRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGG 79
                           90
                   ....*....|....
gi 568926925   272 TQPTDSILVFEVEV 285
Cdd:pfam00254   80 VIPPNATLVFEVEL 93
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
561-890 9.53e-21

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 99.02  E-value: 9.53e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  561 IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVT 640
Cdd:COG1196   679 LEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEEL--------KRELAALEEELEQLQSRLEELEEELEELE 750
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  641 EELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 720
Cdd:COG1196   751 EELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEI 830
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  721 TSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIR------KSHQEELDRLRQLLKKARVSTDQaaAEQLTL 794
Cdd:COG1196   831 EELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEeledelKELEEEKEELEEELRELESELAE--LKEEIE 908
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  795 AQAELQSQWEAKCEQLLASARDEHLQQYRE-VCAQRDAHQQKLALLQDECLALQA-QIAAFTEQKEHMQRLEKTKSQapa 872
Cdd:COG1196   909 KLRERLEELEAKLERLEVELPELEEELEEEyEDTLETELEREIERLEEEIEALGPvNLRAIEEYEEVEERYEELKSQ--- 985
                         330
                  ....*....|....*...
gi 568926925  873 graAADPSEKVKKIMNQV 890
Cdd:COG1196   986 ---REDLEEAKEKLLEVI 1000
FkpA COG0545
FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein ...
183-289 3.23e-18

FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223619 [Multi-domain]  Cd Length: 205  Bit Score: 84.39  E-value: 3.23e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  183 QDLVAAEGPAVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGsgKVVKGLEDGLLGMKKGGKRLIITPSACA 262
Cdd:COG0545   106 KVLKAGDGAAPKKGDTVTVHYTGTLID----GTVFDSSYDRGQPAEFPLG--GVIPGWDEGLQGMKVGGKRKLTIPPELA 179
                          90       100
                  ....*....|....*....|....*..
gi 568926925  263 AGSEGVIGwTQPTDSILVFEVEVRRVK 289
Cdd:COG0545   180 YGERGVPG-VIPPNSTLVFEVELLDVK 205
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
573-841 9.19e-16

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 82.80  E-value: 9.19e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   573 ERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLM------MEKRNNSLQTATENTQARILHAEQEKAKVTEELAAA 646
Cdd:TIGR02168  235 EELREELEELQEELKEAEEELEELTAELQELEEKLEELrlevseLEEEIEELQKELYALANEISRLEQQKQILRERLANL 314
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   647 TAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEE 726
Cdd:TIGR02168  315 ERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQ 394
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   727 LTDLRAEKTSLEKNLS---ERKKKSAQERCQAEAEMDEIRKS-HQEELDRLRQLLKKArVSTDQAAAEQLTLAQAELqsq 802
Cdd:TIGR02168  395 IASLNNEIERLEARLErleDRRERLQQEIEELLKKLEEAELKeLQAELEELEEELEEL-QEELERLEEALEELREEL--- 470
                          250       260       270
                   ....*....|....*....|....*....|....*....
gi 568926925   803 weAKCEQLLASARDEHLQqyrevcaqrdaHQQKLALLQD 841
Cdd:TIGR02168  471 --EEAEQALDAAERELAQ-----------LQARLDSLER 496
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
570-869 2.75e-11

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 67.02  E-value: 2.75e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   570 QENERLKQELL---------EKSSRIE-------------EQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQA 627
Cdd:pfam15742   13 EEVQQLRQDLHrlqilcssaERELRYEreknldlkqhnslLQEENIKIKAELKQ--AQQKLLDSTKMCSSLTAEWEHCQQ 90
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   628 RILHAEQEKAKVTEELAAATA---QVSHLQLKMTAHQKKETELQLQLTD--NLKETDLLRGHVTRLQADLSELREASEQT 702
Cdd:pfam15742   91 KIRELELEVLKQAQSIKSQNSlqeKLAQEKSKVAEAEKKILELQQKLEHahKVCLTETCILEKKQLEEEIKEAQENEAKL 170
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   703 QTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKShqEELDRLRQLLKkarv 782
Cdd:pfam15742  171 KQQYQEEQQKRKLLDQNVNELQQQVRILQDKEAQLERTNSQQQLRIQQQEAQLKQLENEKRKS--DEHLKSNQELS---- 244
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   783 stdqaaaEQLTLAQAELQSQWEaKCEQLLASArDEHLQQYREVCAQRDAHQQKL-ALLQDECLALQAQIAAFTEQKEHMQ 861
Cdd:pfam15742  245 -------EKLSSLQQEKEALQE-ELQQFLKQL-DVHVRKYNEKHHHHKAKLRRAkDRLLHEVEQRDERIKQLENEIRILQ 315

                   ....*...
gi 568926925   862 RLEKTKSQ 869
Cdd:pfam15742  316 SQIEKEKA 323
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
632-1027 6.79e-10

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 63.39  E-value: 6.79e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  632 AEQEKaKVTEELAAATAQVSHLQLK-MTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-----EASEQTQTK 705
Cdd:NF033930   85 AKKEK-KASEEEQKANLAVQKAYVKyRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRakvvpEAEELAETK 163
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  706 FKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSaqERCQAEAEMDEIrkshQEELDRLRQLLKKARVSTD 785
Cdd:NF033930  164 KKAEEAKAEEPVAKKKVDEAKKKVEEAKKKVEAEEAEIEKLQN--EEVALEAKIAEL----ENQVDNLEKELAEIDESDS 237
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  786 QAAAEQ---------LTLAQAELqSQWEAKCEQLLASARDEHLQQyrevcaQRDAHQQKLALLQDECLALQAQIAAFTEQ 856
Cdd:NF033930  238 EDYIKEglrapleseLDAKQAKL-AKKQTELEKLLDSLDPEGKTQ------DELDKEAAEEELSKKIDELDNEVAKLEKE 310
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  857 KEHMQRLEKtkSQAPAGRAAADPSEKVKKImnqvfqslrgefELEEsydggtilrtimhTIKMVTlQLLNHQEEEEEEEE 936
Cdd:NF033930  311 VSDLENSDN--NVADYYKEALEKDLATKKA------------ELEK-------------TQKDLD-KALNELGPDGDEEE 362
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  937 EEEEEKKPLRPSlEQPGPA----TPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPEngaqtrkgEPAEAEVPS 1012
Cdd:NF033930  363 TPAPAPQPEQPA-PAPAPApkpeQPAPAPKPEKPADQQAEEDYARRSEEEYNRLTQQQPPKAE--------KPAPAPAPK 433
                         410
                  ....*....|....*
gi 568926925 1013 eikdsslPPQPAGIP 1027
Cdd:NF033930  434 -------PEQPAPAP 441
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
563-898 8.73e-10

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 63.16  E-value: 8.73e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  563 SNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTA---TENTQARILHAEQEKAKV 639
Cdd:PRK03918  324 NGIEERIKELEEKEERLEELKKKLKELEKRLEELEERHELYEEAKAKKEELERLKKRLTgltPEKLEKELEELEKAKEEI 403
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  640 TEELAAATAQVSHL------------QLK------------MTAHQKKE-------------------TELQLQLTDNLK 676
Cdd:PRK03918  404 EEEISKITARIGELkkeikelkkaieELKkakgkcpvcgreLTEEHRKElleeytaelkriekelkeiEEKERKLRKELR 483
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  677 ETDLLRGHVTRLQA------------------DLSELREASEQTQT-------------KFKSEKQSRRQLELKVTSLEE 725
Cdd:PRK03918  484 ELEKVLKKESELIKlkelaeqlkeleeklkkyNLEELEKKAEEYEKlkekliklkgeikSLKKELEKLEELKKKLAELEK 563
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  726 ELTDLRAEKTSLEKNLSERKKKSAQErcqAEAEMDEIRKSHQE---------ELDRLRQLLKKARVSTDQAAAEqLTLAQ 796
Cdd:PRK03918  564 KLDELEEELAELLKELEELGFESVEE---LEERLKELEPFYNEylelkdaekELEREEKELKKLEEELDKAFEE-LAETE 639
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  797 AELQSQwEAKCEQLLASARDEhlqQYREVcaqrdahQQKLALLQDECLALQAQIAAFTEQKEHMQR-LEKTKSQAPAGRA 875
Cdd:PRK03918  640 KRLEEL-RKELEELEKKYSEE---EYEEL-------REEYLELSRELAGLRAELEELEKRREEIKKtLEKLKEELEEREK 708
                         410       420
                  ....*....|....*....|...
gi 568926925  876 AADPSEKVKKIMNQVfQSLRGEF 898
Cdd:PRK03918  709 AKKELEKLEKALERV-EELREKV 730
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
547-752 1.48e-05

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 49.24  E-value: 1.48e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  547 MLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDliernqryvEQSNLMMEKRNNSLQTATENTQ 626
Cdd:NF038025   23 DLLENMAKEKDEKQIKKAADEVTAEKDDLLDELENEQEEEPETFTEQKE---------EEDKEDLEAILDELATEANKAS 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  627 ARILHAEQEKAKVTEELAAataqvshlqlkmtahqKKETELQLqltdNLKEtdllrghvtrlqaDLSELREaseqtqtkf 706
Cdd:NF038025   94 AELDEVNAEIQGVKEEIKE----------------KQEQLMVL----DTKE-------------ELDELSE--------- 131
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 568926925  707 ksEKQSRRQ-LELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQER 752
Cdd:NF038025  132 --EELAERQeLEAEIKQLEAQLDELEEEKEELEEELKTIRKDQWSQT 176
PspC_subgroup_1 NF033838
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ...
561-999 3.56e-05

pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.


Pssm-ID: 411407 [Multi-domain]  Cd Length: 684  Bit Score: 48.08  E-value: 3.56e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  561 IMSNIQRIIQEnerlKQELLEKSSRIEEQ--NDKISDLierNQRYVEQSNLMMEKRNNSLQTAT-ENTQARILHAEQEKA 637
Cdd:NF033838   63 VESHLEKILSE----IQKSLDKRKHTQNValNKKLSDI---KTEYLYELNVLKEKSEAELTSKTkKELDAAFEQFKKDTL 135
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  638 KVTEELAAATAQVSHLQLKmtAHQKKETELQLQLTDNLK--ETDLLRGHVTRLQADLSELREASEQTQtkfksEKQSRRQ 715
Cdd:NF033838  136 EPGKKVAEATKKVEEAEKK--AKDQKEEDRRNYPTNTYKtlELEIAESDVEVKKAELELVKEEAKEPR-----DEEKIKQ 208
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  716 LELKVTSLEEELTDLRAEKTSLEKnlSERKKKSAQERCQAEAEMDEIRKSHQEELDRL--RQLL----------KKARvS 783
Cdd:NF033838  209 AKAKVESKKAEATRLEKIKTDREK--AEEEAKRRADAKLKEAVEKNVATSEQDKPKRRakRGVLgepatpdkkeNDAK-S 285
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  784 TDQAAAEQlTLAQAELqsqweaKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAqiaAFTEQKEHMQRL 863
Cdd:NF033838  286 SDSSVGEE-TLPSPSL------KPEKKVAEAEKKVEEAKKKAKDQKEEDRRNYPTNTYKTLELEI---AESDVKVKEAEL 355
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  864 EKTKSQAPAGRAaadpSEKVKKIMNQVfQSLRGEfeleesydgGTILRTIMHTIKMVTLQLLNHQEEEEEEEEEEEEEKK 943
Cdd:NF033838  356 ELVKEEAKEPRN----EEKIKQAKAKV-ESKKAE---------ATRLEKIKTDRKKAEEEAKRKAAEEDKVKEKPAEQPQ 421
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 568926925  944 PL---RPSLEQPGPATPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPENGAQ 999
Cdd:NF033838  422 PApapQPEKPAPKPEKPAEQPKAEKPADQQAEEDYARRSEEEYNRLTQQQPPKTEKPAQ 480
PHA03247 PHA03247
large tegument protein UL36; Provisional
944-1129 1.10e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.86  E-value: 1.10e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  944 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 1023
Cdd:PHA03247 2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925 1024 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 1101
Cdd:PHA03247 2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                         170       180
                  ....*....|....*....|....*....
gi 568926925 1102 PalDPESQGGEAQPPECKQAEDVSSS-GP 1129
Cdd:PHA03247 3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
PRK11570 PRK11570
peptidyl-prolyl cis-trans isomerase; Provisional
185-285 7.34e-04

peptidyl-prolyl cis-trans isomerase; Provisional


Pssm-ID: 183207  Cd Length: 206  Bit Score: 42.09  E-value: 7.34e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  185 LVAAEGPAVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSgkVVKGLEDGLLGMKKGGKRLIITPSACAAG 264
Cdd:PRK11570  109 LTQGEGAIPARTDRVRVHYTGKLID----GTVFDSSVARGEPAEFPVNG--VIPGWIEALTLMPVGSKWELTIPHELAYG 182
                          90       100
                  ....*....|....*....|.
gi 568926925  265 SEGViGWTQPTDSILVFEVEV 285
Cdd:PRK11570  183 ERGA-GASIPPFSTLVFEVEL 202
BREX_BrxC NF033441
BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, ...
685-886 1.23e-03

BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, from BREX (bacteriophage exclusion) systems of type 1.


Pssm-ID: 380283  Cd Length: 1173  Bit Score: 43.34  E-value: 1.23e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  685 VTRLQADLSELREAS--EQTQTKFKSEKQSRRQLELKVTSLEEELT--------DLRAEKTSLEKNLSERKKKSAQErcq 754
Cdd:NF033441  928 LEPALALLEEILSIKdnEEFLKALNKKEDDLLDLIEDWEDVKSFFEgdqlpiwdRALRLLKEYEDNLDYELDEEAEE--- 1004
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  755 AEAEMDEI-------RKSHQ--EELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSqwEAKCEQLLASARDEHLQQYREv 825
Cdd:NF033441 1005 AIEELRSIladpdpySRIPDlpPLLEALREALREALEELREAALEAIEEAKAELEA--DLEWQELSDEQQNRLLAPFDE- 1081
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568926925  826 CAQRDAHQQKLALLQDeclaLQAQIA--AFTEQKEHMQRL--EKTKSQAPAGRAAADPSEKVKKI 886
Cdd:NF033441 1082 LKERIEPEVSIASLRA----LLDQLAdaLLDRLLDRIEALiqRFQEEKAEPEVKEAAAEPPEPKV 1142
PHA03247 PHA03247
large tegument protein UL36; Provisional
302-495 6.95e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 40.69  E-value: 6.95e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  302 SSRDSAAPSPIPASDSLSADPVVTPLPLPLKPGEPGlrskSNSLSEQLTVNSNPDTVKAKLISRMAKMGQPMLPILPPQ- 380
Cdd:PHA03247 2607 DPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHP----PPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQr 2682
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  381 ----------------LDSNDSETEDATVLRGAGQSLVTPSIQPSLQPAHPVLPqmASQAPQPSGSGLQTPSAALMQAvs 444
Cdd:PHA03247 2683 prrraarptvgsltslADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALP--AAPAPPAVPAGPATPGGPARPA-- 2758
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568926925  445 ldSHSAVSGNAQNFQPYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAPH 495
Cdd:PHA03247 2759 --RPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADP 2807
F-BAR_PSTPIP cd07647
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine ...
634-808 9.34e-03

The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins; F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Vetebrates contain two Proline-Serine-Threonine Phosphatase-Interacting Proteins (PSTPIPs), PSTPIP1 and PSTPIP2. PSTPIPs are mainly expressed in hematopoietic cells and are involved in the regulation of cell adhesion and motility. Mutations in PSTPIPs have been shown to cause autoinflammatory disorders. PSTPIP1 contains an N-terminal F-BAR domain, PEST motifs, and a C-terminal SH3 domain, while PSTPIP2 contains only the N-terminal F-BAR domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.


Pssm-ID: 153331 [Multi-domain]  Cd Length: 239  Bit Score: 39.38  E-value: 9.34e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  634 QEKAKVTEELAAATAQVShlqlKMTAHQKKETELQLQLTDNLKETD-LLRGHVTRLQAdlseLREASEQTQTKFKSEKQS 712
Cdd:cd07647    29 KQRAKAEEDYGKALLKLS----KSAGPGDEIGTLKSSWDSLRKETEnVANAHIQLAQS----LREEAEKLEEFREKQKEE 100
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  713 RRQLELKVTSLEEeltdlraEKTSLEKNLSErKKKSAQERCQA--EAEMDEIRKS---HQEELDRLRQLLKKARVSTDQA 787
Cdd:cd07647   101 RKKTEDIMKRSQK-------NKKELYKKTMK-AKKSYEQKCREkdKAEQAYEKSSsgaQPKEAEKLKKKAAQCKTSAEEA 172
                         170       180
                  ....*....|....*....|....*..
gi 568926925  788 ------AAEQLTLAQAELQSQWEAKCE 808
Cdd:cd07647   173 dsayksSIGCLEDARVEWESEHATACQ 199
 
Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
192-285 4.51e-28

FKBP-type peptidyl-prolyl cis-trans isomerase;


Pssm-ID: 395196  Cd Length: 94  Bit Score: 108.83  E-value: 4.51e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   192 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGW 271
Cdd:pfam00254    4 KAKKGDRVTVHYTGRLED----GTVFDSSYDRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGG 79
                           90
                   ....*....|....
gi 568926925   272 TQPTDSILVFEVEV 285
Cdd:pfam00254   80 VIPPNATLVFEVEL 93
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
561-890 9.53e-21

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 99.02  E-value: 9.53e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  561 IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVT 640
Cdd:COG1196   679 LEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEEL--------KRELAALEEELEQLQSRLEELEEELEELE 750
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  641 EELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 720
Cdd:COG1196   751 EELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEI 830
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  721 TSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIR------KSHQEELDRLRQLLKKARVSTDQaaAEQLTL 794
Cdd:COG1196   831 EELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEeledelKELEEEKEELEEELRELESELAE--LKEEIE 908
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  795 AQAELQSQWEAKCEQLLASARDEHLQQYRE-VCAQRDAHQQKLALLQDECLALQA-QIAAFTEQKEHMQRLEKTKSQapa 872
Cdd:COG1196   909 KLRERLEELEAKLERLEVELPELEEELEEEyEDTLETELEREIERLEEEIEALGPvNLRAIEEYEEVEERYEELKSQ--- 985
                         330
                  ....*....|....*...
gi 568926925  873 graAADPSEKVKKIMNQV 890
Cdd:COG1196   986 ---REDLEEAKEKLLEVI 1000
FkpA COG0545
FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein ...
183-289 3.23e-18

FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223619 [Multi-domain]  Cd Length: 205  Bit Score: 84.39  E-value: 3.23e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  183 QDLVAAEGPAVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGsgKVVKGLEDGLLGMKKGGKRLIITPSACA 262
Cdd:COG0545   106 KVLKAGDGAAPKKGDTVTVHYTGTLID----GTVFDSSYDRGQPAEFPLG--GVIPGWDEGLQGMKVGGKRKLTIPPELA 179
                          90       100
                  ....*....|....*....|....*..
gi 568926925  263 AGSEGVIGwTQPTDSILVFEVEVRRVK 289
Cdd:COG0545   180 YGERGVPG-VIPPNSTLVFEVELLDVK 205
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
573-869 2.16e-17

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 88.23  E-value: 2.16e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  573 ERLKQELLEKSSRIEEQNDKISDLI--------------ERNQRYVEQSNlmmEKRnnSLQTATenTQARILHAEQEKAK 638
Cdd:COG1196   171 KERKEEAERKLERTEENLERLEDLLeelekqleklerqaEKAERYQELKA---ELR--ELELAL--LLAKLKELRKELEE 243
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  639 VTEELAAATAQVSHLQLKMtahQKKETELQlQLTDNLKEtdlLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLEL 718
Cdd:COG1196   244 LEEELSRLEEELEELQEEL---EEAEKEIE-ELKSELEE---LREELEELQEELLELKEEIEELEGEISLLRERLEELEN 316
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  719 KVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLL--KKARVSTDQAAAE-QLTLA 795
Cdd:COG1196   317 ELEELEERLEELKEKIEALKEELEERETLLEELE-QLLAELEEAKEELEEKLSALLEELeeLFEALREELAELEaELAEI 395
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568926925  796 QAELQSQweAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQ-RLEKTKSQ 869
Cdd:COG1196   396 RNELEEL--KREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRdRLKELERE 468
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
573-841 9.19e-16

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 82.80  E-value: 9.19e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   573 ERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLM------MEKRNNSLQTATENTQARILHAEQEKAKVTEELAAA 646
Cdd:TIGR02168  235 EELREELEELQEELKEAEEELEELTAELQELEEKLEELrlevseLEEEIEELQKELYALANEISRLEQQKQILRERLANL 314
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   647 TAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEE 726
Cdd:TIGR02168  315 ERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQ 394
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   727 LTDLRAEKTSLEKNLS---ERKKKSAQERCQAEAEMDEIRKS-HQEELDRLRQLLKKArVSTDQAAAEQLTLAQAELqsq 802
Cdd:TIGR02168  395 IASLNNEIERLEARLErleDRRERLQQEIEELLKKLEEAELKeLQAELEELEEELEEL-QEELERLEEALEELREEL--- 470
                          250       260       270
                   ....*....|....*....|....*....|....*....
gi 568926925   803 weAKCEQLLASARDEHLQqyrevcaqrdaHQQKLALLQD 841
Cdd:TIGR02168  471 --EEAEQALDAAERELAQ-----------LQARLDSLER 496
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
531-857 1.13e-15

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 82.42  E-value: 1.13e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   531 LMTKVEELQKHSSgnsMLLPSMSV-TMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNL 609
Cdd:TIGR02169  693 LQSELRRIENRLD---ELSQELSDaSRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQEIENVKSELKELEARIEE 769
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   610 MMEKRNNsLQTATENTQARILHA-----EQEKAKVTEELAAATAQVSHLQLKMtahqkKETELQLQLTDNLKETdlLRGH 684
Cdd:TIGR02169  770 LEEDLHK-LEEALNDLEARLSHSripeiQAELSKLEEEVSRIEARLREIEQKL-----NRLTLEKEYLEKEIQE--LQEQ 841
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   685 VTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKsaqeRCQAEAEMDEIRK 764
Cdd:TIGR02169  842 RIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERK----IEELEAQIEKKRK 917
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   765 sHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQ-SQWEAKCEQLLASARD------EHLQQYREVCAQRDAHQQKLA 837
Cdd:TIGR02169  918 -RLSELKAKLEALEEELSEIEDPKGEDEEIPEEELSlEDVQAELQRVEEEIRAlepvnmLAIQEYEEVLKRLDELKEKRA 996
                          330       340
                   ....*....|....*....|
gi 568926925   838 LLQDECLALQAQIAAFTEQK 857
Cdd:TIGR02169  997 KLEEERKAILERIEEYEKKK 1016
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
562-905 1.49e-15

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 82.07  E-value: 1.49e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  562 MSNIQRIiQENERLKQELLEkssRIEEQNDKISDLIERNQRYVEQSN-------LMMEKRNNSLQTATENTQARILHAEQ 634
Cdd:COG1196   178 ERKLERT-EENLERLEDLLE---ELEKQLEKLERQAEKAERYQELKAelrelelALLLAKLKELRKELEELEEELSRLEE 253
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  635 EKAKVTEELAAATAQVSHLQLKMTAHQKKETELQ---LQLTDNLKETD----LLRGHVTRLQADLSELREASEQTQTKFK 707
Cdd:COG1196   254 ELEELQEELEEAEKEIEELKSELEELREELEELQeelLELKEEIEELEgeisLLRERLEELENELEELEERLEELKEKIE 333
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  708 SEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRK----------SHQEELDRLRQLL 777
Cdd:COG1196   334 ALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFEALREELAELEAelaeirneleELKREIESLEERL 413
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  778 KKARVSTDQAAAEQLTLAQ--AELQSQWEAKCEQLlasarDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIaafte 855
Cdd:COG1196   414 ERLSERLEDLKEELKELEAelEELQTELEELNEEL-----EELEEQLEELRDRLKELERELAELQEELQRLEKEL----- 483
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|
gi 568926925  856 qKEHMQRLEKTKSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFELEESYD 905
Cdd:COG1196   484 -SSLEARLDRLEAEQRASQGVRAVLEALESGLPGVYGPVAELIKVKEKYE 532
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
559-869 2.01e-14

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 78.26  E-value: 2.01e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  559 SMIMSNIQRIIQENERLKQELLEKSSRIEEQndkISDLIERNQRYVEQSNLMME----KRNNSLQTATENTQARILHAEQ 634
Cdd:COG0419   170 EKLSELLKEVIKEAKAKIEELEGQLSELLED---IEDLLEALEEELKELKKLEEiqeeQEEEELEQEIEALEERLAELEE 246
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  635 EKaKVTEELAAATAQVSHLQLKMTAHQKKE----TELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQ---TKFK 707
Cdd:COG0419   247 EK-ERLEELKARLLEIESLELEALKIREEElrelERLLEELEEKIERLEELEREIEELEEELEGLRALLEELEellEKLK 325
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  708 SEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMD---EIRKSHQEELDRLRQLL--KKARV 782
Cdd:COG0419   326 SLEERLEKLEEKLEKLESELEELAEEKNELAKLLEERLKELEERLEELEKELEkalERLKQLEEAIQELKEELaeLSAAL 405
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  783 STDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRE--------------VCAQ--RDAHQQKLALLQDECL-A 845
Cdd:COG0419   406 EEIQEELEELEKELEELERELEELEEEIKKLEEQINQLESKElmiaelagagekcpVCGQelPEEHEKELLELYELELeE 485
                         330       340
                  ....*....|....*....|....
gi 568926925  846 LQAQIAAFTEQKEHMQRLEKTKSQ 869
Cdd:COG0419   486 LEEELSREKEEAELREEIEELEKE 509
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
621-902 1.47e-13

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 75.86  E-value: 1.47e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   621 ATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASE 700
Cdd:TIGR02168  664 GSAKTNSSILERRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVE 743
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   701 QTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKK--SAQERCQA-EAEMDEIRKSHQEELDRLRQLL 777
Cdd:TIGR02168  744 QLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQieQLKEELKAlREALDELRAELTLLNEEAANLR 823
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   778 KKARVSTDQAAAEQLTLaqAELQSQWEAKCEQL---------LASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQA 848
Cdd:TIGR02168  824 ERLESLERRIAATERRL--EDLEEQIEELSEDIeslaaeieeLEELIEELESELEALLNERASLEEALALLRSELEELSE 901
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 568926925   849 QIAaftEQKEHMQRLEKTKSQAPAGRAAADPS-EKVKKIMNQVFQSLRGEFELEE 902
Cdd:TIGR02168  902 ELR---ELESKRSELRRELEELREKLAQLELRlEGLEVRIDNLQERLSEEYSLTL 953
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
560-889 1.10e-12

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 72.87  E-value: 1.10e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  560 MIMSNIQRIIQENERLKQeLLEKSSRIEEQNDKISDLIE-----RNQRYVEQSNLMMEKRNN--SLQTATENTQARILHA 632
Cdd:COG0419   309 GLRALLEELEELLEKLKS-LEERLEKLEEKLEKLESELEelaeeKNELAKLLEERLKELEERleELEKELEKALERLKQL 387
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  633 EQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQ---LQLTDNLKETDLLRGHVTRLQADLSELREASEQ-----TQT 704
Cdd:COG0419   388 EEAIQELKEELAELSAALEEIQEELEELEKELEELErelEELEEEIKKLEEQINQLESKELMIAELAGAGEKcpvcgQEL 467
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  705 KFKSEKQSRRQLELKVTSLEEELTdLRAEKTSLEKNLSERKKK---SAQERCQAEAEMDEIRKSHQEELDRLRQLLKKAR 781
Cdd:COG0419   468 PEEHEKELLELYELELEELEEELS-REKEEAELREEIEELEKElreLEEELIELLELEEALKEELEEKLEKLENLLEELE 546
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  782 VSTDQAAAEQLtlaQAELQSqweakCEQLLASARDEhLQQYREVCAQrdahQQKLALLQDECLALQAQIAAFTEQKEHMQ 861
Cdd:COG0419   547 ELKEKLQLQQL---KEELRQ-----LEDRLQELKEL-LEELRLLRTR----KEELEELRERLKELKKKLKELEERLSQLE 613
                         330       340
                  ....*....|....*....|....*...
gi 568926925  862 RLEKTKSQAPAGRAAADPSEKVKKIMNQ 889
Cdd:COG0419   614 ELLQSLELSEAENELEEAEEELESELEK 641
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
626-870 2.52e-12

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 71.67  E-value: 2.52e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  626 QARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTK 705
Cdd:COG1196   659 KRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSR 738
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  706 FKSEKQSRRQLELKVTSL-------EEELTDLRAEKTSLEknlsERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLK 778
Cdd:COG1196   739 LEELEEELEELEEELEELqerleelEEELESLEEALAKLK----EEIEELEEKRQALQEELEELEEELEEAERRLDALER 814
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  779 KARVSTDQAAAEQLTLAQAELQ-SQWEAKCEQL------LASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIa 851
Cdd:COG1196   815 ELESLEQRRERLEQEIEELEEEiEELEEKLDELeeeleeLEKELEELKEELEELEAEKEELEDELKELEEEKEELEEEL- 893
                         250
                  ....*....|....*....
gi 568926925  852 afTEQKEHMQRLEKTKSQA 870
Cdd:COG1196   894 --RELESELAELKEEIEKL 910
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
507-778 2.67e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 71.63  E-value: 2.67e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   507 MTEARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSvtMETSMIMSNIQRIIQENERLKQELLEKSSRI 586
Cdd:TIGR02168  686 IEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALR--KDLARLEAEVEQLEERIAQLSKELTELEAEI 763
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   587 EEQNDKISDL----------IERNQRYVEQSNLMMEK------------------------RNNSLQTATENTQARILHA 632
Cdd:TIGR02168  764 EELEERLEEAeeelaeaeaeIEELEAQIEQLKEELKAlrealdelraeltllneeaanlreRLESLERRIAATERRLEDL 843
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   633 EQEKAKVTEELAAATAQVSHLQLKMTahqkketELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQS 712
Cdd:TIGR02168  844 EEQIEELSEDIESLAAEIEELEELIE-------ELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRE 916
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568926925   713 RRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLK 778
Cdd:TIGR02168  917 LEELREKLAQLELRLEGLEVRIDNLQERLSEEYSLTLEEAEALENKIEDDEEEARRRLKRLENKIK 982
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
627-905 3.01e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 71.24  E-value: 3.01e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   627 ARILHAE-QEKAKVTEELAAataqVSHLQLKmtahqKKETELQL--------QLTDNLKEtdlLRGHVTRLQA------- 690
Cdd:TIGR02168  147 SEIIEAKpEERRAIFEEAAG----ISKYKER-----RKETERKLertrenldRLEDILNE---LERQLKSLERqaekaer 214
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   691 ------------------DLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKK----- 747
Cdd:TIGR02168  215 ykelkaelrelelallvlRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKElyala 294
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   748 SAQERCQAEAEMDEIRKSH----QEELDRLRQLLKKARVsTDQAAAEQLTLAQAELQSQWEAKCEQL--LASARDEHLQQ 821
Cdd:TIGR02168  295 NEISRLEQQKQILRERLANlerqLEELEAQLEELESKLD-ELAEELAELEEKLEELKEELESLEAELeeLEAELEELESR 373
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   822 YREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQ-RLEKTKSQAPAGRAAADPSEKvKKIMNQVFQSLRGEFEL 900
Cdd:TIGR02168  374 LEELEEQLETLRSKVAQLELQIASLNNEIERLEARLERLEdRRERLQQEIEELLKKLEEAEL-KELQAELEELEEELEEL 452

                   ....*
gi 568926925   901 EESYD 905
Cdd:TIGR02168  453 QEELE 457
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
570-869 2.75e-11

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 67.02  E-value: 2.75e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   570 QENERLKQELL---------EKSSRIE-------------EQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQA 627
Cdd:pfam15742   13 EEVQQLRQDLHrlqilcssaERELRYEreknldlkqhnslLQEENIKIKAELKQ--AQQKLLDSTKMCSSLTAEWEHCQQ 90
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   628 RILHAEQEKAKVTEELAAATA---QVSHLQLKMTAHQKKETELQLQLTD--NLKETDLLRGHVTRLQADLSELREASEQT 702
Cdd:pfam15742   91 KIRELELEVLKQAQSIKSQNSlqeKLAQEKSKVAEAEKKILELQQKLEHahKVCLTETCILEKKQLEEEIKEAQENEAKL 170
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   703 QTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKShqEELDRLRQLLKkarv 782
Cdd:pfam15742  171 KQQYQEEQQKRKLLDQNVNELQQQVRILQDKEAQLERTNSQQQLRIQQQEAQLKQLENEKRKS--DEHLKSNQELS---- 244
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   783 stdqaaaEQLTLAQAELQSQWEaKCEQLLASArDEHLQQYREVCAQRDAHQQKL-ALLQDECLALQAQIAAFTEQKEHMQ 861
Cdd:pfam15742  245 -------EKLSSLQQEKEALQE-ELQQFLKQL-DVHVRKYNEKHHHHKAKLRRAkDRLLHEVEQRDERIKQLENEIRILQ 315

                   ....*...
gi 568926925   862 RLEKTKSQ 869
Cdd:pfam15742  316 SQIEKEKA 323
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
566-798 8.59e-11

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 66.63  E-value: 8.59e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   566 QRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQtateNTQARILHAEQEKAKVTEELAA 645
Cdd:TIGR02169  272 QLLEELNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKERELEDAEERLA----KLEAEIDKLLAEIEELEREIEE 347
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   646 ATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEE 725
Cdd:TIGR02169  348 ERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELDRLQEELQRLSEELADLNA 427
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568926925   726 ELTDLRAEKTSLE---KNLSERKKKSAQERCQAEAEMDEIRKSH---QEELDRLRQLLKKARVSTDQAAAEQLTLAQAE 798
Cdd:TIGR02169  428 AIAGIEAKINELEeekEDKALEIKKQEWKLEQLAADLSKYEQELydlKEEYDRVEKELSKLQRELAEAEAQARASEERV 506
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
515-739 3.15e-10

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 64.69  E-value: 3.15e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   515 TEIRMAVNKVADKMDHLMTKVEELQKhssgnsmllpsmsvtmETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKIS 594
Cdd:TIGR02168  270 EELRLEVSELEEEIEELQKELYALAN----------------EISRLEQQKQILRERLANLERQLEELEAQLEELESKLD 333
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   595 DLIERNQRYVEQSNL--------------------MMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQ 654
Cdd:TIGR02168  334 ELAEELAELEEKLEElkeelesleaeleeleaeleELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEARLERLE 413
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   655 lkmtAHQKKETELQLQLTDNLKETDL--LRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRA 732
Cdd:TIGR02168  414 ----DRRERLQQEIEELLKKLEEAELkeLQAELEELEEELEELQEELERLEEALEELREELEEAEQALDAAERELAQLQA 489

                   ....*..
gi 568926925   733 EKTSLEK 739
Cdd:TIGR02168  490 RLDSLER 496
Cast pfam10174
RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part ...
508-890 5.21e-10

RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion. The C-terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). The family also contains four coiled-coil domains.


Pssm-ID: 401982 [Multi-domain]  Cd Length: 765  Bit Score: 63.69  E-value: 5.21e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   508 TEARQhnTEIRMAVNKVAdKMDHLMTKVEELQKHSSGNSML--------LPSMSVTMETSMIMSN-IQRIIQENERLKQE 578
Cdd:pfam10174  227 TKALQ--TVIEMKDTKIS-SLERNIRDLEDEVQMLKTNGLLhtedreeeIKQMEVYKSHSKFMKNkIDQLKQELSKKESE 303
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   579 LLEKSSRIEEQNDKISDlierNQRYVE---QSNLMMEKRNNSLQTATENTQARILHAEQ---EKAK----VTEELAAATA 648
Cdd:pfam10174  304 LLALQTKLETLTNQNSD----CKQHIEvlkESLTAKEQRAAILQTEVDALRLRLEEKESflnKKTKqlqdLTEEKSTLAG 379
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   649 QVSHLQ-------LKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADlselreaSEQTQTkfksekqsrrqlelKVT 721
Cdd:pfam10174  380 EIRDLKdmldvkeRKINVLQKKIENLQEQLRDKDKQLAGLKERVKSLQTD-------SSNTDT--------------ALT 438
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   722 SLEEELtdlrAEKTSLEKNLSERKKKSAQERcqaeaemdeirkshQEELDRLRQLLKKARvstdqaaaEQLTLAQAELQS 801
Cdd:pfam10174  439 TLEEAL----SEKERIIERLKEQREREDRER--------------LEELESLKKENKDLK--------EKVSALQPELTE 492
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   802 QweakcEQLLASARdEHLQQYREVCAQRDAH--QQKLALLQ--DECLALQAQiaafteqkehmqrLEKTKSQAPAGRAAA 877
Cdd:pfam10174  493 K-----ESSLIDLK-EHASSLASSGLKKDSKlkSLEIAIEQkkEECSKLENQ-------------LKKAHNAEEAVRTNP 553
                          410
                   ....*....|...
gi 568926925   878 DPSEKVKKIMNQV 890
Cdd:pfam10174  554 EINDRIRLLEQEV 566
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
632-1027 6.79e-10

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 63.39  E-value: 6.79e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  632 AEQEKaKVTEELAAATAQVSHLQLK-MTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-----EASEQTQTK 705
Cdd:NF033930   85 AKKEK-KASEEEQKANLAVQKAYVKyRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRakvvpEAEELAETK 163
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  706 FKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSaqERCQAEAEMDEIrkshQEELDRLRQLLKKARVSTD 785
Cdd:NF033930  164 KKAEEAKAEEPVAKKKVDEAKKKVEEAKKKVEAEEAEIEKLQN--EEVALEAKIAEL----ENQVDNLEKELAEIDESDS 237
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  786 QAAAEQ---------LTLAQAELqSQWEAKCEQLLASARDEHLQQyrevcaQRDAHQQKLALLQDECLALQAQIAAFTEQ 856
Cdd:NF033930  238 EDYIKEglrapleseLDAKQAKL-AKKQTELEKLLDSLDPEGKTQ------DELDKEAAEEELSKKIDELDNEVAKLEKE 310
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  857 KEHMQRLEKtkSQAPAGRAAADPSEKVKKImnqvfqslrgefELEEsydggtilrtimhTIKMVTlQLLNHQEEEEEEEE 936
Cdd:NF033930  311 VSDLENSDN--NVADYYKEALEKDLATKKA------------ELEK-------------TQKDLD-KALNELGPDGDEEE 362
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  937 EEEEEKKPLRPSlEQPGPA----TPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPEngaqtrkgEPAEAEVPS 1012
Cdd:NF033930  363 TPAPAPQPEQPA-PAPAPApkpeQPAPAPKPEKPADQQAEEDYARRSEEEYNRLTQQQPPKAE--------KPAPAPAPK 433
                         410
                  ....*....|....*
gi 568926925 1013 eikdsslPPQPAGIP 1027
Cdd:NF033930  434 -------PEQPAPAP 441
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
563-898 8.73e-10

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 63.16  E-value: 8.73e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  563 SNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTA---TENTQARILHAEQEKAKV 639
Cdd:PRK03918  324 NGIEERIKELEEKEERLEELKKKLKELEKRLEELEERHELYEEAKAKKEELERLKKRLTgltPEKLEKELEELEKAKEEI 403
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  640 TEELAAATAQVSHL------------QLK------------MTAHQKKE-------------------TELQLQLTDNLK 676
Cdd:PRK03918  404 EEEISKITARIGELkkeikelkkaieELKkakgkcpvcgreLTEEHRKElleeytaelkriekelkeiEEKERKLRKELR 483
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  677 ETDLLRGHVTRLQA------------------DLSELREASEQTQT-------------KFKSEKQSRRQLELKVTSLEE 725
Cdd:PRK03918  484 ELEKVLKKESELIKlkelaeqlkeleeklkkyNLEELEKKAEEYEKlkekliklkgeikSLKKELEKLEELKKKLAELEK 563
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  726 ELTDLRAEKTSLEKNLSERKKKSAQErcqAEAEMDEIRKSHQE---------ELDRLRQLLKKARVSTDQAAAEqLTLAQ 796
Cdd:PRK03918  564 KLDELEEELAELLKELEELGFESVEE---LEERLKELEPFYNEylelkdaekELEREEKELKKLEEELDKAFEE-LAETE 639
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  797 AELQSQwEAKCEQLLASARDEhlqQYREVcaqrdahQQKLALLQDECLALQAQIAAFTEQKEHMQR-LEKTKSQAPAGRA 875
Cdd:PRK03918  640 KRLEEL-RKELEELEKKYSEE---EYEEL-------REEYLELSRELAGLRAELEELEKRREEIKKtLEKLKEELEEREK 708
                         410       420
                  ....*....|....*....|...
gi 568926925  876 AADPSEKVKKIMNQVfQSLRGEF 898
Cdd:PRK03918  709 AKKELEKLEKALERV-EELREKV 730
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
563-808 1.50e-09

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 62.39  E-value: 1.50e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  563 SNIQRIIQENErlkQELLEKSSRIEEQNDKISDLIERnqryVEqsnlMMEKRNNSLqtatENTQARILHAEQEKAKVTEE 642
Cdd:PRK03918  189 ENIEELIKEKE---KELEEVLREINEISSELPELREE----LE----KLEKEVKEL----EELKEEIEELEKELESLEGS 253
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  643 LAAATAQVSHLQlKMTAHQKKETElqlQLTDNLKETDLLRGHVTRLQAdLSELREaseqtqtKFKSEKqsrRQLELKVTS 722
Cdd:PRK03918  254 KRKLEEKIRELE-ERIEELKKEIE---ELEEKVKELKELKEKAEEYIK-LSEFYE-------EYLDEL---REIEKRLSR 318
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  723 LEEELTDLRAEKTSLEKnLSERKKKSAQERCQAEAEMDEIRKSHqEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQ 802
Cdd:PRK03918  319 LEEEINGIEERIKELEE-KEERLEELKKKLKELEKRLEELEERH-ELYEEAKAKKEELERLKKRLTGLTPEKLEKELEEL 396

                  ....*.
gi 568926925  803 WEAKCE 808
Cdd:PRK03918  397 EKAKEE 402
DUF5401 pfam17380
Family of unknown function (DUF5401); This is a family of unknown function found in ...
566-829 1.58e-09

Family of unknown function (DUF5401); This is a family of unknown function found in Chromadorea.


Pssm-ID: 375164 [Multi-domain]  Cd Length: 722  Bit Score: 62.06  E-value: 1.58e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   566 QRIIQENERLKQELlEKSSRIEEQNDKISDLIERNQR-YVEQSNLMMEkRNNSLQTATENTQARilhaEQEKAKvTEELA 644
Cdd:pfam17380  299 ERLRQEKEEKAREV-ERRRKLEEAEKARQAEMDRQAAiYAEQERMAME-RERELERIRQEERKR----ELERIR-QEEIA 371
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   645 AATAQVSHLQ-LKMTAHQKK----------------ETELQLQLTDNLKETDLLRGHVTRL-QADLSELREASEQTQTKF 706
Cdd:pfam17380  372 MEISRMRELErLQMERQQKNervrqeleaarkvkilEEERQRKIQQQKVEMEQIRAEQEEArQREVRRLEEERAREMERV 451
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   707 KSEKQSRRQlelKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLKKARVSTDQ 786
Cdd:pfam17380  452 RLEEQERQQ---QVERLRQQEEERKRKKLELEKEKRDRKRAEEQRRKILEKELEERKQAMIEE-ERKRKLLEKEMEERQK 527
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|...
gi 568926925   787 AAAEQLTLAQAELQSQWEAKCEQllasaRDEHLQQYREVCAQR 829
Cdd:pfam17380  528 AIYEEERRREAEEERRKQQEMEE-----RRRIQEQMRKATEER 565
PTZ00121 PTZ00121
MAEBL; Provisional
571-884 3.25e-09

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 61.70  E-value: 3.25e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  571 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKvTEELAAATAQV 650
Cdd:PTZ00121 1312 EEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKK-ADAAKKKAEEK 1390
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  651 shlqlKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEqtqTKFKSEkQSRRQLELKVTSlEEELTDL 730
Cdd:PTZ00121 1391 -----KKADEAKKKAEEDKKKADELKKAAAAKKKADEAKKKAEEKKKADE---AKKKAE-EAKKADEAKKKA-EEAKKAE 1460
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  731 RAEKTSLEKNLSERKKKSAQERCQAE--AEMDEIRKSHQEELDRLRQLLKKA---RVSTDQAAAEQLTLAQAELQSQWEA 805
Cdd:PTZ00121 1461 EAKKKAEEAKKADEAKKKAEEAKKADeaKKKAEEAKKKADEAKKAAEAKKKAdeaKKAEEAKKADEAKKAEEAKKADEAK 1540
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  806 KCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK--EHMQRLEKTKSQAPAGRAAADPSEKV 883
Cdd:PTZ00121 1541 KAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEAriEEVMKLYEEEKKMKAEEAKKAEEAKI 1620

                  .
gi 568926925  884 K 884
Cdd:PTZ00121 1621 K 1621
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
567-905 3.33e-09

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 61.34  E-value: 3.33e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   567 RIIQENERLKQELLEKSSRIEEQNDK--------------ISDLIERNQRYvEQSNLMMEK-------RNNSLQTATENT 625
Cdd:pfam01576  149 KLSKERKLLEERISEFTSNLAEEEEKvkslnklknkheamISDLEDRLKKE-EKGRQELEKakrkldgESTDLQEQIAEL 227
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   626 QARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTD---NLKETDLLRGHVTRLQADLSE----LREA 698
Cdd:pfam01576  228 QAQIEELRAQLAKKEEELQAALARLEEEGAQKNNALKKLRELQAQIAElqeDLESERAARAKAEKQRRDLGEeleaLKTE 307
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   699 SEQTQ--TKFKSEKQSRRQLELK---------------------------VTSLEEELTDLRAEKTSLEKN--------- 740
Cdd:pfam01576  308 LEDTLdsTAAQQELRSKREQEVTelkkaleeetrsheaqlqemrqkhtqaLEELSEQLEQAKRNKANLEKAkqalesenn 387
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   741 --------LSERKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLkkarvstdqaaAEQLTLAQAELQS------QWEAK 806
Cdd:pfam01576  388 elqaelktLQQAKQDSEHKRKKLEGQLQELQARLSES-ERQRAEL-----------AEKLSKLQSELESvsgllsEAEGK 455
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   807 CEQLL--ASARDEHLQQYREVCAQRDahQQKLAL------LQDECLALQAQIAAFTEQKEHMQR--------LEKTKSQA 870
Cdd:pfam01576  456 SIKLSkdVSSLESQLQDTQELLQEET--RQKLNLssrlrqLEDERNSLQEQLEEEEEAKRNVERqlstlqaqLSEMKKKL 533
                          410       420       430
                   ....*....|....*....|....*....|....*.
gi 568926925   871 PAGRAAADPSEKVKKIMNQVFQSLRGEF-ELEESYD 905
Cdd:pfam01576  534 EEDAGAVEALEEAKKRLQRELEALTQRLeEKAAAYD 569
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
518-869 7.13e-09

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 60.37  E-value: 7.13e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   518 RMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMETSM--IMSNIQRIIQENERLKQELLEKSSRIEEQNDKisd 595
Cdd:TIGR00618  179 TQLALMEFAKKKSLHGKAELLTLRSQLLTLCTPCMPDTYHERKqvLEKELKHLREALQQTQQSHAYLTQKREAQEEQ--- 255
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   596 liERNQRYVEQSNLMMEKRNNsLQTATENTQARIlhaeqEKAKVTEELAAATAQVSHLQLKMtahQKKETELQLQLTDNL 675
Cdd:TIGR00618  256 --LKKQQLLKQLRARIEELRA-QEAVLEETQERI-----NRARKAAPLAAHIKAVTQIEQQA---QRIHTELQSKMRSRA 324
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   676 KEtdllRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQlelkvtslEEELTDLRAEKtSLEKNLSERKKKSAQERCQA 755
Cdd:TIGR00618  325 KL----LMKRAAHVKQQSSIEEQRRLLQTLHSQEIHIRDA--------HEVATSIREIS-CQQHTLTQHIHTLQQQKTTL 391
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   756 EaemdEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRevcaQRDAHQQK 835
Cdd:TIGR00618  392 T----QKLQSLCKELDILQREQATIDTRTSAFRDLQGQLAHAKKQQELQQRYAELCAAAITCTAQCEK----LEKIHLQE 463
                          330       340       350
                   ....*....|....*....|....*....|....*....
gi 568926925   836 LALLQDECLALQAQIAAFTEQ-----KEHMQRLEKTKSQ 869
Cdd:TIGR00618  464 SAQSLKEREQQLQTKEQIHLQetrkkAVVLARLLELQEE 502
MukB COG3096
Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 ...
536-838 1.25e-08

Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 substr. MG1655 [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 225638 [Multi-domain]  Cd Length: 1480  Bit Score: 59.51  E-value: 1.25e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  536 EELQKHSSGNSMLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIER---NQRYVEQSNLMME 612
Cdd:COG3096   314 RELAELNGAEGDLEADYQAASDHLNLVQTALRQQEKIERYQADLEELTIRLEEQNEVVEEANERqeeNEARAEAAELEVD 393
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  613 KRNNSL---QTATENTQARILHAEQ-----EKAKV---TEELAAATAQVSHLQLKmtAHQKKETELQLQLTDNLKETDL- 680
Cdd:COG3096   394 ELKSQLadyQQALDVQQTRAIQYQQaiaalERAKElchLPDLTADSAEEWLETFQ--AKEEEATEKLLSLEQKMSMAQAa 471
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  681 -------------LRGHVTRLQADLSE---LREASEQtqtkfKSEKQSRRQLELKVTSLEEELTDLRaEKTSLEKNLSER 744
Cdd:COG3096   472 hsqfeqayqlvvaIAGELARSEAWDVArelLREGPDQ-----RHLAEQVQPLRMRLSELEQRLRQQQ-SAERLLADFCKR 545
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  745 KKKSAQ------ERCQAEAEMDEIRKSHQEELDR---LRQLLK--KARVSTDQAAAEQLTLAQAELqSQWEAKCEQLLAS 813
Cdd:COG3096   546 QGKNLDaeeleaLHQELEALIESLSDSVSNAREQrmaLRQEQEqlQSRIQSLMQRAPVWLAAQNAL-EQLSEQSGEEFTD 624
                         330       340       350
                  ....*....|....*....|....*....|..
gi 568926925  814 ARD--EHLQQY----REVCAQRDA-HQQKLAL 838
Cdd:COG3096   625 SQDvtEYMQQLlereREATVERDElGARKNAL 656
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
564-780 1.46e-08

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 59.39  E-value: 1.46e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  564 NIQRIIQENERLKQELLE-KSSRIEEQNDKISDLIERNQRYVEQSNLMmEKRNNSLQTATEntqaRILHAEQEKAKVTEE 642
Cdd:COG0419   534 KLEKLENLLEELEELKEKlQLQQLKEELRQLEDRLQELKELLEELRLL-RTRKEELEELRE----RLKELKKKLKELEER 608
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  643 LAAATAQVSHLQLkMTAHQKKETELQlQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQsRRQLELKVTS 722
Cdd:COG0419   609 LSQLEELLQSLEL-SEAENELEEAEE-ELESELEKLNLQAELEELLQAALEELEEKVEELEAEIRRELQ-RIENEEQLEE 685
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 568926925  723 LEEELTDLRAEKTSLEKNLSERKKKsaQERCQAEAEMDEIRKshqEELDRLRQLLKKA 780
Cdd:COG0419   686 KLEELEQLEEELEQLREELEELLKK--LGEIEQLIEELESRK---AELEELKKELEKL 738
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
561-869 1.52e-08

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 58.88  E-value: 1.52e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   561 IMSNIQRIIQENERLKQELLEkssrIEEQNDKISD-LIERNQRYVEQSNLMMEKRNNSLQTATENT------QARILHAE 633
Cdd:TIGR04523  202 LLSNLKKKIQKNKSLESQISE----LKKQNNQLKDnIEKKQQEINEKTTEISNTQTQLNQLKDEQNkikkqlSEKQKELE 277
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   634 QEKAKVTE-------------ELAAATAQVSHLQLK--MTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREA 698
Cdd:TIGR04523  278 QNNKKIKElekqlnqlkseisDLNNQKEQDWNKELKseLKNQEKKLEEIQNQISQNNKIISQLNEQISQLKKELTNSESE 357
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   699 SEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAeaemdEIRKSHQEELDRLRQLLK 778
Cdd:TIGR04523  358 NSEKQRELEEKQNEIEKLKKENQSYKQEIKNLESQINDLESKIQNQEKLNQQKDEQI-----KKLQQEKELLEKEIERLK 432
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   779 KARVS--------TDQAAAEQLTLAQAE-LQSQWEAKCEQLLASARDEHlQQYREVCAQRDAHQQKLALLQDECLALQAQ 849
Cdd:TIGR04523  433 ETIIKnnseikdlTNQDSVKELIIKNLDnTRESLETQLKVLSRSINKIK-QNLEQKQKELKSKEKELKKLNEEKKELEEK 511
                          330       340
                   ....*....|....*....|....
gi 568926925   850 IAAFTEQ----KEHMQRLEKTKSQ 869
Cdd:TIGR04523  512 VKDLTKKisslKEKIEKLESEKKE 535
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
516-781 1.94e-08

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 58.92  E-value: 1.94e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  516 EIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLlpsmsvTMETSMIMSNIQRI---IQENERLKQELLEKSSRIEEQNDK 592
Cdd:PRK03918  211 EISSELPELREELEKLEKEVKELEELKEEIEEL------EKELESLEGSKRKLeekIRELEERIEELKKEIEELEEKVKE 284
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  593 ISDLIERNQRYVEQSNLM---------MEKRNNSLQTATENTQARILHAEQEKAKVtEELaaataqvshlqlkmtahQKK 663
Cdd:PRK03918  285 LKELKEKAEEYIKLSEFYeeyldelreIEKRLSRLEEEINGIEERIKELEEKEERL-EEL-----------------KKK 346
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  664 ETELQLQLtDNLKETDLLRGHVTRLQADLSELR-EASEQTQTKFKSEKQSrrqLELKVTSLEEELTDLRAEKTSLEKNLS 742
Cdd:PRK03918  347 LKELEKRL-EELEERHELYEEAKAKKEELERLKkRLTGLTPEKLEKELEE---LEKAKEEIEEEISKITARIGELKKEIK 422
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568926925  743 ERKK-----KSAQERC-----------------QAEAEMDEIRKSHQEELDRLRQLLKKAR 781
Cdd:PRK03918  423 ELKKaieelKKAKGKCpvcgrelteehrkelleEYTAELKRIEKELKEIEEKERKLRKELR 483
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
623-903 2.41e-08

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 58.11  E-value: 2.41e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  623 ENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLtdnlketDLLRGHVTRLQADLSELREASEQT 702
Cdd:COG4372    77 DDIRPQLRALRTELGTAQGEKRAAETEREAARSELQKARQEREAVRQEL-------AAARQNLAKAQQELARLTKQAQDL 149
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  703 QTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKsaQERCQAEAEMDEIRKSHQEELDRLRQLLKKARV 782
Cdd:COG4372   150 QTRLKTLAEQRRQLEAQAQSLQASQKQLQASATQLKSQVLDLKLR--SAQIEQEAQNLATRANAAQARTEELARRAAAAQ 227
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  783 STDQAAAEQLTLAQAELQSqweakceqllASARDEHLQQyREVCAQRdaHQQKLALLQDECLALQAQIAAFTEQKEHMQR 862
Cdd:COG4372   228 QTAQAIQQRDAQISQKAQQ----------IAARAEQIRE-RERQLQR--LETAQARLEQEVAQLEAYYQAYVRLRQQAAA 294
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|...
gi 568926925  863 LEKTKSQAPAGRAAADpSEKVKKIMNQVFQSLR--GEFELEES 903
Cdd:COG4372   295 TQRGQVLAGAAQRVAQ-AQAQAQAQAQLLSSANrpAALRLRRS 336
PTZ00121 PTZ00121
MAEBL; Provisional
573-798 4.40e-08

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 57.84  E-value: 4.40e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  573 ERLKQELLEKSSRIEEQNDKisdliernqRYVEQSNLMMEKRNNSLQTATENTQArilhaeqEKAKVTEELaaataQVSH 652
Cdd:PTZ00121 1544 EKKKADELKKAEELKKAEEK---------KKAEEAKKAEEDKNMALRKAEEAKKA-------EEARIEEVM-----KLYE 1602
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  653 LQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSE-------LREASEQT-----QTKFKSEKQSRRQLELKV 720
Cdd:PTZ00121 1603 EEKKMKAEEAKKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEekkkaeeLKKAEEENkikaaEEAKKAEEDKKKAEEAKK 1682
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568926925  721 TSLEEELTDLRAEKTSLEKNLSER-KKKSAQERCQAEaemdEIRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAE 798
Cdd:PTZ00121 1683 AEEDEKKAAEALKKEAEEAKKAEElKKKEAEEKKKAE----ELKKAEEENKIKAEEAKKEAE--EDKKKAEEAKKDEEE 1755
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
566-862 4.73e-08

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 57.85  E-value: 4.73e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   566 QRIIQENERLKQELLEKSSRIEEQNDKISDL---------IERNQRYVEQSNLMMEKRNNSLQTAT-ENTQARILHAEQE 635
Cdd:pfam12128  425 HQLEQQKLEFNEEQYLLESRLGELKLQLNQAtatpellenIEQNDERLERAQEAQEQANASVEAAQsELRQLRKRRDEAD 504
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   636 KA-----KVTEELAAATAQVsHLQLKMTAHQK-----------KETELQLQLTDNLKETDL----------------LRG 683
Cdd:pfam12128  505 EAlrranRRLEQLKQALQQL-ELQLSPQAGSLlhflrneapdwEQSIGKLISTELLHRTDLdpelvesssqelnlygVTL 583
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   684 HVTRLQADLS-----ELREASEQTQTKFKSEKQsrrqlelKVTSLEEELTDLRAEKTSLEKNLSERKkksaQERCQAEAE 758
Cdd:pfam12128  584 DLQRIDAPDYaaleeALRERLDQAEKALQAARD-------KQKAAEEQLVQLNKELEKLKREETEAA----RALKQARLT 652
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   759 MDEIRKSHQEELDRLRQLLKKARvstdQAAAEQLTLAQAEL------QSQWEAKCEQLLASARDEHLQQYREVCAQRDAh 832
Cdd:pfam12128  653 LGRLQDEKQSLKDKLQKALKARK----QQAETQLQTLDAQLkqllkkQQAALEEQKEQLRELRTEKQEKWQVVVGDLDA- 727
                          330       340       350
                   ....*....|....*....|....*....|.
gi 568926925   833 qqKLALLQDECLALQAQIAAFTEQ-KEHMQR 862
Cdd:pfam12128  728 --QLALLSAAIAALRTQAKAQLKAlEEQYKR 756
MscS_porin pfam12795
Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part ...
635-870 4.97e-08

Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part of the turgor-driven solute efflux system that protects bacteria from lysis in the event of osmotic shock. The MscS protein alone is sufficient to form a functional mechanosensitive channel gated directly by tension in the lipid bilayer. The MscS proteins are heptamers of three transmembrane subunits with seven converging M3 domains, and this MscS_porin is towards the N-terminal of the molecules. The high concentration of negative charges at the extracellular entrance of the pore helps select the cations for efflux.


Pssm-ID: 403869 [Multi-domain]  Cd Length: 235  Bit Score: 54.99  E-value: 4.97e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   635 EKAKVTEELAAATAQV--SHLQL--KMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSElreaseqtQTKFKSEK 710
Cdd:pfam12795    6 EKRKLDEAAQKALLQDlqQALNLldKIDKSKQRAAQYQKALDDAPAELRELRQELAALQAKAEA--------APKEILAS 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   711 QSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQercqAEAEMDEIRkshqEELDRLRQLLKKARVSTDQAAAE 790
Cdd:pfam12795   78 LSLEELEQRLLQTSSQLQELQEQLAQLNSQLIELQTRPER----AQQQLSEAR----QRLQQIRNQLNGLAAAGEPLSEA 149
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   791 QLTLAQAELQSQW----EAKCEQLLASARDEHLQqyrevcAQRDAHQQKLALLQDECLALQAQIAAfteqkehmQRLEKT 866
Cdd:pfam12795  150 QRWLLQAELAALKaqidMLEQELLSNNNRQDLLQ------AQRDLLTLRIARLEQQLQALQELLNE--------KRLAEA 215

                   ....
gi 568926925   867 KSQA 870
Cdd:pfam12795  216 EQAV 219
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
633-869 5.88e-08

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 57.39  E-value: 5.88e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   633 EQEKAKVTEELAAATAQVSHLQLKmtahqkkETELQLQLtDNLKETdllRGHVTRLQADLSELR--EASEQTQTKFKSEK 710
Cdd:TIGR02169  169 DRKKEKALEELEEVEENIERLDLI-------IDEKRQQL-ERLRRE---REKAERYQALLKEKReyEGYELLKEKEALER 237
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   711 QsRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRL----RQLLKKARVSTDQ 786
Cdd:TIGR02169  238 Q-KEAIERQLASLEEELEKLTEEISELEKRLEEIEQLLEELNKKIKDLGEEEQLRVKEKIGELeaeiASLERSIAEKERE 316
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   787 A--AAEQLTLAQAELQSQwEAKCEQLlasarDEHLQQYRevcAQRDAHQQKLALLQDECLALQAQI--------AAFTEQ 856
Cdd:TIGR02169  317 LedAEERLAKLEAEIDKL-LAEIEEL-----EREIEEER---KRRDKLTEEYAELKEELEDLRAELeevdkefaETRDEL 387
                          250
                   ....*....|...
gi 568926925   857 KEHMQRLEKTKSQ 869
Cdd:TIGR02169  388 KDYREKLEKLKRE 400
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
559-817 6.09e-08

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 56.95  E-value: 6.09e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   559 SMIMSNIQRIIQENER---LKQEL-------LEKSSRIEEQNDKISDLIERNQRYVEQS-NLMMEKR--NNSLQTATENT 625
Cdd:TIGR04523  328 NQISQNNKIISQLNEQisqLKKELtnsesenSEKQRELEEKQNEIEKLKKENQSYKQEIkNLESQINdlESKIQNQEKLN 407
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   626 Q---ARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQT 702
Cdd:TIGR04523  408 QqkdEQIKKLQQEKELLEKEIERLKETIIKNNSEIKDLTNQDSVKELIIKNLDNTRESLETQLKVLSRSINKIKQNLEQK 487
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   703 QTKFKSE-------KQSRRQLELKV-------TSLEEELTDLRAEKTSLEKNLSERKKK-----SAQERCQAEAEMDEIr 763
Cdd:TIGR04523  488 QKELKSKekelkklNEEKKELEEKVkdltkkiSSLKEKIEKLESEKKEKESKISDLEDElnkddFELKKENLEKEIDEK- 566
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 568926925   764 kshQEELDRLRQLLKKARVSTDQAA--AEQLTLAQAELQSQWEAKcEQLLASARDE 817
Cdd:TIGR04523  567 ---NKEIEELKQTQKSLKKKQEEKQelIDQKEKEKKDLIKEIEEK-EKKISSLEKE 618
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
574-870 9.01e-08

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 56.59  E-value: 9.01e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  574 RLKQELLEKSSRIEEQNDKIsdliERNQRYVEQSNLMM----EKRN--NSLQTATENTQARILHAEQEKAKVTEELAAAT 647
Cdd:PRK02224  210 GLESELAELDEEIERYEEQR----EQARETRDEADEVLeeheERREelETLEAEIEDLRETIAETEREREELAEEVRDLR 285
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  648 AQVSHLQ---------------------LKMTAHQKKETELQ-------LQLTDNLKETDLLRGHVTRLQADLSELREAS 699
Cdd:PRK02224  286 ERLEELEeerddllaeaglddadaeaveARREELEDRDEELRdrleecrVAAQAHNEEAESLREDADDLEERAEELREEA 365
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  700 EQTQTKFKSEKQSRRQLELKVTSLEEELTDLRaektsleknlsERKKKSAQERCQAEAEMDEIRkshqEELDRLRQLLKK 779
Cdd:PRK02224  366 AELESELEEAREAVEDRREEIEELEEEIEELR-----------ERFGDAPVDLGNAEDFLEELR----EERDELREREAE 430
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  780 ARVSTdQAAAEQLTLAQAELQSQWEAKCEQLLA-SARDEHLQQYREvcaQRDAHQQKLALLQDECLALQAQIAAFTEQKE 858
Cdd:PRK02224  431 LEATL-RTARERVEEAEALLEAGKCPECGQPVEgSPHVETIEEDRE---RVEELEAELEDLEEEVEEVEERLERAEDLVE 506
                         330
                  ....*....|..
gi 568926925  859 HMQRLEKTKSQA 870
Cdd:PRK02224  507 AEDRIERLEERR 518
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
528-870 2.28e-07

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 55.51  E-value: 2.28e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   528 MDHLMTKVEELQKHSSGNSMLLPSMSVTMETSM--IMSNIQRiiqenerlKQELLEKSSRIEEQNDKISDLIERNQRYVE 605
Cdd:pfam15921  414 IDHLRRELDDRNMEVQRLEALLKAMKSECQGQMerQMAAIQG--------KNESLEKVSSLTAQLESTKEMLRKVVEELT 485
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   606 QSNLMMEKRNNSLQTATENTQARILHAEQEKAKVT----------EELAAATAQVSHLQlkmtaHQKKETE-LQLQLTDN 674
Cdd:pfam15921  486 AKKMTLESSERTVSDLTASLQEKERAIEATNAEITklrsrvdlklQELQHLKNEGDHLR-----NVQTECEaLKLQMAEK 560
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   675 LKETDLLRGHVTRLQADLSEL-REASEQTQTKFKSEKQ-SRRQLEL------------KVTSLEEELTDLRAEKTSLEKN 740
Cdd:pfam15921  561 DKVIEILRQQIENMTQLVGQHgRTAGAMQVEKAQLEKEiNDRRLELqefkilkdkkdaKIRELEARVSDLELEKVKLVNA 640
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   741 LSER---KKKSAQERCQAeaeMDEIRKSHQE--ELDRLRQLLKKarvsTDQAAAEQLTLAQAELQSQweakceqlLASAR 815
Cdd:pfam15921  641 GSERlraVKDIKQERDQL---LNEVKTSRNElnSLSEDYEVLKR----NFRNKSEEMETTTNKLKMQ--------LKSAQ 705
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 568926925   816 DEhLQQYREVCAQ---RDAHQQKLAL-LQDECLALQAQIAAFTEQkehMQRLEKTKSQA 870
Cdd:pfam15921  706 SE-LEQTRNTLKSmegSDGHAMKVAMgMQKQITAKRGQIDALQSK---IQFLEEAMTNA 760
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
557-803 2.71e-07

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 54.34  E-value: 2.71e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  557 ETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDL-----------IERNQRYVEQSN-LMMEKRNNSLQT---- 620
Cdd:COG4942    60 QRAKLEKQLKSLETEIASLEAQLIETADDLKKLRKQIADLnarlnalevqeREQRRRLAEQLAaLQRSGRNPPPALlvsp 139
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  621 --ATENTQARILHAE--QEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNlketdllrghvtrlQADLSELR 696
Cdd:COG4942   140 edAQRSVRLAIYYGAlnPARAERIDALKATLKQLAAVRAEIAAEQAELTTLLSEQRAQ--------------QAKLAQLL 205
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  697 EASEQTQTKFKSEKQSRRQlelkvtSLEEeltdLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQl 776
Cdd:COG4942   206 EERKKTLAQLNSELSADQK------KLEE----LRANESRLKNEIASAEAAAAKAREAAAAAEAAAARARAAEAKRTGE- 274
                         250       260
                  ....*....|....*....|....*..
gi 568926925  777 LKKARVSTDQAAAEQLTLAQAELQSQW 803
Cdd:COG4942   275 TYKPTAPEKMLISSTGGFGALRGQLAW 301
PRK11281 PRK11281
mechanosensitive channel MscK;
632-879 5.20e-07

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 54.15  E-value: 5.20e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  632 AEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETE-LQLQLTDNLKETdllrghvTRLQADLSELReASEQTQTKFKSEK 710
Cdd:PRK11281   49 NKQKLLEAEDKLVQQDLEQTLALLDKIDRQKEETEqLKQQLAQAPAKL-------RQAQAELEALK-DDNDEETRETLST 120
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  711 QSRRQLELKVTSLEEELTDLRAEKTSLEKNLSerKKKSAQERCQAEaeMDEirksHQEELDRLRQLLKKARVSTDQAAAE 790
Cdd:PRK11281  121 LSLRQLESRLAQTLDQLQNAQNDLAEYNSQLV--SLQTQPERAQAA--LYA----NSQRLQQIRNLLKGGKVGGKALRPS 192
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  791 QLTLAQAELQSqWEAKCE---QLLASArdEHLQQYREvcAQRDAHQQKLALLQDECLALQAQIAA--FTEQKEHMQRLEk 865
Cdd:PRK11281  193 QRVLLQAEQAL-LNAQNDlqrKSLEGN--TQLQDLLQ--KQRDYLTARIQRLEHQLQLLQEAINSkrLTLSEKTVQEAQ- 266
                         250
                  ....*....|....
gi 568926925  866 tkSQAPAGRAAADP 879
Cdd:PRK11281  267 --SQDEAARIQANP 278
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
661-951 7.02e-07

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 53.92  E-value: 7.02e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   661 QKKETELQLQLTDNLKETDLLRGHVTRLQadlSELREASEQTqtkfkSEKQSRRQ-LELKVTSLEEELTDL--------- 730
Cdd:TIGR02169  680 RERLEGLKRELSSLQSELRRIENRLDELS---QELSDASRKI-----GEIEKEIEqLEQEEEKLKERLEELeedlssleq 751
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   731 -----RAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEqltlAQAELQSqwEA 805
Cdd:TIGR02169  752 eienvKSELKELEARIEELEEDLHKLEEALNDLEARLSHSRIPEIQAELSKLEEEVSRIEARLRE----IEQKLNR--LT 825
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   806 KCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAaftEQKEHMQRLEKTKSqapagraaaDPSEKVKK 885
Cdd:TIGR02169  826 LEKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELE---ELEAALRDLESRLG---------DLKKERDE 893
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568926925   886 IMNQVFQSLRGEFELEESYDggtILRTIMHTIKmVTLQLLNHQEEEEEEEEEEEEEKKPLRPSLEQ 951
Cdd:TIGR02169  894 LEAQLRELERKIEELEAQIE---KKRKRLSELK-AKLEALEEELSEIEDPKGEDEEIPEEELSLED 955
TPH pfam13868
Trichohyalin-plectin-homology domain; This family is a mixtrue of two different families of ...
569-864 7.88e-07

Trichohyalin-plectin-homology domain; This family is a mixtrue of two different families of eukaryotic proteins. Trichoplein or mitostatin, was first defined as a meiosis-specific nuclear structural protein. It has since been linked with mitochondrial movement. It is associated with the mitochondrial outer membrane, and over-expression leads to reduction in mitochondrial motility whereas lack of it enhances mitochondrial movement. The activity appears to be mediated through binding the mitochondria to the actin intermediate filaments (IFs). The family is in the trichohyalin-plectin-homology domain.


Pssm-ID: 404709 [Multi-domain]  Cd Length: 352  Bit Score: 52.61  E-value: 7.88e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   569 IQENERLKQELLEKSSRIEEqndkisdliernqryveqsnlMMEKRNnslqtatentqARILHAEQEKAKVTEELAAATA 648
Cdd:pfam13868   28 IAEKKRIKAEEKEEERRLDE---------------------MMEEER-----------EKALEEEEEKEEERKEKRKEYR 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   649 QVSHLQLKMTAHQKKETELQLqltdnLKETDLLRGHVTRLQA-DLSELREASE-QTQT-----KFKSEKQSRRQLELKvt 721
Cdd:pfam13868   76 QELEQQIEEREKKRQEEYEEK-----LQEKEMIDEIVEKIQEeDEAEAEEKLEkQKELreeidEFNEEQAEWKELEKE-- 148
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   722 slEEELTDLRAEKTSLEKnlserkkksaQERcqaEAEMD----EIRKSHQEELDRLRQLLKKARvsTDQAAAEQL--TLA 795
Cdd:pfam13868  149 --EEKEEDERILEYLKEK----------EER---EEEREaerrEIEEEKEREIARLRAQQEKAQ--DEKEERDELraDLY 211
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   796 QAELQSQWEAK----------CEQLLASARDEHL---QQYREVCAQRDAHQQKLALLQdecLALQAQIAAFTEQKEHMQR 862
Cdd:pfam13868  212 QEEQERKWRQKereeaekkarQRQELRQAREEQVelkERRLAEEAEREEEEFERMLRK---QAEDERIEQEEAEKRRMKR 288

                   ..
gi 568926925   863 LE 864
Cdd:pfam13868  289 LE 290
COG1579 COG1579
Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function ...
633-779 9.86e-07

Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function prediction only];


Pssm-ID: 224495 [Multi-domain]  Cd Length: 239  Bit Score: 51.21  E-value: 9.86e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  633 EQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTK--FKSEK 710
Cdd:COG1579    23 EPRIKEIRKALKKAKAELEALNKALEALEIELEDLENQVSQLESEIQEIRERIKRAEEKLSAVKDERELRALNieIQIAK 102
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568926925  711 QSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKK 779
Cdd:COG1579   103 ERINSLEDELAELMEEIEKLEKEIEDLKERLERLEKNLAEAEARLEEEVAEIREEGQELSSKREELKEK 171
SlpA COG1047
FKBP-type peptidyl-prolyl cis-trans isomerase 2 [Posttranslational modification, protein ...
192-253 1.07e-06

FKBP-type peptidyl-prolyl cis-trans isomerase 2 [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223976  Cd Length: 174  Bit Score: 49.95  E-value: 1.07e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 568926925  192 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKR 253
Cdd:COG1047     2 KIEKGDVVSLHYTLKVED----GEVVDTTDENYGPLTFIVGAGQLIPGLEEALLGKEVGEEF 59
PTZ00121 PTZ00121
MAEBL; Provisional
570-885 1.08e-06

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 53.22  E-value: 1.08e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  570 QENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRN--NSLQTATENTQARILHAEQEKAKVTEELA--A 645
Cdd:PTZ00121 1413 AAAAKKKADEAKKKAEEKKKADEAKKKAEEAKKADEAKKKAEEAKKaeEAKKKAEEAKKADEAKKKAEEAKKADEAKkkA 1492
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  646 ATAQVSHLQLKMTAHQKKETElQLQLTDNLKETDLLRGHVTRLQAD----------------LSELREASEQTQTKFKSE 709
Cdd:PTZ00121 1493 EEAKKKADEAKKAAEAKKKAD-EAKKAEEAKKADEAKKAEEAKKADeakkaeekkkadelkkAEELKKAEEKKKAEEAKK 1571
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  710 KQSRRQLELK---------------VTSLEEELTDLRAEKT-----------SLEKNLSERKKKSAQERCQAEA--EMDE 761
Cdd:PTZ00121 1572 AEEDKNMALRkaeeakkaeearieeVMKLYEEEKKMKAEEAkkaeeakikaeELKKAEEEKKKVEQLKKKEAEEkkKAEE 1651
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  762 IRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYREVcAQRDAHQQKLAllqD 841
Cdd:PTZ00121 1652 LKKAEEENKIKAAEEAKKAE--EDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKAEELKKKEAE-EKKKAEELKKA---E 1725
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....
gi 568926925  842 ECLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADPSEKVKK 885
Cdd:PTZ00121 1726 EENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKK 1769
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
574-904 1.18e-06

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 53.05  E-value: 1.18e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   574 RLKQELLEKSsriEEQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATEntqarilhAEQEKAKVTEELAAATAQVSHl 653
Cdd:TIGR00618  153 EFAQFLKAKS---KEKKELLMNLFPLDQ--YTQLALMEFAKKKSLHGKAE--------LLTLRSQLLTLCTPCMPDTYH- 218
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   654 qlkmTAHQKKETELQlQLTDNLKETDllrghvtRLQADLSELREASEQTQTKFKSEKQSRRQLElKVTSLEEELtdlraE 733
Cdd:TIGR00618  219 ----ERKQVLEKELK-HLREALQQTQ-------QSHAYLTQKREAQEEQLKKQQLLKQLRARIE-ELRAQEAVL-----E 280
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   734 KTSLEKNLSERKKKSAQErcqaEAEMDEIRKSHQEELDRLRQ---LLKKARVSTDQAAAEQLTL-AQAELQSQWEAKCEQ 809
Cdd:TIGR00618  281 ETQERINRARKAAPLAAH----IKAVTQIEQQAQRIHTELQSkmrSRAKLLMKRAAHVKQQSSIeEQRRLLQTLHSQEIH 356
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   810 LlasaRDEHLQQyrevCAQRDAHQQKLALLQdECLALQAQIAAFTEQkehMQRLEKTKSQAPAGRAAADPSEKVKKIMNQ 889
Cdd:TIGR00618  357 I----RDAHEVA----TSIREISCQQHTLTQ-HIHTLQQQKTTLTQK---LQSLCKELDILQREQATIDTRTSAFRDLQG 424
                          330
                   ....*....|....*
gi 568926925   890 VFQSLRGEFELEESY 904
Cdd:TIGR00618  425 QLAHAKKQQELQQRY 439
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
507-804 1.26e-06

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 53.18  E-value: 1.26e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  507 MTEARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLpsMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRI 586
Cdd:COG1196   760 LEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEEL--EEAERRLDALERELESLEQRRERLEQEIEELEEEI 837
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  587 EEQNDKISDLiernqryveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVTEELAaataqvshlqlkmtAHQKKETE 666
Cdd:COG1196   838 EELEEKLDEL---------------EEELEELEKELEELKEELEELEAEKEELEDELK--------------ELEEEKEE 888
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  667 LQLQLTDnlketdllrghvtrLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEknlSERKK 746
Cdd:COG1196   889 LEEELRE--------------LESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEEEYEDTLETE---LEREI 951
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 568926925  747 KSAQERCQAEAEMDE-IRKSHQEELDRLRQLLKKarvstdqaaAEQLTLAQAELQSQWE 804
Cdd:COG1196   952 ERLEEEIEALGPVNLrAIEEYEEVEERYEELKSQ---------REDLEEAKEKLLEVIE 1001
YhaN COG4717
Uncharacterized protein YhaN, contains AAA domain [Function unknown];
568-840 1.62e-06

Uncharacterized protein YhaN, contains AAA domain [Function unknown];


Pssm-ID: 227061 [Multi-domain]  Cd Length: 984  Bit Score: 52.54  E-value: 1.62e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  568 IIQENERLKQELLEkSSRIEEQNDKIS---DLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELA 644
Cdd:COG4717   538 ITDELPELAVDLLV-QSRIRQHWQQLRkalDQLEAAYEALEGRFAAAEAAMAEWQSEWEEALDELGLSRELSPEQQLDIL 616
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  645 AATAQVSHLQlkmtahqKKETELQLQLTDNLKETDLLRGHVTRL----QADLSELREASEQTQTKFKSEKQS---RRQLE 717
Cdd:COG4717   617 STMKDLKKLM-------QKKAELTHQVARLREEQAAFEERVEGLlavlEAQFIDLSTLFCVQRLRVAAELQKeeaRLALE 689
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  718 LKVTSLEEELTDLRAEktsLEKNlseRKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLKKARVSTDQ---AAAEQLTL 794
Cdd:COG4717   690 GNIERTKELNDELRAE---LELH---RKEILDLFDCGTADTEDAFREAAREE-QQLTQRESRLESLEAQlegVAAEAYEL 762
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 568926925  795 AQAELQSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQ 840
Cdd:COG4717   763 SASLDQRELKEEELALLEEAIDALDEEVEELHAQVAALSRQIAQLE 808
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
589-840 1.80e-06

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 51.95  E-value: 1.80e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  589 QNDKISDLIERNQRYVEQSnlmmEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQ 668
Cdd:COG4372    75 QLDDIRPQLRALRTELGTA----QGEKRAAETEREAARSELQKARQEREAVRQELAAARQNLAKAQQELARLTKQAQDLQ 150
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  669 LQLTDNLKETDLLRGHVTRLQADLSELREASEQTQT-----KFKSEKQSRRQLELK-----VTSLEEELTDLRAEKTSLE 738
Cdd:COG4372   151 TRLKTLAEQRRQLEAQAQSLQASQKQLQASATQLKSqvldlKLRSAQIEQEAQNLAtranaAQARTEELARRAAAAQQTA 230
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  739 KNLSERKKKsAQERCQAEAEMDEIRKSHQEELDRLRQllKKARVSTDQAAAEQLTLAQAELQSQWEAKCE-QLLASA--R 815
Cdd:COG4372   231 QAIQQRDAQ-ISQKAQQIAARAEQIRERERQLQRLET--AQARLEQEVAQLEAYYQAYVRLRQQAAATQRgQVLAGAaqR 307
                         250       260
                  ....*....|....*....|....*
gi 568926925  816 DEHLQQYREVCAQRDAHQQKLALLQ 840
Cdd:COG4372   308 VAQAQAQAQAQAQLLSSANRPAALR 332
DUF812 pfam05667
Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of ...
571-862 2.03e-06

Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of unknown function.


Pssm-ID: 398992 [Multi-domain]  Cd Length: 590  Bit Score: 51.94  E-value: 2.03e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   571 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLmmekrnnslqtATENTQARILHAEQEKAKVTEEL-AAATAQ 649
Cdd:pfam05667  223 EEEWNSQGLASRLTPEEYRKRKRTKLLKRIAEQLRSAAL-----------ASTEATSGASRSAQDLAELLSSFgGSSTTD 291
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   650 VSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTD 729
Cdd:pfam05667  292 TNLTKGSRFTHTEKLQFTNEAAASPPSKAETEEELQQQREEELEELQEQLEDLESSIEELEKEIKKLESSIKQVEEELEE 371
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   730 LRAEKTSLEKNLsERKKKSAQERCQAEAEMDEirkshqeeldrlrqlLKKARvstdQAAAEQLtlaqAELQSQWEAKCEQ 809
Cdd:pfam05667  372 LKEQNEELEKQY-KVKKKTLDLLPDAEENIAK---------------LQAVV----EASAQRL----VELAGQWEKHRVP 427
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 568926925   810 LLasardEHLQQYREVCAQR-DAHQQKLA---LLQDECLalqaQIAAFTEQKEHMQR 862
Cdd:pfam05667  428 LI-----EEYRALKEAKSNKeSESQRKLEeikELREKIK----EVAEEARSKEELYK 475
HMMR_N pfam15905
Hyaluronan mediated motility receptor N-terminal; HMMR_N is the N-terminal region of ...
572-824 2.12e-06

Hyaluronan mediated motility receptor N-terminal; HMMR_N is the N-terminal region of eukaryotic hyaluronan-mediated motility receptor proteins. The protein is functionally associated with BRCA1 and thus predicted to be a common, low-penetrance breast cancer candidate.


Pssm-ID: 406356 [Multi-domain]  Cd Length: 331  Bit Score: 51.34  E-value: 2.12e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   572 NERLKQELLEKssrieeqndKISDLIernqryveQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAataqvs 651
Cdd:pfam15905   72 KESKDQKELEK---------EIRALV--------QERGEQDKRLQALEEELEKVEAKLNAAVREKTSLSASVAS------ 128
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   652 hlqlkmtahqkketeLQLQLTDNLKETDLLR------GHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEE 725
Cdd:pfam15905  129 ---------------LEKQLLELTRVNELLKakfsedGTQKKMSSLSMELMKLRNKLEAKMKEVMAKQEGMEGKLQVTQK 193
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   726 ELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQ--EELDRLRQLLKKARVSTDQAAAEQLTLAQA------ 797
Cdd:pfam15905  194 NLEHSKGKVAQLEEKLVSTEKEKIEEKSETEKLLEYITELSCvsEQVEKYKLDIAQLEELLKEKNDEIESLKQSleekeq 273
                          250       260       270
                   ....*....|....*....|....*....|
gi 568926925   798 ELQSQWE---AKCeQLLASARDEHLQQYRE 824
Cdd:pfam15905  274 ELSKQIKdlnEKC-KLLESEKEELLREYEE 302
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
580-871 2.14e-06

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 51.99  E-value: 2.14e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  580 LEKSSRIEEQNDKISDLIER--------NQRYVEQ--------SNLMMEK------RNNSLQTATENTQARILHAEQEKA 637
Cdd:PRK03918  100 LDGSEVLEEGDSSVREWVERlipyhvflNAIYIRQgeidaileSDESREKvvrqilGLDDYENAYKNLGEVIKEIKRRIE 179
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  638 KVtEELAAATAQVSHLqLKmtaHQKKETELQLQ----LTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSR 713
Cdd:PRK03918  180 RL-EKFIKRTENIEEL-IK---EKEKELEEVLReineISSELPELREELEKLEKEVKELEELKEEIEELEKELESLEGSK 254
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  714 RQLELKVTSLEEELTDLRAEKTSLEKNLSERK--KKSAQERCQAEAEMDEIRKSHQE---ELDRLRQLLKK-----ARVS 783
Cdd:PRK03918  255 RKLEEKIRELEERIEELKKEIEELEEKVKELKelKEKAEEYIKLSEFYEEYLDELREiekRLSRLEEEINGieeriKELE 334
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  784 TDQAAAEQLTLAQAELQSQWEA--KCEQLLASARD--EHLQQYR---------EVCAQRDAHQQKLALLQDECLALQAQI 850
Cdd:PRK03918  335 EKEERLEELKKKLKELEKRLEEleERHELYEEAKAkkEELERLKkrltgltpeKLEKELEELEKAKEEIEEEISKITARI 414
                         330       340
                  ....*....|....*....|....*
gi 568926925  851 AAF----TEQKEHMQRLEKTKSQAP 871
Cdd:PRK03918  415 GELkkeiKELKKAIEELKKAKGKCP 439
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
570-778 2.24e-06

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 52.10  E-value: 2.24e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   570 QENERLKQELLEKSSRIEEQNDKISDLIERnqryVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQ 649
Cdd:pfam01576  422 SESERQRAELAEKLSKLQSELESVSGLLSE----AEGKSIKLSKDVSSLESQLQDTQELLQEETRQKLNLSSRLRQLEDE 497
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   650 VSHL--QLKMTAHQKKETE-----LQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTS 722
Cdd:pfam01576  498 RNSLqeQLEEEEEAKRNVErqlstLQAQLSEMKKKLEEDAGAVEALEEAKKRLQRELEALTQRLEEKAAAYDKLEKTKNR 577
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   723 LEEELTDL-------RAEKTSLEKN-------LSERKKKSAQ---ERCQAEAEMDEIR-------------KSHQEELDR 772
Cdd:pfam01576  578 LQQELDDLlvdldhqRQLVSNLEKKqkkfdqmLAEEKAISARyaeERDRAEAEAREKEtralslsraleeaLEAKEELER 657

                   ....*.
gi 568926925   773 LRQLLK 778
Cdd:pfam01576  658 QNKQLR 663
PRK04778 PRK04778
septation ring formation regulator EzrA; Provisional
577-870 2.58e-06

septation ring formation regulator EzrA; Provisional


Pssm-ID: 179877 [Multi-domain]  Cd Length: 569  Bit Score: 51.76  E-value: 2.58e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  577 QELLEkssRIEEQNDKIsdliernqRYVEQSNLMmeKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQV----SH 652
Cdd:PRK04778   85 EEQLF---EAEELNDKF--------RFRKAKHEI--NEIESLLDLIEEDIEQILEELQELLESEEKNREEVEQLkdlyRE 151
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  653 LQLKMTAH-------------QKKETELQLQLTDNLKET----------DLLRGHVTRLQADLSELREASEQTQTKFKSE 709
Cdd:PRK04778  152 LRKSLLANrfsfgpaldelekQLENLEEEFSQFVELTESgdyveareilDQLEEELAALEQIMEEIPELLKELQTELPDQ 231
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  710 ----KQSRRQLE-----LKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQA-EAEMDEI----------RKSHQEE 769
Cdd:PRK04778  232 lqelKAGYRELVeegyhLDHLDIEKEIQDLKEQIDENLALLEELDLDEAEEKNEEiQERIDQLydilerevkaRKYVEKN 311
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  770 LDRLRQLLKKARVSTDQAAAE--------QLTLAQAELQSQWEAKCEQLLAsardehlqQYREVCAQRDAHQQKLALLQD 841
Cdd:PRK04778  312 SDTLPDFLEHAKEQNKELKEEidrvkqsyTLNESELESVRQLEKQLESLEK--------QYDEITERIAEQEIAYSELQE 383
                         330       340       350
                  ....*....|....*....|....*....|...
gi 568926925  842 ECLALQAQIAAFTEQ----KEHMQRLEKTKSQA 870
Cdd:PRK04778  384 ELEEILKQLEEIEKEqeklSEMLQGLRKDELEA 416
EzrA COG4477
Septation ring formation regulator EzrA [Cell cycle control, cell division, chromosome ...
586-782 2.87e-06

Septation ring formation regulator EzrA [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 226883 [Multi-domain]  Cd Length: 570  Bit Score: 51.61  E-value: 2.87e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  586 IEEQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQA--RILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKK 663
Cdd:COG4477   253 IDSRLERLKEQLVENS--ELLTQLELDEAEEELGLIQEKIESlyDLLEREVEAKNVVEENLPILPDYLEKAKENNEHLKE 330
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  664 ETELqLQLTDNLKETDLlrGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSE 743
Cdd:COG4477   331 EIER-VKESYRLAETEL--GSVRKFEKELKELESVLDEILENIEAQEVAYSELQDNLEEIEKALTDIEDEQEKVQEHLTS 407
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 568926925  744 RKKKSAQERcqaeaemdEIRKSHQEELDRLRQLLKKARV 782
Cdd:COG4477   408 LRKDELEAR--------ENLERLKSKLHEIKRYMEKSNL 438
COG1340 COG1340
Uncharacterized coiled-coil protein, contains DUF342 domain [Function unknown];
509-747 2.93e-06

Uncharacterized coiled-coil protein, contains DUF342 domain [Function unknown];


Pssm-ID: 224259 [Multi-domain]  Cd Length: 294  Bit Score: 50.45  E-value: 2.93e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  509 EARQHNTEIRMAVNKVADKMDHLMTKVEELqkhssgnsmllpsmsvtmeTSMIMSNIQR---IIQENERLKQELLEKSSR 585
Cdd:COG1340    24 ELKEKRDELRKEASELAEKRDELNAKVREL-------------------REKAQELREErdeINEEVQELKEKRDEINAK 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  586 IEEQNDKISDLIE-RNQRYVEQSNLM-MEKRNNSLQTATENTQARI----------------LHAEQEKAKVTEELAAAT 647
Cdd:COG1340    85 LQELRKEYRELKEkRNEFNLGGRSIKsLEREIERLEKKQQTSVLTPeeerelvqkikelrkeLEDAKKALEENEKLKELK 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  648 AQVSHLQLKMTAHQKKETEL-------QLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 720
Cdd:COG1340   165 AEIDELKKKAREIHEKIQELaneaqeyHEEMIKLFEEADELRKEADELHEEFVELSKKIDELHEEFRNLQNELRELEKKI 244
                         250       260
                  ....*....|....*....|....*....
gi 568926925  721 TSLEEELTDL--RAEKTSLEKNLSERKKK 747
Cdd:COG1340   245 KALRAKEKAAkrREKREELKERAEEIYEK 273
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
495-863 3.85e-06

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 51.27  E-value: 3.85e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   495 HFQGSGDMMSFLMteaRQHNTEIRMAVNKVADKMDHLmtkvEELQKHSSGNSMLLPSMSvtmetsmiMSNIQRIIQENER 574
Cdd:pfam15921  214 HFRSLGSAISKIL---RELDTEISYLKGRIFPVEDQL----EALKSESQNKIELLLQQH--------QDRIEQLISEHEV 278
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   575 LKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENtqariLHAEQEKAKVTEElaaatAQVSHLQ 654
Cdd:pfam15921  279 EITGLTEKASSARSQANSIQSQLEIIQEQARNQNSMYMRQLSDLESTVSQ-----LRSELREAKRMYE-----DKIEELE 348
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   655 LKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADL----SELREASEQTQTKFKSEKQS-------RRQLE---LKV 720
Cdd:pfam15921  349 KQLVLANSELTEARTERDQFSQESGNLDDQLQKLLADLhkreKELSLEKEQNKRLWDRDTGNsitidhlRRELDdrnMEV 428
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   721 TSLEEELTDLRAE-KTSLEKNLS--ERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQllKKARVSTDQAAAEQLTLAQA 797
Cdd:pfam15921  429 QRLEALLKAMKSEcQGQMERQMAaiQGKNESLEKVSSLTAQLESTKEMLRKVVEELTA--KKMTLESSERTVSDLTASLQ 506
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568926925   798 ELQSQWEAKCEQL--LASARDEHLQQYREVCAQRDAHQQklalLQDECLALQAQIAA-------FTEQKEHMQRL 863
Cdd:pfam15921  507 EKERAIEATNAEItkLRSRVDLKLQELQHLKNEGDHLRN----VQTECEALKLQMAEkdkvieiLRQQIENMTQL 577
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
565-865 4.06e-06

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 51.12  E-value: 4.06e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   565 IQRIIQENERLKQ---ELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTE 641
Cdd:TIGR00618  565 MQEIQQSFSILTQcdnRSKEDIPNLQNITVRLQDLTEKLSEAEDMLACEQHALLRKLQPEQDLQDVRLHLQQCSQELALK 644
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   642 ELAAATAQVSHLQLKMTAHQKKETELQLQLTD-NLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 720
Cdd:TIGR00618  645 LTALHALQLTLTQERVREHALSIRVLPKELLAsRQLALQKMQSEKEQLTYWKEMLAQCQTLLRELETHIEEYDREFNEIE 724
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   721 TSLEEELTDLRAEKTSLEKNLSERKKKsAQERCQAEAEMDEiRKSHQE-----ELDRLRQLLKKARVSTDQAAAEQLTLA 795
Cdd:TIGR00618  725 NASSSLGSDLAAREDALNQSLKELMHQ-ARTVLKARTEAHF-NNNEEVtaalqTGAELSHLAAEIQFFNRLREEDTHLLK 802
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568926925   796 QAELQSQWEAKCEQLLASARDEHLQQYREVCAQRDA------HQQKLALLQD-ECLALQAQiaAFTEQKEHMQRLEK 865
Cdd:TIGR00618  803 TLEAEIGQEIPSDEDILNLQCETLVQEEEQFLSRLEeksatlGEITHQLLKYeECSKQLAQ--LTQEQAKIIQLSDK 877
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
569-868 4.29e-06

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 51.19  E-value: 4.29e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  569 IQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQsnlmmEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATA 648
Cdd:PRK02224  470 IEEDRERVEELEAELEDLEEEVEEVEERLERAEDLVEA-----EDRIERLEERREDLEELIAERRETIEEKRERAEELRE 544
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  649 QVSHLQLKMTAHQKKETELQLqltdnlkETDLLRGHVTRLQADLSELreaseqtqtkfkseKQSRRQLElKVTSLEEELT 728
Cdd:PRK02224  545 RAAELEAEAEEKREAAAEAEE-------EAEEAREEVAELNSKLAEL--------------KERIESLE-RIRTLLAAIA 602
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  729 DLRAEKTSLeknlserkkksaQERCQAEAEMDEIRKSHQEEL-DRLRQL---LKKARVSTDQAAAEQLTLAQAELqsqwe 804
Cdd:PRK02224  603 DAEDEIERL------------REKREALAELNDERRERLAEKrERKRELeaeFDEARIEEAREDKERAEEYLEQV----- 665
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 568926925  805 akceqllasarDEHLQQYREvcaQRDAhqqklalLQDECLALQAQIAAFTEQKEHMQRLEKTKS 868
Cdd:PRK02224  666 -----------EEKLDELRE---ERDD-------LQAEIGAVENELEELEELRERREALENRVE 708
COG5022 COG5022
Myosin heavy chain [General function prediction only];
521-734 4.75e-06

Myosin heavy chain [General function prediction only];


Pssm-ID: 227355 [Multi-domain]  Cd Length: 1463  Bit Score: 51.23  E-value: 4.75e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  521 VNKVADKMDHLMTKVEELQKHSSGNSML---LPSMSVTMETSM---IMSNIQRIIQ-ENERLKQELLEKSSRIEEQNDKI 593
Cdd:COG5022   894 ISSLKLVNLELESEIIELKKSLSSDLIEnleFKTELIARLKKLlnnIDLEEGPSIEyVKLPELNKLHEVESKLKETSEEY 973
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  594 SDLIERNQRYVEQSNLMMEKRNNSLQTATE-NTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLT 672
Cdd:COG5022   974 EDLLKKSTILVREGNKANSELKNFKKELAElSKQYGALQESTKQLKELPVEVAELQSASKIISSESTELSILKPLQKLKG 1053
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 568926925  673 DNLKEtdllrghVTRLQADLSELREASEQTQTKFKSEKQSRRQ--LELKVTSLEEELTDLRAEK 734
Cdd:COG5022  1054 LLLLE-------NNQLQARYKALKLRRENSLLDDKQLYQLESTenLLKTINVKDLEVTNRNLVK 1110
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
563-743 6.81e-06

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 50.53  E-value: 6.81e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  563 SNIQRIIQENERLKQELLEKSSRIEEQND--KISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAR----ILHAEQEK 636
Cdd:COG0419   562 RQLEDRLQELKELLEELRLLRTRKEELEElrERLKELKKKLKELEERLSQLEELLQSLELSEAENELEeaeeELESELEK 641
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  637 AKVTEELA-AATAQVSHLQLK--------MTAHQKKETELQLQltDNLKETDLLRGHVTRLQADLSELREaseqtqtKFK 707
Cdd:COG0419   642 LNLQAELEeLLQAALEELEEKveeleaeiRRELQRIENEEQLE--EKLEELEQLEEELEQLREELEELLK-------KLG 712
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 568926925  708 SEKQSRRQLElkvtSLEEELTDLRAEKTSLEKNLSE 743
Cdd:COG0419   713 EIEQLIEELE----SRKAELEELKKELEKLEKALEL 744
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
606-837 8.41e-06

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 49.72  E-value: 8.41e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  606 QSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHV 685
Cdd:COG4942    31 FSAAADDKQLKQIQKEIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADDLKKLRKQIADLNARLNALEVQE 110
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  686 TRLQADLSELREASEQTQTKFK-----SEKQSRRQLELKVtsLEEELTDLRAEKT-SLEKNLSE---RKKKSAQERCQAE 756
Cdd:COG4942   111 REQRRRLAEQLAALQRSGRNPPpallvSPEDAQRSVRLAI--YYGALNPARAERIdALKATLKQlaaVRAEIAAEQAELT 188
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  757 AEMDEiRKSHQEELDRLRQLLKKARVSTDQA-AAEQLTLAqaELQSQwEAKCEQLLASARDEHLQQYREVCAQRDAHQQK 835
Cdd:COG4942   189 TLLSE-QRAQQAKLAQLLEERKKTLAQLNSElSADQKKLE--ELRAN-ESRLKNEIASAEAAAAKAREAAAAAEAAAARA 264

                  ..
gi 568926925  836 LA 837
Cdd:COG4942   265 RA 266
mukB PRK04863
chromosome partition protein MukB;
641-881 9.05e-06

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 50.34  E-value: 9.05e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  641 EELAAATAQVSHLQLKMTAHQKKETELQLQLtDNLKET-DLLRGHVTR--------LQADLSELREASEQTQTKFKSEKQ 711
Cdd:PRK04863  837 AELRQLNRRRVELERALADHESQEQQQRSQL-EQAKEGlSALNRLLPRlnlladetLADRVEEIREQLDEAEEAKRFVQQ 915
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  712 SRRQLELkvtsLEEELTDLRAEktsleknlserkkksaqercqaEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAA--- 788
Cdd:PRK04863  916 HGNALAQ----LEPIVSVLQSD----------------------PEQFEQLKQDYQQAQQTQRDAKQQAFALTEVVQrra 969
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  789 ------AEQLTLAQAELQSQWEAKCEQlLASARDEHLQQYREVCAQrdaHQQKLALLQDeclaLQAQIAAFTEQ-KEHMQ 861
Cdd:PRK04863  970 hfsyedAAEMLAKNSDLNEKLRQRLEQ-AEQERTRAREQLRQAQAQ---LAQYNQVLAS----LKSSYDAKRQMlQELKQ 1041
                         250       260
                  ....*....|....*....|...
gi 568926925  862 RLEKTKSQAPAG---RAAADPSE 881
Cdd:PRK04863 1042 ELQDLGVPADSGaeeRARARRDE 1064
Macoilin pfam09726
Macoilin family; The Macoilin proteins has an N-terminal portion that is composed of 5 ...
641-857 9.53e-06

Macoilin family; The Macoilin proteins has an N-terminal portion that is composed of 5 trasnmembrane helices, followed by a C-terminal coiled-coil region. Macoilin is a highly conserved protein present in eukaryotes. Macoilin appears to be found in the ER and be involved in the function of neurons.


Pssm-ID: 401607  Cd Length: 664  Bit Score: 49.84  E-value: 9.53e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   641 EELAAATAQVSHLQLKMTAHQKKETELQLQLtdnlketDLLRGHVTRLQADLSELREASEQTQTKFKS-------EKQSR 713
Cdd:pfam09726  389 DALVRLEQDIKKLKAELQASRQTEQELRSQI-------SSLTSLERSLKSELGQLRQENDLLQTKLHNavsakqkDKQTV 461
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   714 RQLELKvtsLEEEltdlRAEKTSLEKNLSERKK-------KSAQERCQAEA---EMDEIRKSHQEELD-RLRQLLKKARV 782
Cdd:pfam09726  462 QQLEKR---LKAE----QEARASAEKQLAEEKKrkkeeeaTAARAVALAAAsrgECTESLKQRKRELEsEIKKLTHDIKL 534
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568926925   783 STDQAAaeqltlaqaelqsQWEAKCEQllasardehLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK 857
Cdd:pfam09726  535 KEEQIR-------------ELEIKVQE---------LRKYKESEKDTEVLMSALSAMQDKNQHLENSLSAETRIK 587
PRK11281 PRK11281
mechanosensitive channel MscK;
564-800 1.24e-05

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 49.91  E-value: 1.24e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  564 NIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERN-----QRYVEQSNLMMEKRNNSLQTATENTQarilhaeqekak 638
Cdd:PRK11281   74 KIDRQKEETEQLKQQLAQAPAKLRQAQAELEALKDDNdeetrETLSTLSLRQLESRLAQTLDQLQNAQ------------ 141
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  639 vtEELAAATAQVSHLQLK-------MTAHQKKETELQLQLTDNLKETDLLRG-HVTRLQADLS------ELREASEQTQT 704
Cdd:PRK11281  142 --NDLAEYNSQLVSLQTQperaqaaLYANSQRLQQIRNLLKGGKVGGKALRPsQRVLLQAEQAllnaqnDLQRKSLEGNT 219
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  705 KFKSEKQSRRQL-ELKVTSLEEELTDLRAEKTslEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVS 783
Cdd:PRK11281  220 QLQDLLQKQRDYlTARIQRLEHQLQLLQEAIN--SKRLTLSEKTVQEAQSQDEAARIQANPLVAQELEINLQLSQRLLKA 297
                         250
                  ....*....|....*..
gi 568926925  784 TDQAAaeqlTLAQAELQ 800
Cdd:PRK11281  298 TEKLN----TLTQQNLR 310
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
621-878 1.39e-05

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 49.76  E-value: 1.39e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   621 ATENTQARILHAEQEkakvTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKE--------TDLLRGHVTRLQADL 692
Cdd:pfam12128  234 RIMKVAPEIEKLQED----FEQLESLELKLSLLHVELKADELRIATEQEERQELKNElksqlrtlEDELAEKIDELNGRL 309
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   693 SELREASEQTQTKFKS-EKQSRRQLELKVTSLEEELTDLRAEKTSLEkNLSERKKKSAQERCQAEAEMDEIRKSHQEELD 771
Cdd:pfam12128  310 SAADAALAAKRSELEAlDDQKGAFQDDDIETLAADQEQLPSIQSELE-EVEERLDALTGNHQDVTQKYERLKQKISEELN 388
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   772 RLRQLLKKARVSTDQAAAEQLTLAQAELQ---SQWEAKCEQLLASARDEhlQQYREVCAQRDAHQQKLALLQDEclaLQA 848
Cdd:pfam12128  389 RDLSGNKERLAKIREAKDRQLAAIEEVLQaleSQLRHQLEQQKLEFNEE--QYLLESRLGELKLQLNQATATPE---LLE 463
                          250       260       270
                   ....*....|....*....|....*....|....
gi 568926925   849 QIAAFTEQKEHMQR----LEKTKSQAPAGRAAAD 878
Cdd:pfam12128  464 NIEQNDERLERAQEaqeqANASVEAAQSELRQLR 497
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
547-752 1.48e-05

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 49.24  E-value: 1.48e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  547 MLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDliernqryvEQSNLMMEKRNNSLQTATENTQ 626
Cdd:NF038025   23 DLLENMAKEKDEKQIKKAADEVTAEKDDLLDELENEQEEEPETFTEQKE---------EEDKEDLEAILDELATEANKAS 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  627 ARILHAEQEKAKVTEELAAataqvshlqlkmtahqKKETELQLqltdNLKEtdllrghvtrlqaDLSELREaseqtqtkf 706
Cdd:NF038025   94 AELDEVNAEIQGVKEEIKE----------------KQEQLMVL----DTKE-------------ELDELSE--------- 131
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 568926925  707 ksEKQSRRQ-LELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQER 752
Cdd:NF038025  132 --EELAERQeLEAEIKQLEAQLDELEEEKEELEEELKTIRKDQWSQT 176
PspA COG1842
Phage shock protein A [Transcription, Signal transduction mechanisms];
611-815 1.55e-05

Phage shock protein A [Transcription, Signal transduction mechanisms];


Pssm-ID: 224755 [Multi-domain]  Cd Length: 225  Bit Score: 47.70  E-value: 1.55e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  611 MEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKeTELQLQLTDNlketDLLRGHVTRLQa 690
Cdd:COG1842    22 AEDPEKMLEQAIRDMESELAKARQALAQAIARQKQLERKLEEAQARAEKLEEK-AELALQAGNE----DLAREALEEKQ- 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  691 DLSELREASEQTQTKFKsekQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKkksAQERCQ----------AEAEMD 760
Cdd:COG1842    96 SLEDLAKALEAELQQAE---EQVEKLKKQLAALEQKIAELRAKKEALKARKAAAK---AQEKVNrslgggssssAMAAFE 169
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 568926925  761 EIRKShQEELDRLRQLLKKARVSTDQAAAEQltLAQAELQSQWEAKCEQLLASAR 815
Cdd:COG1842   170 RMEEK-IEEREARAEAAAELAEGSGDDLDKE--FAQAGAQSAVDSRLAALKARMK 221
TPR_MLP1_2 pfam07926
TPR/MLP1/MLP2-like protein; The sequences featured in this family are similar to a region of ...
632-739 1.62e-05

TPR/MLP1/MLP2-like protein; The sequences featured in this family are similar to a region of human TPR protein and to yeast myosin-like proteins 1 (MLP1) and 2 (MLP2). These proteins share a number of features; for example, they all have coiled-coil regions and all three are associated with nuclear pores. TPR is thought to be a component of nuclear pore complex- attached intra-nuclear filaments, and is implicated in nuclear protein import. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerization of kinase domains or by targeting these kinases to the nuclear pore complex. MLP1 and MLP2 are involved in the process of telomere length regulation, where they are thought to interact with proteins such as Tel1p and modulate their activity.


Pssm-ID: 400329 [Multi-domain]  Cd Length: 129  Bit Score: 45.68  E-value: 1.62e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   632 AEQEKAKVTEELAAATAQVSHLQLKM--------TAHQKKETELQLQLTDnLKETDLLRGHVTRLQADLSELREASEQTQ 703
Cdd:pfam07926    6 LESEIKRLKEEAEDAEAQLQKLQEDLekqaeiakEAQQNYERELVLHAED-IKALQALREELNELKAEIAELKAEAESAK 84
                           90       100       110
                   ....*....|....*....|....*....|....*.
gi 568926925   704 TKFKSEKQSrrqLELKVTSLEEELTDLRAEKTSLEK 739
Cdd:pfam07926   85 AELEESEES---WEEQKERLEKELSELEKRIEDLNE 117
CAGE1 pfam15066
Cancer-associated gene protein 1 family; CAGE-1 is a family of proteins overexpressed in tumor ...
573-752 1.91e-05

Cancer-associated gene protein 1 family; CAGE-1 is a family of proteins overexpressed in tumor tissues compared with surrounding tissues. CAGE-1 gene showed testis-specific expression among normal tissues and displayed wide expression in a variety of cancer cell lines and cancer tissues. CAGE-1 is predominantly expressed during post-meiotic stages. It localizes to the acrosomal matrix and acrosomal granule showing it to be a component of the acrosome of mammalian spermatids and spermatozoa.


Pssm-ID: 405712  Cd Length: 528  Bit Score: 48.67  E-value: 1.91e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   573 ERLKQELLEKSSR-------IEEQNDKISDLIErnqryvEQSNLMMEKR--NNSLQTATE---NTQARILHAEQEKAKVT 640
Cdd:pfam15066  345 EKKVKELQMKITKqqvfvdiINKLKENVEELIE------DKYNVILEKNdiNKTLQNLQEilaNTQKHLQESRKEKETLQ 418
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   641 EELAAATAQVSHLQLK-MTAHQKKETE----LQLQLTDNLKEtdllrGHVTRLQADLSELREASEQTQTKFKSEKQSRRQ 715
Cdd:pfam15066  419 LELKKIKVNYVHLQERyITEMQQKNKSvsqcLEMDKTLSKKE-----EEVERLQQLKGELEKATTSALDLLKREKETREQ 493
                          170       180       190
                   ....*....|....*....|....*....|....*...
gi 568926925   716 LELkvtSLEEELTdlRAEKtsleKNLSERKK-KSAQER 752
Cdd:pfam15066  494 EFL---SLQEEFQ--KHEK----ENLEERQKlKSRLEK 522
SMC_N pfam02463
RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The ...
569-867 1.95e-05

RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.


Pssm-ID: 308206 [Multi-domain]  Cd Length: 1162  Bit Score: 49.20  E-value: 1.95e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   569 IQENERLKqELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTatentqarilhaeqekakvtEELAAATA 648
Cdd:pfam02463  170 RKKKEALK-KLIEETENLAELIIDLEELKLQELKLKEQAKKALEYYQLKEKL--------------------ELEEEYLL 228
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   649 QVSHLQLkmtaHQKKETELQLQLTDNLKETDLLRGhvtrlqadLSELREASEQTQTKFKSEkqsrrqlELKVTSLEEE-- 726
Cdd:pfam02463  229 YLDYLKL----NEERIDLLQELLRDEQEEIESSKQ--------EIEKEEEKLAQVLKENKE-------EEKEKKLQEEel 289
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   727 -LTDLRAEKTSLEKNLSERKKKSAQErcQAEAEMDEIRKsHQEELDRLRQLLKKARVS-TDQAAAEQLTLAQAELQSQWE 804
Cdd:pfam02463  290 kLLAKEEEELKSELLKLERRKVDDEE--KLKESEKEKKK-AEKELKKEKEEIEELEKElKELEIKREAEEEEEEELEKLQ 366
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 568926925   805 AKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFtEQKEHMQRLEKTK 867
Cdd:pfam02463  367 EKLEQLEEELLAKKKLESERLSSAAKLKEEELELKSEEEKEAQLLLELA-RQLEDLLKEEKKE 428
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
629-881 2.50e-05

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 48.18  E-value: 2.50e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  629 ILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-EASEQTQTKFK 707
Cdd:COG4942    26 VLAAAFSAAADDKQLKQIQKEIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADDLKKLRkQIADLNARLNA 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  708 SEKQSRRQLELkvtsLEEELTDLR--AEKTSLEKNLSErkkKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTD 785
Cdd:COG4942   106 LEVQEREQRRR----LAEQLAALQrsGRNPPPALLVSP---EDAQRSVRLAIYYGALNPARAERIDALKATLKQLAAVRA 178
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  786 QAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRevcAQRDAHQQKLALLQDECLALQAQIAafteqkehmqRLEK 865
Cdd:COG4942   179 EIAAEQAELTTLLSEQRAQQAKLAQLLEERKKTLAQLN---SELSADQKKLEELRANESRLKNEIA----------SAEA 245
                         250
                  ....*....|....*.
gi 568926925  866 TKSQAPAGRAAADPSE 881
Cdd:COG4942   246 AAAKAREAAAAAEAAA 261
ATG16 pfam08614
Autophagy protein 16 (ATG16); Autophagy is a ubiquitous intracellular degradation system for ...
595-773 3.49e-05

Autophagy protein 16 (ATG16); Autophagy is a ubiquitous intracellular degradation system for eukaryotic cells. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. ATG16 (also known as Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate in the yeast autophagy pathway.


Pssm-ID: 400781 [Multi-domain]  Cd Length: 176  Bit Score: 45.69  E-value: 3.49e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   595 DLIERNQRYVEQSNLMmEKRNNSLQTATENTQARILHAEQEKAKVTEE-LAAATAQVSHLQLKMTAHQKKETELQLQLTD 673
Cdd:pfam08614    4 ELIDAYNRLLDRTALL-EAENAKLQSEPESVPPSTSSSLASASPVQSAsIQSLEQKLAQLREELAELYRSRGELAQQLVD 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   674 nlketdllrghvtrLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEEL-------TDLRAEKTSLEKNLSerkk 746
Cdd:pfam08614   83 --------------LNEELQELESELREDERRLAELEAERAQLEEKLRDREEELrekrklnQDLQDELVALQLQLN---- 144
                          170       180
                   ....*....|....*....|....*..
gi 568926925   747 ksaqercQAEAEMDEIRKSHQEELDRL 773
Cdd:pfam08614  145 -------MAEEKLRKLEKENRELVERW 164
PspC_subgroup_1 NF033838
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ...
561-999 3.56e-05

pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.


Pssm-ID: 411407 [Multi-domain]  Cd Length: 684  Bit Score: 48.08  E-value: 3.56e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  561 IMSNIQRIIQEnerlKQELLEKSSRIEEQ--NDKISDLierNQRYVEQSNLMMEKRNNSLQTAT-ENTQARILHAEQEKA 637
Cdd:NF033838   63 VESHLEKILSE----IQKSLDKRKHTQNValNKKLSDI---KTEYLYELNVLKEKSEAELTSKTkKELDAAFEQFKKDTL 135
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  638 KVTEELAAATAQVSHLQLKmtAHQKKETELQLQLTDNLK--ETDLLRGHVTRLQADLSELREASEQTQtkfksEKQSRRQ 715
Cdd:NF033838  136 EPGKKVAEATKKVEEAEKK--AKDQKEEDRRNYPTNTYKtlELEIAESDVEVKKAELELVKEEAKEPR-----DEEKIKQ 208
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  716 LELKVTSLEEELTDLRAEKTSLEKnlSERKKKSAQERCQAEAEMDEIRKSHQEELDRL--RQLL----------KKARvS 783
Cdd:NF033838  209 AKAKVESKKAEATRLEKIKTDREK--AEEEAKRRADAKLKEAVEKNVATSEQDKPKRRakRGVLgepatpdkkeNDAK-S 285
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  784 TDQAAAEQlTLAQAELqsqweaKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAqiaAFTEQKEHMQRL 863
Cdd:NF033838  286 SDSSVGEE-TLPSPSL------KPEKKVAEAEKKVEEAKKKAKDQKEEDRRNYPTNTYKTLELEI---AESDVKVKEAEL 355
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  864 EKTKSQAPAGRAaadpSEKVKKIMNQVfQSLRGEfeleesydgGTILRTIMHTIKMVTLQLLNHQEEEEEEEEEEEEEKK 943
Cdd:NF033838  356 ELVKEEAKEPRN----EEKIKQAKAKV-ESKKAE---------ATRLEKIKTDRKKAEEEAKRKAAEEDKVKEKPAEQPQ 421
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 568926925  944 PL---RPSLEQPGPATPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPENGAQ 999
Cdd:NF033838  422 PApapQPEKPAPKPEKPAEQPKAEKPADQQAEEDYARRSEEEYNRLTQQQPPKTEKPAQ 480
46 PHA02562
endonuclease subunit; Provisional
509-747 3.81e-05

endonuclease subunit; Provisional


Pssm-ID: 222878 [Multi-domain]  Cd Length: 562  Bit Score: 47.70  E-value: 3.81e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  509 EARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMetsmiMSNIQRIIQENERLKQELLEKSSRIEE 588
Cdd:PHA02562  178 ELNQQIQTLDMKIDHIQQQIKTYNKNIEEQRKKNGENIARKQNKYDEL-----VEEAKTIKAEIEELTDELLNLVMDIED 252
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  589 QNDKISDLierNQRYVEQSNLM--------MEKRNNSLQTATENtqariLHAEQEK-AKVTEELAAATAQVShlqlKMTA 659
Cdd:PHA02562  253 PSAALNKL---NTAAAKIKSKIeqfqkvikMYEKGGVCPTCTQQ-----ISEGPDRiTKIKDKLKELQHSLE----KLDT 320
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  660 HQKKETELQLQLTDNLKEtdllrghVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEK 739
Cdd:PHA02562  321 AIDELEEIMDEFNEQSKK-------LLELKNKISTNKQSLITLVDKAKKVKAAIEELQAEFVDNAEELAKLQDELDKIVK 393

                  ....*...
gi 568926925  740 NLSERKKK 747
Cdd:PHA02562  394 TKSELVKE 401
WEMBL pfam05701
Weak chloroplast movement under blue light; WEMBL consists of several plant proteins required ...
632-903 4.26e-05

Weak chloroplast movement under blue light; WEMBL consists of several plant proteins required for the chloroplast avoidance response under high intensity blue light. This avoidance response consists in the relocation of chloroplasts on the anticlinal side of exposed cells. Acts in association with PMI2 to maintain the velocity of chloroplast photo-relocation movement via the regulation of cp-actin filaments. Thus several member-sequences are described as "myosin heavy chain-like".


Pssm-ID: 399015 [Multi-domain]  Cd Length: 562  Bit Score: 47.70  E-value: 4.26e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   632 AEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQlqltdnlKETDLLRGHVTRLQADLSElrEASEQTQTKFKSEKQ 711
Cdd:pfam05701   61 AEAAKSQVLEELESTKRLIEELKLNLEKAQTEEAQAK-------QDSELAKLRVEEMEQGIAD--EASVAAKAQLEVAKA 131
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   712 SRRQLELKVTSLEEELTDLRAEKTSL--EKNLSERKkksAQErcqAEAEMDEIRKSHQE---ELDRLRQLLKKARVSTDQ 786
Cdd:pfam05701  132 RHAAAVAELKSVKEELESLQKEYASLvsERDIAIKR---AEE---AVSASKEIEKTVEEltiELIATKESLESAHAAHLE 205
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925   787 AAAEQLTLAQAELQ--SQWEAKCEQLlasarDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK-----EH 859
Cdd:pfam05701  206 AEEHRIGAALAREQdkLNWEKELKQA-----EEELQRLNQQLLSAKDLKSKLETASALLLDLKAELAAYMESKlkeeaSE 280
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 568926925   860 MQRLEKTKSQAPAGRAAADPS-EKVK----------KIMNQVFQSLRGEFELEES 903
Cdd:pfam05701  281 EGEEKKTSTSIQAALASARKElEEVKaniekakdevKCLKVAAASLRSELEKEKA 335
PTZ00121 PTZ00121
MAEBL; Provisional
509-902 4.39e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 48.21  E-value: 4.39e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  509 EARQHNTEIRM-AVNKV--ADKMDHLMTKVEELQKHSSGNSMLLPSMSVtmetsmiMSNIQRIIQENERLKQELLEKSsr 585
Cdd:PTZ00121 1216 EARKAEDAKKAeAVKKAeeAKKDAEEAKKAEEERNNEEIRKFEEARMAH-------FARRQAAIKAEEARKADELKKA-- 1286
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  586 ieEQNDKISDLIERNQ-RYVEQSNLMME--KRNNSLQTATENTQ--ARILHAEQEKAKVTEELAAATAQVSHLQLKMTAH 660
Cdd:PTZ00121 1287 --EEKKKADEAKKAEEkKKADEAKKKAEeaKKADEAKKKAEEAKkkADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEE 1364
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  661 QKKETELQlqltdnlKETDLLRGHVTRLQADlsELREASEqtqTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKN 740
Cdd:PTZ00121 1365 KAEAAEKK-------KEEAKKKADAAKKKAE--EKKKADE---AKKKAEEDKKKADELKKAAAAKKKADEAKKKAEEKKK 1432
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  741 LSERKKKSAQERCQAEA--EMDEIRKSHQ-----EELDRLRQLLKKA----RVSTDQAAAEQLTLAQAELQSQWEA--KC 807
Cdd:PTZ00121 1433 ADEAKKKAEEAKKADEAkkKAEEAKKAEEakkkaEEAKKADEAKKKAeeakKADEAKKKAEEAKKKADEAKKAAEAkkKA 1512
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  808 EQLLASARDEHLQQYREVCAQRDAHQQKLAllQDECLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADPSEKVKKIM 887
Cdd:PTZ00121 1513 DEAKKAEEAKKADEAKKAEEAKKADEAKKA--EEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAE 1590
                         410
                  ....*....|....*
gi 568926925  888 NQVFQSLRGEFELEE 902
Cdd:PTZ00121 1591 EARIEEVMKLYEEEK 1605
mukB PRK04863
chromosome partition protein MukB;
573-856 5.11e-05

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 47.64  E-value: 5.11e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  573 ERLKQELLEKSSRIEEQN---DKISDLIERNQRYVEQSNLMMEKRNNSL---QTATENTQARIL---HAEQ--EKAKVTE 641
Cdd:PRK04863  351 ERYQADLEELEERLEEQNevvEEADEQQEENEARAEAAEEEVDELKSQLadyQQALDVQQTRAIqyqQAVQalERAKQLC 430
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  642 ELAAATA-QVSHLQLKMTAHQKKETELQLQLTDNLKETD-----------LLR---GHVTR------------------- 687
Cdd:PRK04863  431 GLPDLTAdNAEDWLEEFQAKEQEATEELLSLEQKLSVAQaahsqfeqayqLVRkiaGEVSRseawdvarellrrlreqrh 510
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568926925  688 -------LQADLSELREASEQTQTKFKSEKQSRRQLELKVTSlEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAemd 760
Cdd:PRK04863  511 laeqlqqLRMRLSELEQRLRQQQRAERLLAEFCKRLGKNLDD-EDELEQLQEELEARLESLSESVSEARERRMALRQ--- 586
                         250       260       2