NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568931356|ref|XP_006538984|]
View 

leucine zipper protein 1 isoform X1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Smc super family cl34174
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
19-354 1.90e-14

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


The actual alignment was detected with superfamily member COG1196:

Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 78.22  E-value: 1.90e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   19 KLQSLSRRLDELEEATKNLQRAEDELLDLQDKviqaegsdsstLAEIEVLRQRVL--KIEGKDEEIKRAEDlchtmkekl 96
Cdd:COG1196   187 NLERLEDLLEELEKQLEKLERQAEKAERYQEL-----------KAELRELELALLlaKLKELRKELEELEE--------- 246
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   97 eEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTE 176
Cdd:COG1196   247 -ELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEERL 325
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  177 QSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHM---RNASTFLERNDLRIEDGISSTLSS 253
Cdd:COG1196   326 EELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFealREELAELEAELAEIRNELEELKRE 405
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  254 KESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNR 333
Cdd:COG1196   406 IESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRLEKELSS 485
                         330       340
                  ....*....|....*....|.
gi 568931356  334 NRSLASQLEEIKLQVRKQKEL 354
Cdd:COG1196   486 LEARLDRLEAEQRASQGVRAV 506
 
Name Accession Description Interval E-value
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
19-354 1.90e-14

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 78.22  E-value: 1.90e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   19 KLQSLSRRLDELEEATKNLQRAEDELLDLQDKviqaegsdsstLAEIEVLRQRVL--KIEGKDEEIKRAEDlchtmkekl 96
Cdd:COG1196   187 NLERLEDLLEELEKQLEKLERQAEKAERYQEL-----------KAELRELELALLlaKLKELRKELEELEE--------- 246
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   97 eEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTE 176
Cdd:COG1196   247 -ELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEERL 325
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  177 QSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHM---RNASTFLERNDLRIEDGISSTLSS 253
Cdd:COG1196   326 EELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFealREELAELEAELAEIRNELEELKRE 405
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  254 KESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNR 333
Cdd:COG1196   406 IESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRLEKELSS 485
                         330       340
                  ....*....|....*....|.
gi 568931356  334 NRSLASQLEEIKLQVRKQKEL 354
Cdd:COG1196   486 LEARLDRLEAEQRASQGVRAV 506
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
104-353 4.18e-12

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 70.48  E-value: 4.18e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  104 RELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSEL 183
Cdd:PRK03918  172 KEIKRRIERLEKFIKRTENIEELIKEKEKELEEVLREINEISSELPELREELEKLEKEVKELEELKEEIEELEKELESLE 251
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  184 EKLKSLTLSFVNERKYLNEKEKEN---EKIIKELTQ---------KLEQNKKMNRDHMRNASTFLERNDLRIEdGISSTL 251
Cdd:PRK03918  252 GSKRKLEEKIRELEERIEELKKEIeelEEKVKELKElkekaeeyiKLSEFYEEYLDELREIEKRLSRLEEEIN-GIEERI 330
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  252 SSKESKrKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHF--ESLEEELKKMRAKNNDLQDNYLT 329
Cdd:PRK03918  331 KELEEK-EERLEELKKKLKELEKRLEELEERHELYEEAKAKKEELERLKKRLTGLtpEKLEKELEELEKAKEEIEEEISK 409
                         250       260
                  ....*....|....*....|....
gi 568931356  330 ELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:PRK03918  410 ITARIGELKKEIKELKKAIEELKK 433
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
103-362 1.74e-10

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 65.47  E-value: 1.74e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   103 TRELKSEIERLQKRMVDLEKLEEAL----SRSKNECSQLCLSLNEERNLTKKISSELEML---RVKVKE-LESSEDRLDK 174
Cdd:TIGR02169  669 SRSEPAELQRLRERLEGLKRELSSLqselRRIENRLDELSQELSDASRKIGEIEKEIEQLeqeEEKLKErLEELEEDLSS 748
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   175 TEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKkmnRDHMRNASTFLERNDLRIEDgISSTLSSK 254
Cdd:TIGR02169  749 LEQEIENVKSELKELEARIEELEEDLHKLEEALNDLEARLSHSRIPEI---QAELSKLEEEVSRIEARLRE-IEQKLNRL 824
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   255 ESKRKGSLDYLKQVENETRDKSENEKNRNQE----DNKVKDLNQEIEKLKTQIKHFES----LEEELKKMRAKNNDLQDN 326
Cdd:TIGR02169  825 TLEKEYLEKEIQELQEQRIDLKEQIKSIEKEienlNGKKEELEEELEELEAALRDLESrlgdLKKERDELEAQLRELERK 904
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|.
gi 568931356   327 Y---LTELNRNRSLASQLEEiKLQVRKQ--KELGNGDIEGE 362
Cdd:TIGR02169  905 IeelEAQIEKKRKRLSELKA-KLEALEEelSEIEDPKGEDE 944
SMC_N pfam02463
RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The ...
61-353 4.71e-07

RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.


Pssm-ID: 308206 [Multi-domain]  Cd Length: 1162  Bit Score: 54.21  E-value: 4.71e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    61 TLAEIEVLRQRVLKIEGKDEEIKRAEDlchtmKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLS 140
Cdd:pfam02463  175 ALKKLIEETENLAELIIDLEELKLQEL-----KLKEQAKKALEYYQLKEKLELEEEYLLYLDYLKLNEERIDLLQELLRD 249
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   141 LNEERNLTKKI---SSELEMLRVKVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQK 217
Cdd:pfam02463  250 EQEEIESSKQEiekEEEKLAQVLKENKEEEKEKKLQEEELKLLAKEEEELKSELLKLERRKVDDEEKLKESEKEKKKAEK 329
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   218 LEQNKKMNRDHMRNASTFLERNDLRIEDGISSTLSS--KESKRKGSLDYLKQVENETRDKSENEKN-----RNQEDNKVK 290
Cdd:pfam02463  330 ELKKEKEEIEELEKELKELEIKREAEEEEEEELEKLqeKLEQLEEELLAKKKLESERLSSAAKLKEeelelKSEEEKEAQ 409
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 568931356   291 DLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:pfam02463  410 LLLELARQLEDLLKEEKKEELEILEEEEESIELKQGKLTEEKEELEKQELKLLKDELELKKSE 472
Spc7 smart00787
Spc7 kinetochore protein; This domain is found in cell division proteins which are required ...
262-346 4.64e-03

Spc7 kinetochore protein; This domain is found in cell division proteins which are required for kinetochore-spindle association.


Pssm-ID: 197874 [Multi-domain]  Cd Length: 312  Bit Score: 40.39  E-value: 4.64e-03
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    262 LDYLKQVENETRDKSENEKNRNQEdnKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNrnrSLASQL 341
Cdd:smart00787  188 LRQLKQLEDELEDCDPTELDRAKE--KLKKLLQEIMIKVKKLEELEEELQELESKIEDLTNKKSELNTEIA---EAEKKL 262

                    ....*
gi 568931356    342 EEIKL 346
Cdd:smart00787  263 EQCRG 267
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
74-312 9.99e-03

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 39.89  E-value: 9.99e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   74 KIEGKDEEIKRAEDLCHTMKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISS 153
Cdd:NF033930   64 KKKAEDAQKKYDEDQKKTEEKAKKEKKASEEEQKANLAVQKAYVKYRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKA 143
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  154 ELEMLRVKV----KELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELT-------------Q 216
Cdd:NF033930  144 EFNKVRAKVvpeaEELAETKKKAEEAKAEEPVAKKKVDEAKKKVEEAKKKVEAEEAEIEKLQNEEValeakiaelenqvD 223
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  217 KLEQN-KKMNRDHMRNASTFLERNDLRIE-DGISSTLSSKESKRKGSLDYLKQvENETRDKSENEKNRNQEDNKVKDLNQ 294
Cdd:NF033930  224 NLEKElAEIDESDSEDYIKEGLRAPLESElDAKQAKLAKKQTELEKLLDSLDP-EGKTQDELDKEAAEEELSKKIDELDN 302
                         250
                  ....*....|....*...
gi 568931356  295 EIEKLKTQIKHFESLEEE 312
Cdd:NF033930  303 EVAKLEKEVSDLENSDNN 320
 
Name Accession Description Interval E-value
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
19-354 1.90e-14

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 78.22  E-value: 1.90e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   19 KLQSLSRRLDELEEATKNLQRAEDELLDLQDKviqaegsdsstLAEIEVLRQRVL--KIEGKDEEIKRAEDlchtmkekl 96
Cdd:COG1196   187 NLERLEDLLEELEKQLEKLERQAEKAERYQEL-----------KAELRELELALLlaKLKELRKELEELEE--------- 246
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   97 eEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTE 176
Cdd:COG1196   247 -ELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEERL 325
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  177 QSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHM---RNASTFLERNDLRIEDGISSTLSS 253
Cdd:COG1196   326 EELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFealREELAELEAELAEIRNELEELKRE 405
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  254 KESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNR 333
Cdd:COG1196   406 IESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRLEKELSS 485
                         330       340
                  ....*....|....*....|.
gi 568931356  334 NRSLASQLEEIKLQVRKQKEL 354
Cdd:COG1196   486 LEARLDRLEAEQRASQGVRAV 506
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
14-351 2.21e-13

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 74.75  E-value: 2.21e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   14 RHLRFKLQSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVL-KIEGKDEEIKRAEDLCHTM 92
Cdd:COG1196   691 KSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEeELEELQERLEELEEELESL 770
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   93 KEKLEEEENLTRELKSEIERLQKRmvdLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRL 172
Cdd:COG1196   771 EEALAKLKEEIEELEEKRQALQEE---LEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDEL 847
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  173 DKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQnkkmnrdhmrnastfLERNDLRIEDGISSTLS 252
Cdd:COG1196   848 EEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRE---------------LESELAELKEEIEKLRE 912
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  253 SKESKRKgsldyLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFE-----SLEE--ELKKMRAKNNDLQD 325
Cdd:COG1196   913 RLEELEA-----KLERLEVELPELEEELEEEYEDTLETELEREIERLEEEIEALGpvnlrAIEEyeEVEERYEELKSQRE 987
                         330       340
                  ....*....|....*....|....*.
gi 568931356  326 NYLTELNRNRSLASQLEEIKLQVRKQ 351
Cdd:COG1196   988 DLEEAKEKLLEVIEELDKEKRERFKE 1013
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
104-379 3.41e-13

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 74.37  E-value: 3.41e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  104 RELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSEL 183
Cdd:COG1196   667 RELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEEL 746
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  184 EKLKS---LTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHMRNASTFLERNDLRiedgISSTLSSKESKRKG 260
Cdd:COG1196   747 EELEEeleELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERR----LDALERELESLEQR 822
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  261 SLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFE----SLEEELKKMRAKNNDLQdnyltelNRNRS 336
Cdd:COG1196   823 RERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEaekeELEDELKELEEEKEELE-------EELRE 895
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|...
gi 568931356  337 LASQLEEIKLQVRKQKELGNgDIEGEDAFLLGRGRHERTKLKG 379
Cdd:COG1196   896 LESELAELKEEIEKLRERLE-ELEAKLERLEVELPELEEELEE 937
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
7-356 1.04e-12

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 72.44  E-value: 1.04e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    7 YKDAASNRHLRFKLQSLSRRLDELEEatkNLQRAEDELLDLQDKVIQAEGsdsstlaEIEVLRQRVLKIEGKDEEIKRAE 86
Cdd:COG1196   656 SRNKRSSLAQKRELKELEEELAELEA---QLEKLEEELKSLKNELRSLED-------LLEELRRQLEELERQLEELKREL 725
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   87 dlchtmkekleeeenltRELKSEIERLQKRmvdLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELE 166
Cdd:COG1196   726 -----------------AALEEELEQLQSR---LEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELE 785
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  167 SSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKmnrdhmrnastflERNDLRIEdg 246
Cdd:COG1196   786 EKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEE-------------KLDELEEE-- 850
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  247 ISSTLSSKESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIK----HFESLEEELKKMRAKNND 322
Cdd:COG1196   851 LEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEklreRLEELEAKLERLEVELPE 930
                         330       340       350
                  ....*....|....*....|....*....|....
gi 568931356  323 LQDNYLTELNRNRSLASQlEEIKLQVRKQKELGN 356
Cdd:COG1196   931 LEEELEEEYEDTLETELE-REIERLEEEIEALGP 963
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
104-353 4.18e-12

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 70.48  E-value: 4.18e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  104 RELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSEL 183
Cdd:PRK03918  172 KEIKRRIERLEKFIKRTENIEELIKEKEKELEEVLREINEISSELPELREELEKLEKEVKELEELKEEIEELEKELESLE 251
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  184 EKLKSLTLSFVNERKYLNEKEKEN---EKIIKELTQ---------KLEQNKKMNRDHMRNASTFLERNDLRIEdGISSTL 251
Cdd:PRK03918  252 GSKRKLEEKIRELEERIEELKKEIeelEEKVKELKElkekaeeyiKLSEFYEEYLDELREIEKRLSRLEEEIN-GIEERI 330
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  252 SSKESKrKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHF--ESLEEELKKMRAKNNDLQDNYLT 329
Cdd:PRK03918  331 KELEEK-EERLEELKKKLKELEKRLEELEERHELYEEAKAKKEELERLKKRLTGLtpEKLEKELEELEKAKEEIEEEISK 409
                         250       260
                  ....*....|....*....|....
gi 568931356  330 ELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:PRK03918  410 ITARIGELKKEIKELKKAIEELKK 433
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
3-353 2.22e-11

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 68.25  E-value: 2.22e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    3 ELTNYKDAASNRHLRFKLQSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLrqrvlkIEGKDEEI 82
Cdd:COG0419   217 KLEEIQEEQEEEELEQEIEALEERLAELEEEKERLEELKARLLEIESLELEALKIREEELRELERL------LEELEEKI 290
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   83 KRAEDLchtmkekleeeENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKV 162
Cdd:COG0419   291 ERLEEL-----------EREIEELEEELEGLRALLEELEELLEKLKSLEERLEKLEEKLEKLESELEELAEEKNELAKLL 359
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  163 KELESS-EDRLDKTEQSLVSELE--------------KLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRD 227
Cdd:COG0419   360 EERLKElEERLEELEKELEKALErlkqleeaiqelkeELAELSAALEEIQEELEELEKELEELERELEELEEEIKKLEEQ 439
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  228 HMRNASTFLERNDLRIEDGISSTLSSK--ESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKH 305
Cdd:COG0419   440 INQLESKELMIAELAGAGEKCPVCGQElpEEHEKELLELYELELEELEEELSREKEEAELREEIEELEKELRELEEELIE 519
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 568931356  306 --------FESLEEELKKMRAKNNDLQDNYL-TELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:COG0419   520 lleleealKEELEEKLEKLENLLEELEELKEkLQLQQLKEELRQLEDRLQELKELLE 576
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
19-356 2.50e-11

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 67.86  E-value: 2.50e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   19 KLQSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDS---------STLAEIEVLRQRVLKIEGKDEEIKRAEDLC 89
Cdd:COG0419   418 ELEELERELEELEEEIKKLEEQINQLESKELMIAELAGAGEkcpvcgqelPEEHEKELLELYELELEELEEELSREKEEA 497
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   90 HTMKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLslNEERNLTKKISSELEMLRVKVKELESSE 169
Cdd:COG0419   498 ELREEIEELEKELRELEEELIELLELEEALKEELEEKLEKLENLLEELEE--LKEKLQLQQLKEELRQLEDRLQELKELL 575
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  170 DRLDKTEQSLvSELEKLksltlsfvnerkylNEKEKENEKIIKELTQKLEQ-NKKMNRDHMRNASTFLERNDLRIEDgIS 248
Cdd:COG0419   576 EELRLLRTRK-EELEEL--------------RERLKELKKKLKELEERLSQlEELLQSLELSEAENELEEAEEELES-EL 639
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  249 STLSSKESKRKGSLDYLKQVEN---ETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQD 325
Cdd:COG0419   640 EKLNLQAELEELLQAALEELEEkveELEAEIRRELQRIENEEQLEEKLEELEQLEEELEQLREELEELLKKLGEIEQLIE 719
                         330       340       350
                  ....*....|....*....|....*....|.
gi 568931356  326 NYLTELNRNRSLASQLEEIKLQVRKQKELGN 356
Cdd:COG0419   720 ELESRKAELEELKKELEKLEKALELLEELRE 750
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
28-360 2.96e-11

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 67.82  E-value: 2.96e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   28 DELEEATKNLQRAEDELLDLQDKviqaegsdsstlaeIEVLRQRVLKIEgkdEEIKRAEDlchtmkekleeeenlTRELK 107
Cdd:COG1196   172 ERKEEAERKLERTEENLERLEDL--------------LEELEKQLEKLE---RQAEKAER---------------YQELK 219
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  108 SEIERLQKRMV--DLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSELEK 185
Cdd:COG1196   220 AELRELELALLlaKLKELRKELEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEE 299
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  186 LKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMnrdhmrnastFLERNDLRIE-----DGISSTLSSKESKRKG 260
Cdd:COG1196   300 LEGEISLLRERLEELENELEELEERLEELKEKIEALKEE----------LEERETLLEEleqllAELEEAKEELEEKLSA 369
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  261 SLDYLKQVENETRDK-SENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNRNRSLAS 339
Cdd:COG1196   370 LLEELEELFEALREElAELEAELAEIRNELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELE 449
                         330       340
                  ....*....|....*....|.
gi 568931356  340 QLEEIKLQVRKQKELGNGDIE 360
Cdd:COG1196   450 ELEEQLEELRDRLKELERELA 470
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
103-362 1.74e-10

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 65.47  E-value: 1.74e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   103 TRELKSEIERLQKRMVDLEKLEEAL----SRSKNECSQLCLSLNEERNLTKKISSELEML---RVKVKE-LESSEDRLDK 174
Cdd:TIGR02169  669 SRSEPAELQRLRERLEGLKRELSSLqselRRIENRLDELSQELSDASRKIGEIEKEIEQLeqeEEKLKErLEELEEDLSS 748
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   175 TEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKkmnRDHMRNASTFLERNDLRIEDgISSTLSSK 254
Cdd:TIGR02169  749 LEQEIENVKSELKELEARIEELEEDLHKLEEALNDLEARLSHSRIPEI---QAELSKLEEEVSRIEARLRE-IEQKLNRL 824
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   255 ESKRKGSLDYLKQVENETRDKSENEKNRNQE----DNKVKDLNQEIEKLKTQIKHFES----LEEELKKMRAKNNDLQDN 326
Cdd:TIGR02169  825 TLEKEYLEKEIQELQEQRIDLKEQIKSIEKEienlNGKKEELEEELEELEAALRDLESrlgdLKKERDELEAQLRELERK 904
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|.
gi 568931356   327 Y---LTELNRNRSLASQLEEiKLQVRKQ--KELGNGDIEGE 362
Cdd:TIGR02169  905 IeelEAQIEKKRKRLSELKA-KLEALEEelSEIEDPKGEDE 944
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
28-345 1.93e-10

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 65.09  E-value: 1.93e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   28 DELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVLKIEGKDEEIKRAEDLCHTMKEKLEEEENLTRELK 107
Cdd:PRK03918  193 ELIKEKEKELEEVLREINEISSELPELREELEKLEKEVKELEELKEEIEELEKELESLEGSKRKLEEKIRELEERIEELK 272
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  108 SEIERLQKRMVDLEKLEE------ALSRSKNEcsqlclSLNEERNLTK---KISSELEMLRVKVKELESSEDRLDKTEQS 178
Cdd:PRK03918  273 KEIEELEEKVKELKELKEkaeeyiKLSEFYEE------YLDELREIEKrlsRLEEEINGIEERIKELEEKEERLEELKKK 346
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  179 LvSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHMRNASTFLERNDLRIEDGISStLSSKESKR 258
Cdd:PRK03918  347 L-KELEKRLEELEERHELYEEAKAKKEELERLKKRLTGLTPEKLEKELEELEKAKEEIEEEISKITARIGE-LKKEIKEL 424
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  259 KGSLDYLKQVENET----RDKSENEKnrnqeDNKVKDLNQEIEKLKTQIKHFESLEEELKKmRAKNNDLQDNYLTELNRN 334
Cdd:PRK03918  425 KKAIEELKKAKGKCpvcgRELTEEHR-----KELLEEYTAELKRIEKELKEIEEKERKLRK-ELRELEKVLKKESELIKL 498
                         330
                  ....*....|.
gi 568931356  335 RSLASQLEEIK 345
Cdd:PRK03918  499 KELAEQLKELE 509
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
27-348 2.05e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 65.12  E-value: 2.05e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   27 LDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVLKIegkDEEIKRAEdlchtmkekleeeenltrel 106
Cdd:COG1196   231 LAKLKELRKELEELEEELSRLEEELEELQEELEEAEKEIEELKSELEEL---REELEELQ-------------------- 287
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  107 kseiERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSELEKL 186
Cdd:COG1196   288 ----EELLELKEEIEELEGEISLLRERLEELENELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEEL 363
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  187 KSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHMRNASTFLERNDLRIEDgISSTLSSKESKRKGSLDYLK 266
Cdd:COG1196   364 EEKLSALLEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLERLSERLED-LKEELKELEAELEELQTELE 442
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  267 QVENETrdkSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNRNRSLASQLEEIKL 346
Cdd:COG1196   443 ELNEEL---EELEEQLEELRDRLKELERELAELQEELQRLEKELSSLEARLDRLEAEQRASQGVRAVLEALESGLPGVYG 519

                  ..
gi 568931356  347 QV 348
Cdd:COG1196   520 PV 521
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
14-314 2.18e-10

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 65.09  E-value: 2.18e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    14 RHLRFKLQSLSRRLDELEEATKNLQ----RAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVLKIEGKDEEIKRAEDLC 89
Cdd:TIGR02169  670 RSEPAELQRLRERLEGLKRELSSLQselrRIENRLDELSQELSDASRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSL 749
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    90 htmkekleeeENLTRELKSEIERLQKRmvdLEKLEEALSRSKNECSQLCLSLNEERnlTKKISSELEMLRVKVKELESSE 169
Cdd:TIGR02169  750 ----------EQEIENVKSELKELEAR---IEELEEDLHKLEEALNDLEARLSHSR--IPEIQAELSKLEEEVSRIEARL 814
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   170 DRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEqnkKMNRDhmrnastfLERNDLRIEDgiss 249
Cdd:TIGR02169  815 REIEQKLNRLTLEKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKE---ELEEE--------LEELEAALRD---- 879
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568931356   250 tLSSKESKRKgsldylKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIkhfESLEEELK 314
Cdd:TIGR02169  880 -LESRLGDLK------KERDELEAQLRELERKIEELEAQIEKKRKRLSELKAKL---EALEEELS 934
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
3-319 2.25e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 65.12  E-value: 2.25e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    3 ELTNYKDAASNRHLRFKLQSLSRRLDELEEATKNLQRAEDELL----DLQDKVIQAEGSDSSTLAEIEVLRQRVL----K 74
Cdd:COG1196   217 ELKAELRELELALLLAKLKELRKELEELEEELSRLEEELEELQeeleEAEKEIEELKSELEELREELEELQEELLelkeE 296
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   75 IEGKDEEIKRAEDLCHTMKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERnltkkiSSE 154
Cdd:COG1196   297 IEELEGEISLLRERLEELENELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKL------SAL 370
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  155 LEMLRVKVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKmnrdhmrnast 234
Cdd:COG1196   371 LEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQT----------- 439
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  235 flERNDLRIEdgisstLSSKESKRKGSLDYLKQVENETRDKSENEKNRNQEdnkVKDLNQEIEKLKTQIKHFESLEEELK 314
Cdd:COG1196   440 --ELEELNEE------LEELEEQLEELRDRLKELERELAELQEELQRLEKE---LSSLEARLDRLEAEQRASQGVRAVLE 508

                  ....*
gi 568931356  315 KMRAK 319
Cdd:COG1196   509 ALESG 513
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
104-410 2.73e-10

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 64.69  E-value: 2.73e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   104 RELKSEIERLQKRM--VDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVS 181
Cdd:TIGR02168  216 KELKAELRELELALlvLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALAN 295
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   182 ELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQnkkmnrdhmrnastfLERNDLRIEDGISSTLSSKESkrkgs 261
Cdd:TIGR02168  296 EISRLEQQKQILRERLANLERQLEELEAQLEELESKLDE---------------LAEELAELEEKLEELKEELES----- 355
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   262 ldyLKQVENETRDKSENEKNRNQE-DNKVKDLNQEIEKLKTQIkhfESLEEELKKMRAKNNDLQDNYLTELNRNRSLASQ 340
Cdd:TIGR02168  356 ---LEAELEELEAELEELESRLEElEEQLETLRSKVAQLELQI---ASLNNEIERLEARLERLEDRRERLQQEIEELLKK 429
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   341 LEEIKLQvRKQKELGNGDIEGEDAfllgRGRHERTKLKGHGSEASVSKHTSRELSPQHKRERLRNREFAL 410
Cdd:TIGR02168  430 LEEAELK-ELQAELEELEEELEEL----QEELERLEEALEELREELEEAEQALDAAERELAQLQARLDSL 494
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
30-350 3.93e-10

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 64.31  E-value: 3.93e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    30 LEEATKNLQRAED---------ELLDLQDKV------IQAEGSDSSTLAEIEVLRQRVLKIEGKDEEIKRAEDLCHTMKE 94
Cdd:TIGR02168  181 LERTRENLDRLEDilnelerqlKSLERQAEKaerykeLKAELRELELALLVLRLEELREELEELQEELKEAEEELEELTA 260
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    95 KLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERnltKKISSELEMLRVKVKELESSEDRLDK 174
Cdd:TIGR02168  261 ELQELEEKLEELRLEVSELEEEIEELQKELYALANEISRLEQQKQILRERL---ANLERQLEELEAQLEELESKLDELAE 337
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   175 TEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKmnrdhmRNASTFLERNDLRIEdgISSTLSSK 254
Cdd:TIGR02168  338 ELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRS------KVAQLELQIASLNNE--IERLEARL 409
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   255 ESKrKGSLDYLKQvENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNRN 334
Cdd:TIGR02168  410 ERL-EDRRERLQQ-EIEELLKKLEEAELKELQAELEELEEELEELQEELERLEEALEELREELEEAEQALDAAERELAQL 487
                          330
                   ....*....|....*.
gi 568931356   335 RSLASQLEEIKLQVRK 350
Cdd:TIGR02168  488 QARLDSLERLQENLEG 503
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
30-345 1.16e-09

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 62.47  E-value: 1.16e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   30 LEEATKNLQRAEDELLDLQ--DKVIQAEGSDSSTL-AEIEVLRQRV-LKIEGKDEEIKRAED-LCHTMKEKLEEEENLTR 104
Cdd:COG0419   149 LKSKPKERKEILDELFGLEkyEKLSELLKEVIKEAkAKIEELEGQLsELLEDIEDLLEALEEeLKELKKLEEIQEEQEEE 228
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  105 ELKSEIERLQKRMVDLEKLEEALSRSKNecsqlclslneerNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLvSELE 184
Cdd:COG0419   229 ELEQEIEALEERLAELEEEKERLEELKA-------------RLLEIESLELEALKIREEELRELERLLEELEEKI-ERLE 294
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  185 KLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDhMRNASTFLERNDLRIEDGiSSTLSSKESKRKGSLDY 264
Cdd:COG0419   295 ELEREIEELEEELEGLRALLEELEELLEKLKSLEERLEKLEEK-LEKLESELEELAEEKNEL-AKLLEERLKELEERLEE 372
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  265 L-KQVENETRDKSENEKNRNQEDNKVKDLNQEIEK----LKTQIKHFESLEEELKKMRAKNNDLQDnyltELNRNRSLAS 339
Cdd:COG0419   373 LeKELEKALERLKQLEEAIQELKEELAELSAALEEiqeeLEELEKELEELERELEELEEEIKKLEE----QINQLESKEL 448

                  ....*.
gi 568931356  340 QLEEIK 345
Cdd:COG0419   449 MIAELA 454
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
16-345 4.73e-09

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 60.46  E-value: 4.73e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   16 LRFKLQSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGsDSSTLAEIEVLRQRV--LKIEGKDEEIKRAEDLCHTMK 93
Cdd:PRK03918  319 LEEEINGIEERIKELEEKEERLEELKKKLKELEKRLEELEE-RHELYEEAKAKKEELerLKKRLTGLTPEKLEKELEELE 397
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   94 EKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSqLC---LSLNEERNLTKKISSELEMLRVKVKELESSED 170
Cdd:PRK03918  398 KAKEEIEEEISKITARIGELKKEIKELKKAIEELKKAKGKCP-VCgreLTEEHRKELLEEYTAELKRIEKELKEIEEKER 476
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  171 RLDKTEQSLVSELEKLKSLTlsfvnerkylneKEKENEKIIKELTQKLeqnKKMNRDHMRNASTFLE--RNDLRIEDGIS 248
Cdd:PRK03918  477 KLRKELRELEKVLKKESELI------------KLKELAEQLKELEEKL---KKYNLEELEKKAEEYEklKEKLIKLKGEI 541
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  249 STLSSKESKRKGSLDYLKQVENETRDKSENEKNRNQEDNK-----VKDLNQEIE----------KLKTQIKHFESLEEEL 313
Cdd:PRK03918  542 KSLKKELEKLEELKKKLAELEKKLDELEEELAELLKELEElgfesVEELEERLKelepfyneylELKDAEKELEREEKEL 621
                         330       340       350
                  ....*....|....*....|....*....|..
gi 568931356  314 KKMRAKNNDLQDNYLTELNRNRSLASQLEEIK 345
Cdd:PRK03918  622 KKLEEELDKAFEELAETEKRLEELRKELEELE 653
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
104-439 8.55e-09

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 59.73  E-value: 8.55e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  104 RELKSEIERLQKRMVDLEKLEEALSRSKNEcSQLCLSLNEERNLTkkissELEMLRVKVKELESSEDRLDKTEQSLVSEL 183
Cdd:COG1196   182 ERTEENLERLEDLLEELEKQLEKLERQAEK-AERYQELKAELREL-----ELALLLAKLKELRKELEELEEELSRLEEEL 255
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  184 EKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKK------MNRDHMRNASTFLERNDLRIEDGISSTLSSKESK 257
Cdd:COG1196   256 EELQEELEEAEKEIEELKSELEELREELEELQEELLELKEeieeleGEISLLRERLEELENELEELEERLEELKEKIEAL 335
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  258 RKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKhfESLEEELKKMRAKNNDLQDNyLTELNRNRSL 337
Cdd:COG1196   336 KEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFEALR--EELAELEAELAEIRNELEEL-KREIESLEER 412
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  338 ASQLEEIKLQVRKQKELGNGDIEGEDAFLLGRGRHERTKLKGHGSEASVSKHTSRELSP-QHKRERLRNREFALSNEHYS 416
Cdd:COG1196   413 LERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAElQEELQRLEKELSSLEARLDR 492
                         330       340
                  ....*....|....*....|...
gi 568931356  417 LSSKQASSPVFTNKRAAKASNMG 439
Cdd:COG1196   493 LEAEQRASQGVRAVLEALESGLP 515
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
19-353 1.15e-08

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 59.26  E-value: 1.15e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    19 KLQSLSRRLDELEEATKNLQRaedELLDLQDKVIQAEGSDSSTLAEIEVLRQRVLKIEGKdeeIKRAEDLCHTMKEKLEE 98
Cdd:TIGR04523  343 QISQLKKELTNSESENSEKQR---ELEEKQNEIEKLKKENQSYKQEIKNLESQINDLESK---IQNQEKLNQQKDEQIKK 416
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    99 EENLTRELKSEIERLQKrmvDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSedrLDKTEQS 178
Cdd:TIGR04523  417 LQQEKELLEKEIERLKE---TIIKNNSEIKDLTNQDSVKELIIKNLDNTRESLETQLKVLSRSINKIKQN---LEQKQKE 490
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   179 LVSELEKLKSLTlsfvNERKYLNEKEKENEKIIKELTQKLEQnkkmnrdhmrnastfLERNDLRIEDGISST----LSSK 254
Cdd:TIGR04523  491 LKSKEKELKKLN----EEKKELEEKVKDLTKKISSLKEKIEK---------------LESEKKEKESKISDLedelNKDD 551
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   255 ESKRKGSLDYLKQVENETRDKSENE-----KNRNQEDNKVKDLNQEIEKLKTQI----KHFESLEEELKKMRAKNNDLQD 325
Cdd:TIGR04523  552 FELKKENLEKEIDEKNKEIEELKQTqkslkKKQEEKQELIDQKEKEKKDLIKEIeekeKKISSLEKELEKAKKENEKLSS 631
                          330       340
                   ....*....|....*....|....*...
gi 568931356   326 NYLTELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:TIGR04523  632 IIKNIKSKKNKLKQEVKQIKETIKEIRN 659
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
7-315 3.34e-08

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 57.76  E-value: 3.34e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356     7 YKDAASNRHLRFKLQSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVLKIEGKDEEIKRAe 86
Cdd:TIGR02168  218 LKAELRELELALLVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALANE- 296
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    87 dlchtmkekleeeenlTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQlclSLNEERNLTKKISSELEMLRVKVKELE 166
Cdd:TIGR02168  297 ----------------ISRLEQQKQILRERLANLERQLEELEAQLEELES---KLDELAEELAELEEKLEELKEELESLE 357
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   167 SSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHMRNASTFLERNDLRIEDG 246
Cdd:TIGR02168  358 AELEELEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAELKE 437
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568931356   247 ISSTLsskESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKK 315
Cdd:TIGR02168  438 LQAEL---EELEEELEELQEELERLEEALEELREELEEAEQALDAAERELAQLQARLDSLERLQENLEG 503
PTZ00121 PTZ00121
MAEBL; Provisional
16-334 5.53e-08

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 57.46  E-value: 5.53e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   16 LRFKLQSLSRRLDELEEATKNLQRAeDELLDLQDKVIQAEGSDSSTLAEIEVLRqrvlkiegKDEEIKRAEDLCHTMKEK 95
Cdd:PTZ00121 1488 AKKKAEEAKKKADEAKKAAEAKKKA-DEAKKAEEAKKADEAKKAEEAKKADEAK--------KAEEKKKADELKKAEELK 1558
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   96 LEEEENLTRELKSEIERlqkRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSED----- 170
Cdd:PTZ00121 1559 KAEEKKKAEEAKKAEED---KNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAEEekkkv 1635
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  171 -RLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHMRNASTFLERNDLRI----ED 245
Cdd:PTZ00121 1636 eQLKKKEAEEKKKAEELKKAEEENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKAEELKKkeaeEK 1715
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  246 GISSTLSSKESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFES--LEEELKKMRAKNNDL 323
Cdd:PTZ00121 1716 KKAEELKKAEEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKKAEEIRKEKEavIEEELDEEDEKRRME 1795
                         330
                  ....*....|.
gi 568931356  324 QDNYLTELNRN 334
Cdd:PTZ00121 1796 VDKKIKDIFDN 1806
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
105-354 3.36e-07

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 54.26  E-value: 3.36e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   105 ELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSELE 184
Cdd:TIGR04523  156 KLNNKYNDLKKQKEELENELNLLEKEKLNIQKNIDKIKNKLLKLELLLSNLKKKIQKNKSLESQISELKKQNNQLKDNIE 235
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   185 KLKS----LTLSFVNERKYLNEKEKENEKIIKELTQK---LEQNKKMNRDhmrnastfLERNDLRIEDGISSTlssKESK 257
Cdd:TIGR04523  236 KKQQeineKTTEISNTQTQLNQLKDEQNKIKKQLSEKqkeLEQNNKKIKE--------LEKQLNQLKSEISDL---NNQK 304
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   258 RKGSLDYLK-QVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKK-MRAKNNDLQ------DNYLT 329
Cdd:TIGR04523  305 EQDWNKELKsELKNQEKKLEEIQNQISQNNKIISQLNEQISQLKKELTNSESENSEKQReLEEKQNEIEklkkenQSYKQ 384
                          250       260
                   ....*....|....*....|....*
gi 568931356   330 ELNrnrSLASQLEEIKLQVRKQKEL 354
Cdd:TIGR04523  385 EIK---NLESQINDLESKIQNQEKL 406
SMC_N pfam02463
RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The ...
61-353 4.71e-07

RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.


Pssm-ID: 308206 [Multi-domain]  Cd Length: 1162  Bit Score: 54.21  E-value: 4.71e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    61 TLAEIEVLRQRVLKIEGKDEEIKRAEDlchtmKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLS 140
Cdd:pfam02463  175 ALKKLIEETENLAELIIDLEELKLQEL-----KLKEQAKKALEYYQLKEKLELEEEYLLYLDYLKLNEERIDLLQELLRD 249
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   141 LNEERNLTKKI---SSELEMLRVKVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQK 217
Cdd:pfam02463  250 EQEEIESSKQEiekEEEKLAQVLKENKEEEKEKKLQEEELKLLAKEEEELKSELLKLERRKVDDEEKLKESEKEKKKAEK 329
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   218 LEQNKKMNRDHMRNASTFLERNDLRIEDGISSTLSS--KESKRKGSLDYLKQVENETRDKSENEKN-----RNQEDNKVK 290
Cdd:pfam02463  330 ELKKEKEEIEELEKELKELEIKREAEEEEEEELEKLqeKLEQLEEELLAKKKLESERLSSAAKLKEeelelKSEEEKEAQ 409
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 568931356   291 DLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:pfam02463  410 LLLELARQLEDLLKEEKKEELEILEEEEESIELKQGKLTEEKEELEKQELKLLKDELELKKSE 472
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
58-354 4.83e-07

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 53.99  E-value: 4.83e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    58 DSSTLAEIEVLRQRVLKIEGKDEEIKRAE-DLCHTmkekleeeenlTRELKSEIERLQKRmvdLEKLEEALSRSKNECSQ 136
Cdd:pfam12128  228 DIQAIARIMKVAPEIEKLQEDFEQLESLElKLSLL-----------HVELKADELRIATE---QEERQELKNELKSQLRT 293
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   137 LCLSLNEERN-LTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELT 215
Cdd:pfam12128  294 LEDELAEKIDeLNGRLSAADAALAAKRSELEALDDQKGAFQDDDIETLAADQEQLPSIQSELEEVEERLDALTGNHQDVT 373
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   216 QKLEQNKKmnrdhmrNASTFLERNDLRIEDGISSTLSSKESKRKGSLDYLKQVENETRDKSENEKNRNQEDNkvKDLNQE 295
Cdd:pfam12128  374 QKYERLKQ-------KISEELNRDLSGNKERLAKIREAKDRQLAAIEEVLQALESQLRHQLEQQKLEFNEEQ--YLLESR 444
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568931356   296 IEKLKTQIKHFESLEEELKKMRAKNN--DLQDNYLTELNRNRSlASQLEEIKLQVRKQKEL 354
Cdd:pfam12128  445 LGELKLQLNQATATPELLENIEQNDErlERAQEAQEQANASVE-AAQSELRQLRKRRDEAD 504
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
3-325 5.39e-07

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 53.91  E-value: 5.39e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356     3 ELTNYKDAAsnRHLRFKLQSLSRRLDELEE----ATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVLKIEGK 78
Cdd:TIGR02168  706 ELEELEEEL--EQLRKELEELSRQISALRKdlarLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAE 783
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    79 ----DEEIKRAEDLCHTMKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERnltKKISSE 154
Cdd:TIGR02168  784 ieelEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQIEELSEDI---ESLAAE 860
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   155 LEMLRVKVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQnkkmnrdhmrnAST 234
Cdd:TIGR02168  861 IEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREKLAQ-----------LEL 929
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   235 FLERNDLRIeDGISSTLSSKESKrkgSLDYLKQVENETRDKSENEKNRnqednkVKDLNQEIEKLK----TQIKHFESLE 310
Cdd:TIGR02168  930 RLEGLEVRI-DNLQERLSEEYSL---TLEEAEALENKIEDDEEEARRR------LKRLENKIKELGpvnlAAIEEYEELK 999
                          330
                   ....*....|....*
gi 568931356   311 EELKKMRAKNNDLQD 325
Cdd:TIGR02168 1000 ERYDFLTAQKEDLTE 1014
rad50 TIGR00606
rad50; All proteins in this family for which functions are known are involvedin recombination, ...
16-415 7.36e-07

rad50; All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).


Pssm-ID: 129694 [Multi-domain]  Cd Length: 1311  Bit Score: 53.51  E-value: 7.36e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    16 LRFKLQSLSRRLDELEEATKNLQRAEDELLDL---QDKVIQAEgsdsstLAEIEVLRQRVLKIEGKDEEIKRAEDLCHTM 92
Cdd:TIGR00606  700 LQSKLRLAPDKLKSTESELKKKEKRRDEMLGLapgRQSIIDLK------EKEIPELRNKLQKVNRDIQRLKNDIEEQETL 773
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    93 KEKLEEEENLTRELKSE---IERLQKRMVDLEKLEEALSrSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSE 169
Cdd:TIGR00606  774 LGTIMPEEESAKVCLTDvtiMERFQMELKDVERKIAQQA-AKLQGSDLDRTVQQVNQEKQEKQHELDTVVSKIELNRKLI 852
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   170 DRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELtQKLEQNKKMNRDHMRNASTFLERNDLRIEDGISS 249
Cdd:TIGR00606  853 QDQQEQIQHLKSKTNELKSEKLQIGTNLQRRQQFEEQLVELSTEV-QSLIREIKDAKEQDSPLETFLEKDQQEKEELISS 931
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   250 TLSSK----------ESKRKGSLDYLKQVENETRDKSENEKnrNQEDNKVKDLNQEIEKLKtqiKHFESLEEELKKMRaK 319
Cdd:TIGR00606  932 KETSNkkaqdkvndiKEKVKNIHGYMKDIENKIQDGKDDYL--KQKETELNTVNAQLEECE---KHQEKINEDMRLMR-Q 1005
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   320 NNDLQDNYLTELNRNRSLASQLEEIKlQVRKQKELGNGDIeGEDAFLLGRGRH----ERTKLKGHGSEASVSKHTSRELS 395
Cdd:TIGR00606 1006 DIDTQKIQERWLQDNLTLRKRENELK-EVEEELKQHLKEM-GQMQVLQMKQEHqkleENIDLIKRNHVLALGRQKGYEKE 1083
                          410       420
                   ....*....|....*....|
gi 568931356   396 PQHKRERLRNREFALSNEHY 415
Cdd:TIGR00606 1084 IKHFKKELREPQFRDAEEKY 1103
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
80-353 7.89e-07

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 53.52  E-value: 7.89e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    80 EEIKRAEDLCHTMKEKLEeeenltrELKSEIERLQKRMVDLEKLEEALSRSKNECS-QLCLSLNEERNLTKKISSELEML 158
Cdd:TIGR02168  684 EKIEELEEKIAELEKALA-------ELRKELEELEEELEQLRKELEELSRQISALRkDLARLEAEVEQLEERIAQLSKEL 756
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   159 RVKVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVNerkyLNEKEKENEKIIKELTQKLeQNKKMNRDHMRNASTFLER 238
Cdd:TIGR02168  757 TELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQ----LKEELKALREALDELRAEL-TLLNEEAANLRERLESLER 831
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   239 NDLRIEDGISSTLSSKESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKtqiKHFESLEEELKKMRA 318
Cdd:TIGR02168  832 RIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLR---SELEELSEELRELES 908
                          250       260       270
                   ....*....|....*....|....*....|....*
gi 568931356   319 KNNDLQDNYLTELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:TIGR02168  909 KRSELRRELEELREKLAQLELRLEGLEVRIDNLQE 943
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
21-280 9.57e-07

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 53.15  E-value: 9.57e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    21 QSLSRRLDELEEATKNLQR-AEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVlkiEGKDEEIKRAEDLCHtmkEKLEEE 99
Cdd:TIGR02169  265 KRLEEIEQLLEELNKKIKDlGEEEQLRVKEKIGELEAEIASLERSIAEKEREL---EDAEERLAKLEAEID---KLLAEI 338
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   100 ENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSL 179
Cdd:TIGR02169  339 EELEREIEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELDRLQEELQRL 418
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   180 VSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHmrNASTFLERNDLRIedgISSTLSSKESKRK 259
Cdd:TIGR02169  419 SEELADLNAAIAGIEAKINELEEEKEDKALEIKKQEWKLEQLAADLSKY--EQELYDLKEEYDR---VEKELSKLQRELA 493
                          250       260
                   ....*....|....*....|.
gi 568931356   260 GSLDYLKQVENETRDKSENEK 280
Cdd:TIGR02169  494 EAEAQARASEERVRGGRAVEE 514
PTZ00121 PTZ00121
MAEBL; Provisional
64-322 1.06e-06

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 53.22  E-value: 1.06e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   64 EIEVLRQRVLKIEGKDEEIKRAEDlchTMKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNE---CSQLCLS 140
Cdd:PTZ00121 1634 KVEQLKKKEAEEKKKAEELKKAEE---ENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEakkAEELKKK 1710
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  141 LNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQ 220
Cdd:PTZ00121 1711 EAEEKKKAEELKKAEEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKKAEEIRKEKEAVIEEELDEEDE 1790
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  221 NKKMNRDhmRNASTFLERNDLRIEDGISSTL---SSKE---SKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQ 294
Cdd:PTZ00121 1791 KRRMEVD--KKIKDIFDNFANIIEGGKEGNLvinDSKEmedSAIKEVADSKNMQLEEADAFEKHKFNKNNENGEDGNKEA 1868
                         250       260
                  ....*....|....*....|....*...
gi 568931356  295 EIEKLKTQIKHFESLEEELKKMRAKNND 322
Cdd:PTZ00121 1869 DFNKEKDLKEDDEEEIEEADEIEKIDKD 1896
SMC_N pfam02463
RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The ...
19-323 2.09e-06

RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.


Pssm-ID: 308206 [Multi-domain]  Cd Length: 1162  Bit Score: 51.90  E-value: 2.09e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    19 KLQSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVLKIEGKDEEIKRAEDLCHTMKEKLEE 98
Cdd:pfam02463  724 LADRVQEAQDKINEELKLLKQKIDEEEEEEEKSRLKKEEKEEEKSELSLKEKELAEEREKTEKLKVEEEKEEKLKAQEEE 803
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    99 EENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCL-SLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQ 177
Cdd:pfam02463  804 LRALEEELKEEAELLEEEQELIEQEEKIKEEELEELALELKeEQKLEKLAEEELERLEEEITKEELLQELLLKEEELEEQ 883
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   178 SLVSELEK-----------LKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMnRDHMRNASTFLERNDLRIEDG 246
Cdd:pfam02463  884 KLKDELESkeekekeekkeLEEESQKLNLLEEKENEIEERIKEEAEILLKYEEEPEEL-LLEEADEKEKEENNKEEEEER 962
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568931356   247 ISSTLSSKESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKhfeslEEELKKMRAKNNDL 323
Cdd:pfam02463  963 NKRLLLAKEELGKVNLMAIEEFEEKEERYNKDELEKERLEEEKKKLIRAIIEETCQRL-----KEFLELFVSINKGW 1034
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
2-349 3.35e-06

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 51.19  E-value: 3.35e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    2 AELTNYKDAASNRhlRFKLQSLSRRLDELEEATKN----LQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRV----- 72
Cdd:PRK02224  370 SELEEAREAVEDR--REEIEELEEEIEELRERFGDapvdLGNAEDFLEELREERDELREREAELEATLRTARERVeeaea 447
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   73 LKIEGK---------DEEIKRAEDLCHTMKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNE 143
Cdd:PRK02224  448 LLEAGKcpecgqpveGSPHVETIEEDRERVEELEAELEDLEEEVEEVEERLERAEDLVEAEDRIERLEERREDLEELIAE 527
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  144 ERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKI------------- 210
Cdd:PRK02224  528 RRETIEEKRERAEELRERAAELEAEAEEKREAAAEAEEEAEEAREEVAELNSKLAELKERIESLERIrtllaaiadaede 607
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  211 IKELTQKLEQNKKMNRDHMRNASTFLERNDLRIEDGISSTLSSKESKRKGSLDYLKQVENETRDKSEneknrnQEDnkvk 290
Cdd:PRK02224  608 IERLREKREALAELNDERRERLAEKRERKRELEAEFDEARIEEAREDKERAEEYLEQVEEKLDELRE------ERD---- 677
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 568931356  291 DLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYltelnrnrSLASQLEEIKLQVR 349
Cdd:PRK02224  678 DLQAEIGAVENELEELEELRERREALENRVEALEALY--------DEAEELESMYGDLR 728
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
19-214 1.28e-05

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 49.29  E-value: 1.28e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   19 KLQSLSRRLDELEEATKNLQRAEDELLD-LQDKVIQAEGSDSSTLAEIEVLRQRVLKIEGKDEEIKRAEDLCHTMKEKLE 97
Cdd:PRK03918  550 KLEELKKKLAELEKKLDELEEELAELLKeLEELGFESVEELEERLKELEPFYNEYLELKDAEKELEREEKELKKLEEELD 629
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   98 EEENLTRELKSEIERLQKRmvdLEKLEEALSRSKNEcsqlclslnEERNLTKKISSELEMLRVKVKELESSEDRLDKTeq 177
Cdd:PRK03918  630 KAFEELAETEKRLEELRKE---LEELEKKYSEEEYE---------ELREEYLELSRELAGLRAELEELEKRREEIKKT-- 695
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 568931356  178 slvseLEKLKsltlsfvNERKYLNEKEKENEKIIKEL 214
Cdd:PRK03918  696 -----LEKLK-------EELEEREKAKKELEKLEKAL 720
rad50 TIGR00606
rad50; All proteins in this family for which functions are known are involvedin recombination, ...
19-353 1.34e-05

rad50; All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).


Pssm-ID: 129694 [Multi-domain]  Cd Length: 1311  Bit Score: 49.27  E-value: 1.34e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    19 KLQSLSRRLDELEEATKNLQRAEDELLDLQDKV-IQAEGSDSSTLAEIEVLRQRVLKIE----GKDEEIKRAEDLCHTMK 93
Cdd:TIGR00606  320 ELVDCQRELEKLNKERRLLNQEKTELLVEQGRLqLQADRHQEHIRARDSLIQSLATRLEldgfERGPFSERQIKNFHTLV 399
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    94 EKLEEEENLTrelkseIERLQKRMVDLEKL-EEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRL 172
Cdd:TIGR00606  400 IERQEDEAKT------AAQLCADLQSKERLkQEQADEIRDEKKGLGRTIELKKEILEKKQEELKFVIKELQQLEGSSDRI 473
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   173 DKTEQSLVSELEKL-----KSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQ--NKKMNRDHMRNASTFLERNDLRIED 245
Cdd:TIGR00606  474 LELDQELRKAERELskaekNSLTETLKKEVKSLQNEKADLDRKLRKLDQEMEQlnHHTTTRTQMEMLTKDKMDKDEQIRK 553
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   246 gISSTLSSKESKRKGSLDYLKQVENETRDKSeneKNRNQEDNKVKDLNQEIEKLKTQIKHFeslEEELKKMRAKNNDLQD 325
Cdd:TIGR00606  554 -IKSRHSDELTSLLGYFPNKKQLEDWLHSKS---KEINQTRDRLAKLNKELASLEQNKNHI---NNELESKEEQLSSYED 626
                          330       340
                   ....*....|....*....|....*...
gi 568931356   326 NyLTELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:TIGR00606  627 K-LFDVCGSQDEESDLERLKEEIEKSSK 653
PRK01156 PRK01156
chromosome segregation protein; Provisional
106-359 2.00e-05

chromosome segregation protein; Provisional


Pssm-ID: 100796 [Multi-domain]  Cd Length: 895  Bit Score: 48.74  E-value: 2.00e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  106 LKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSELEK 185
Cdd:PRK01156  171 LKDVIDMLRAEISNIDYLEEKLKSSNLELENIKKQIADDEKSHSITLKEIERLSIEYNNAMDDYNNLKSALNELSSLEDM 250
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  186 LKSLTLSFVNERKYLNEKEKENEKI--IKELTQKLEQNKKM-NRDHMRNasTFLERNDLRIEDGISSTLSSKESKRKGSL 262
Cdd:PRK01156  251 KNRYESEIKTAESDLSMELEKNNYYkeLEERHMKIINDPVYkNRNYIND--YFKYKNDIENKKQILSNIDAEINKYHAII 328
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  263 DYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNRNRSLASQLE 342
Cdd:PRK01156  329 KKLSVLQKDYNDYIKKKSRYDDLNNQILELEGYEMDYNSYLKSIESLKKKIEEYSKNIERMSAFISEILKIQEIDPDAIK 408
                         250
                  ....*....|....*..
gi 568931356  343 EIKLQVRKQKELGNGDI 359
Cdd:PRK01156  409 KELNEINVKLQDISSKV 425
PRK05771 PRK05771
V-type ATP synthase subunit I; Validated
109-342 2.15e-05

V-type ATP synthase subunit I; Validated


Pssm-ID: 235600 [Multi-domain]  Cd Length: 646  Bit Score: 48.39  E-value: 2.15e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  109 EIERLqKRMVDLEKLEEALSRSkNECSQLCLSLNEERNLTKKISSELEmlRVKVKELESSEDRLDKTEQSLVSELEKLks 188
Cdd:PRK05771   32 HIEDL-KEELSNERLRKLRSLL-TKLSEALDKLRSYLPKLNPLREEKK--KVSVKSLEELIKDVEEELEKIEKEIKEL-- 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  189 ltlsfVNERKYLNEKEKENEKIIKELTQ--------KLEQNKKmnrdhmrNASTFLERNDLRIEDGISSTLSSK----ES 256
Cdd:PRK05771  106 -----EEEISELENEIKELEQEIERLEPwgnfdldlSLLLGFK-------YVSVFVGTVPEDKLEELKLESDVEnveyIS 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  257 KRKGSLDYLKQVENETRDKSENE--KN--RNQEDNKVKDLNQEIEKLKTQI----KHFESLEEELKKMRAKNNDL---QD 325
Cdd:PRK05771  174 TDKGYVYVVVVVLKELSDEVEEElkKLgfERLELEEEGTPSELIREIKEELeeieKERESLLEELKELAKKYLEEllaLY 253
                         250
                  ....*....|....*...
gi 568931356  326 NYL-TELNRNRSLASQLE 342
Cdd:PRK05771  254 EYLeIELERAEALSKFLK 271
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
1-353 2.28e-05

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 48.58  E-value: 2.28e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356     1 MAELTNYKDAASnrHLRFKLQSLSRRL-DELEEATKNLQRAEDELLDLQ---DKVIQAEGSDSSTLAEIEV-LRQRVLKI 75
Cdd:pfam15921  316 MRQLSDLESTVS--QLRSELREAKRMYeDKIEELEKQLVLANSELTEARterDQFSQESGNLDDQLQKLLAdLHKREKEL 393
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    76 EGKDEEIKRAEDlchtmkeKLEEEENLTRELKSEierLQKRMVDLEKLEEALSRSKNECSQlclSLNEERNLTKKISSEL 155
Cdd:pfam15921  394 SLEKEQNKRLWD-------RDTGNSITIDHLRRE---LDDRNMEVQRLEALLKAMKSECQG---QMERQMAAIQGKNESL 460
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   156 EMLRVKVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQ-------KLE--QNKKMNR 226
Cdd:pfam15921  461 EKVSSLTAQLESTKEMLRKVVEELTAKKMTLESSERTVSDLTASLQEKERAIEATNAEITKlrsrvdlKLQelQHLKNEG 540
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   227 DHMRNASTFLERNDLRI--EDGI----------SSTLSSKESKRKGSLDYLK-QVENETRDK----SENEKNRNQEDNKV 289
Cdd:pfam15921  541 DHLRNVQTECEALKLQMaeKDKVieilrqqienMTQLVGQHGRTAGAMQVEKaQLEKEINDRrlelQEFKILKDKKDAKI 620
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568931356   290 KDLNQEIEKLKTQ-IKHFESLEEELKKMRAKNNDlQDNYLTELNRNR----SLASQLEEIKLQVRKQKE 353
Cdd:pfam15921  621 RELEARVSDLELEkVKLVNAGSERLRAVKDIKQE-RDQLLNEVKTSRnelnSLSEDYEVLKRNFRNKSE 688
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
14-319 2.47e-05

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 48.52  E-value: 2.47e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   14 RHLRFKLQSLSRRLDELEEATKNLQRAED-------ELLDLQDKVIQAEGSdsstlAEIEVLRQRVLKIEGKDEEIK-RA 85
Cdd:PRK03918  408 SKITARIGELKKEIKELKKAIEELKKAKGkcpvcgrELTEEHRKELLEEYT-----AELKRIEKELKEIEEKERKLRkEL 482
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   86 EDLCHTMKEKLEEEENLT-----RELKSE-----IERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKIS--- 152
Cdd:PRK03918  483 RELEKVLKKESELIKLKElaeqlKELEEKlkkynLEELEKKAEEYEKLKEKLIKLKGEIKSLKKELEKLEELKKKLAele 562
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  153 ----------------------SELEMLRVKVKELESSEDR---LDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKEN 207
Cdd:PRK03918  563 kkldeleeelaellkeleelgfESVEELEERLKELEPFYNEyleLKDAEKELEREEKELKKLEEELDKAFEELAETEKRL 642
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  208 EKIIKELTqklEQNKKMNRDHMRNASTFLERndlriedgISSTLSSKESKRKGSLDYLKQVENETRDKSENEKNRnqedn 287
Cdd:PRK03918  643 EELRKELE---ELEKKYSEEEYEELREEYLE--------LSRELAGLRAELEELEKRREEIKKTLEKLKEELEER----- 706
                         330       340       350
                  ....*....|....*....|....*....|..
gi 568931356  288 kvKDLNQEIEKLKTQIKHFESLEEELKKMRAK 319
Cdd:PRK03918  707 --EKAKKELEKLEKALERVEELREKVKKYKAL 736
235kDa-fam TIGR01612
reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in ...
82-356 4.33e-05

reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in plasmodium species alternately annotated as reticulocyte binding protein, 235-kDa family protein and rhoptry protein. Rhoptry protein is localized on the cell surface and is extremely large (although apparently lacking in repeat structure) and is important for the process of invasion of the RBCs by the parasite. These proteins are found in P. falciparum, P. vivax and P. yoelii.


Pssm-ID: 130673 [Multi-domain]  Cd Length: 2757  Bit Score: 47.74  E-value: 4.33e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    82 IKRAEDLCHTMKEKLEEEENLTRELKSEIE-RLQKRMvdLEKLEEALSRSKNecsqlclSLNEERNLTKKISSELEMLRV 160
Cdd:TIGR01612  502 MKDFKDIIDFMELYKPDEVPSKNIIGFDIDqNIKAKL--YKEIEAGLKESYE-------LAKNWKKLIHEIKKELEEENE 572
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   161 KVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKekeNEKIIKELT-QKLEQNKKMNRDHMRNASTFLERN 239
Cdd:TIGR01612  573 DSIHLEKEIKDLFDKYLEIDDEIIYINKLKLELKEKIKNISDK---NEYIKKAIDlKKIIENNNAYIDELAKISPYQVPE 649
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   240 DLRIEDGISSTLSSKESK-RKGSLDYLKqveNETRD-KSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFE--SLEEELKK 315
Cdd:TIGR01612  650 HLKNKDKIYSTIKSELSKiYEDDIDALY---NELSSiVKENAIDNTEDKAKLDDLKSKIDKEYDKIQNMEtaTVELHLSN 726
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*..
gi 568931356   316 MRAKNNDLQDNyLTELNR------NRSLASQLEEIKlqvRKQKELGN 356
Cdd:TIGR01612  727 IENKKNELLDI-IVEIKKhihgeiNKDLNKILEDFK---NKEKELSN 769
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
16-353 4.93e-05

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 47.42  E-value: 4.93e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    16 LRFKLQSLSRRLDELEEATKNLQRAEDELLD-LQDKVIQAEGS---------DSSTlaEIEVLRQRVLKIEGKDEEIKR- 84
Cdd:pfam15921  115 LQTKLQEMQMERDAMADIRRRESQSQEDLRNqLQNTVHELEAAkclkedmleDSNT--QIEQLRKMMLSHEGVLQEIRSi 192
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    85 -------------AEDLCHTM--KEKLEEEENLTRELKSEIERLQKRMVDLEKLEEAL-SRSKNECSQLclsLNEERNLT 148
Cdd:pfam15921  193 lvdfeeasgkkiyEHDSMSTMhfRSLGSAISKILRELDTEISYLKGRIFPVEDQLEALkSESQNKIELL---LQQHQDRI 269
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   149 KKISSELEmlrVKVKELESSEDRLDKTEQSLVSELEKLKSLTLsfvNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDH 228
Cdd:pfam15921  270 EQLISEHE---VEITGLTEKASSARSQANSIQSQLEIIQEQAR---NQNSMYMRQLSDLESTVSQLRSELREAKRMYEDK 343
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   229 MRNastfLERNDLRIEDGISSTLSSKE--SKRKGSLDYLKQVENETRDKSENEKNRNQEDNK------------------ 288
Cdd:pfam15921  344 IEE----LEKQLVLANSELTEARTERDqfSQESGNLDDQLQKLLADLHKREKELSLEKEQNKrlwdrdtgnsitidhlrr 419
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568931356   289 -VKDLNQEIEKLKTQIKHFES-----LEEELKKMRAKNNDLQdnyltelnRNRSLASQLEEIKLQVRKQKE 353
Cdd:pfam15921  420 eLDDRNMEVQRLEALLKAMKSecqgqMERQMAAIQGKNESLE--------KVSSLTAQLESTKEMLRKVVE 482
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
19-189 5.23e-05

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 47.40  E-value: 5.23e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   19 KLQSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRvlKIEGKDEEIKRAEDLCHTMKEKLEE 98
Cdd:COG1196   345 LLEELEQLLAELEEAKEELEEKLSALLEELEELFEALREELAELEAELAEIRN--ELEELKREIESLEERLERLSERLED 422
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   99 EENLTRELKSEIERLQKRMVD----LEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDK 174
Cdd:COG1196   423 LKEELKELEAELEELQTELEElneeLEELEEQLEELRDRLKELERELAELQEELQRLEKELSSLEARLDRLEAEQRASQG 502
                         170
                  ....*....|....*
gi 568931356  175 TEQSLVSELEKLKSL 189
Cdd:COG1196   503 VRAVLEALESGLPGV 517
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
62-349 5.73e-05

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 47.37  E-value: 5.73e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    62 LAEIEVLRQRVLKIEGKDEEIK---------RAEDLCHTMKEKLEEEENLT------RELKSEIERLQKRMVDLEKLEEA 126
Cdd:TIGR02169  176 LEELEEVEENIERLDLIIDEKRqqlerlrreREKAERYQALLKEKREYEGYellkekEALERQKEAIERQLASLEEELEK 255
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   127 LSRSKNECSQLCLSLNEERN-LTKKIS--SELEMLRVKVK--ELESSEDRLDKTEQSLVSELEKL-KSLTLSFVNERKYL 200
Cdd:TIGR02169  256 LTEEISELEKRLEEIEQLLEeLNKKIKdlGEEEQLRVKEKigELEAEIASLERSIAEKERELEDAeERLAKLEAEIDKLL 335
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   201 NEKEKENEKIikeLTQKLEQNKKMNRDHMRNASTFLERNDLRIEDGISSTLSSKESKRKGSLDYLKQVENE---TRDKSE 277
Cdd:TIGR02169  336 AEIEELEREI---EEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINElkrELDRLQ 412
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   278 NEKNRNQEdnKVKDLNQEIEKLKTQIKHFES-----------LEEELKKMRAKNNDLQDNYL---TELN----RNRSLAS 339
Cdd:TIGR02169  413 EELQRLSE--ELADLNAAIAGIEAKINELEEekedkaleikkQEWKLEQLAADLSKYEQELYdlkEEYDrvekELSKLQR 490
                          330
                   ....*....|
gi 568931356   340 QLEEIKLQVR 349
Cdd:TIGR02169  491 ELAEAEAQAR 500
PRK01156 PRK01156
chromosome segregation protein; Provisional
20-353 5.99e-05

chromosome segregation protein; Provisional


Pssm-ID: 100796 [Multi-domain]  Cd Length: 895  Bit Score: 47.20  E-value: 5.99e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   20 LQSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVLKIEGKDEEIKRAEDLCHTMKEKLEEE 99
Cdd:PRK01156  175 IDMLRAEISNIDYLEEKLKSSNLELENIKKQIADDEKSHSITLKEIERLSIEYNNAMDDYNNLKSALNELSSLEDMKNRY 254
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  100 ENLTRELKSEIERLQKRMVDLEKLEEALSRSKNecSQLCLSLNEER---NLTKKISSELEMLRVKVKELESSEDRLDKTE 176
Cdd:PRK01156  255 ESEIKTAESDLSMELEKNNYYKELEERHMKIIN--DPVYKNRNYINdyfKYKNDIENKKQILSNIDAEINKYHAIIKKLS 332
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  177 --QSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQ---KLEQNKKMNRDHMRNASTFLERNDL------RIED 245
Cdd:PRK01156  333 vlQKDYNDYIKKKSRYDDLNNQILELEGYEMDYNSYLKSIESlkkKIEEYSKNIERMSAFISEILKIQEIdpdaikKELN 412
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  246 GISSTL---SSKESKRKGSLDYLKQVENETRDKSE-------------------NEKNRNQEDNKVKDLNQEIEKLKTQI 303
Cdd:PRK01156  413 EINVKLqdiSSKVSSLNQRIRALRENLDELSRNMEmlngqsvcpvcgttlgeekSNHIINHYNEKKSRLEEKIREIEIEV 492
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568931356  304 KHFESLEEELKKMRAKNNDLQDN-YLTELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:PRK01156  493 KDIDEKIVDLKKRKEYLESEEINkSINEYNKIESARADLEDIKIKINELKD 543
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
197-353 7.60e-05

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 46.68  E-value: 7.60e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  197 RKYLNEKEKENEKIIKELTQkLEQNKKMnrdhmrnaSTFLERNDLRIEDGISSTLSSKESKRKGSLDYLKQVENETrdKS 276
Cdd:COG0419   146 DAFLKSKPKERKEILDELFG-LEKYEKL--------SELLKEVIKEAKAKIEELEGQLSELLEDIEDLLEALEEEL--KE 214
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568931356  277 ENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:COG0419   215 LKKLEEIQEEQEEEELEQEIEALEERLAELEEEKERLEELKARLLEIESLELEALKIREEELRELERLLEELEEKIE 291
SMC_N pfam02463
RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The ...
103-363 8.05e-05

RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.


Pssm-ID: 308206 [Multi-domain]  Cd Length: 1162  Bit Score: 46.89  E-value: 8.05e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   103 TRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEER------NLTKKISSELEMLRV--KVKELESSEDRLDK 174
Cdd:pfam02463  166 SRLKRKKKEALKKLIEETENLAELIIDLEELKLQELKLKEQAKkaleyyQLKEKLELEEEYLLYldYLKLNEERIDLLQE 245
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   175 TEQSLVSELEKLKSL------TLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHMRNASTFLERNDLRIEDGIS 248
Cdd:pfam02463  246 LLRDEQEEIESSKQEiekeeeKLAQVLKENKEEEKEKKLQEEELKLLAKEEEELKSELLKLERRKVDDEEKLKESEKEKK 325
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   249 STLSSKESKRKGSLDYLKQVENETRDKSENE-KNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKmRAKNNDLQDNY 327
Cdd:pfam02463  326 KAEKELKKEKEEIEELEKELKELEIKREAEEeEEEELEKLQEKLEQLEEELLAKKKLESERLSSAAKL-KEEELELKSEE 404
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 568931356   328 LTELNRNRSLASQLEEIkLQVRKQKELGNGDIEGED 363
Cdd:pfam02463  405 EKEAQLLLELARQLEDL-LKEEKKEELEILEEEEES 439
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
106-399 8.83e-05

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 46.22  E-value: 8.83e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   106 LKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSELEK 185
Cdd:pfam15742   60 IKAELKQAQQKLLDSTKMCSSLTAEWEHCQQKIRELELEVLKQAQSIKSQNSLQEKLAQEKSKVAEAEKKILELQQKLEH 139
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   186 LK--SLTLSFVNERKYLNEKEKENEKIIKELTQK----------LEQNKKMNRDHMRNastflerndLRI-EDGISSTLS 252
Cdd:pfam15742  140 AHkvCLTETCILEKKQLEEEIKEAQENEAKLKQQyqeeqqkrklLDQNVNELQQQVRI---------LQDkEAQLERTNS 210
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   253 SKESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHF-ESLEEELKKM-------RAKNNDLQ 324
Cdd:pfam15742  211 QQQLRIQQQEAQLKQLENEKRKSDEHLKSNQELSEKLSSLQQEKEALQEELQQFlKQLDVHVRKYnekhhhhKAKLRRAK 290
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   325 DNYLTELN----RNRSLASQLEEIKLQVRKQKELGNGDIEGEDAFLLgrgrhERTKL--KGHGSEASVSKHTSRELSPQH 398
Cdd:pfam15742  291 DRLLHEVEqrdeRIKQLENEIRILQSQIEKEKAFQDQVTAENETLLL-----EKRKLleQLSEQEEVIKNNKWTISSVQN 365

                   .
gi 568931356   399 K 399
Cdd:pfam15742  366 R 366
PTZ00440 PTZ00440
reticulocyte binding protein 2-like protein; Provisional
27-332 1.22e-04

reticulocyte binding protein 2-like protein; Provisional


Pssm-ID: 240419 [Multi-domain]  Cd Length: 2722  Bit Score: 46.36  E-value: 1.22e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   27 LDELEEATKNLQRAEDELLDLQDKVIQAEGSDSST--LAEIEVLRQRvlkIEGKDEEIKRAEDLCHTMkekleeeenltr 104
Cdd:PTZ00440  690 IKNLKKELQNLLSLKENIIKKQLNNIEQDISNSLNqyTIKYNDLKSS---IEEYKEEEEKLEVYKHQI------------ 754
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  105 elkseIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVK----ELESSEDRLDKTEQSLV 180
Cdd:PTZ00440  755 -----INRKNEFILHLYENDKDLPDGKNTYEEFLQYKDTILNKENKISNDINILKENKKnnqdLLNSYNILIQKLEAHTE 829
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  181 SELEKLKSLTLSFVNERKYLNEKEKENE-----KIIKELTQKLEQ-NKKMNRDHMRNASTFLERNDLRIedgISSTLSSK 254
Cdd:PTZ00440  830 KNDEELKQLLQKFPTEDENLNLKELEKEfnennQIVDNIIKDIENmNKNINIIKTLNIAINRSNSNKQL---VEHLLNNK 906
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  255 ESKRKGSLDYLKQVENET----RDKSENEKNRNQEDNKV-KDLNQE-IEKLKTQIkhfESLEEELKKMRAKNNDLQDNYL 328
Cdd:PTZ00440  907 IDLKNKLEQHMKIINTDNiiqkNEKLNLLNNLNKEKEKIeKQLSDTkINNLKMQI---EKTLEYYDKSKENINGNDGTHL 983

                  ....
gi 568931356  329 TELN 332
Cdd:PTZ00440  984 EKLD 987
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
79-345 2.22e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 45.44  E-value: 2.22e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    79 DEEIKRAEDLCHTMKEKLEEEENLTRELKSEIERLQKRMVDLEKLEeALSRSKNECSQLCLSLNEERNLT--KKISSELE 156
Cdd:TIGR02169  169 DRKKEKALEELEEVEENIERLDLIIDEKRQQLERLRREREKAERYQ-ALLKEKREYEGYELLKEKEALERqkEAIERQLA 247
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   157 MLRvkvKELESSEDRLDKTEQSLVSELEKLKSLT--LSFVNERKYLNEKEKenekiIKELTQKLEQNKKMNRDHMRNAST 234
Cdd:TIGR02169  248 SLE---EELEKLTEEISELEKRLEEIEQLLEELNkkIKDLGEEEQLRVKEK-----IGELEAEIASLERSIAEKERELED 319
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   235 fLERNDLRIEDGISSTLSSKESKRKGSLDYLKQVENETrdkSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELK 314
Cdd:TIGR02169  320 -AEERLAKLEAEIDKLLAEIEELEREIEEERKRRDKLT---EEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLE 395
                          250       260       270
                   ....*....|....*....|....*....|.
gi 568931356   315 KMRAKNNDLQDNYLTELNRNRSLASQLEEIK 345
Cdd:TIGR02169  396 KLKREINELKRELDRLQEELQRLSEELADLN 426
YloA COG1293
Predicted component of the ribosome quality control (RQC) complex, YloA/Tae2 family, contains ...
109-353 2.47e-04

Predicted component of the ribosome quality control (RQC) complex, YloA/Tae2 family, contains fibronectin-binding (FbpA) and DUF814 domains [Translation, ribosomal structure and biogenesis];


Pssm-ID: 224212 [Multi-domain]  Cd Length: 564  Bit Score: 45.08  E-value: 2.47e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  109 EIERLQKRMVDLEKL--EEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSELEKL 186
Cdd:COG1293   187 DIVRLLARFLGLGGLlaEELLSRAGLDKKVPAKDLFEEEIKKVREALEELLNPLKPNYYYKDEKYLDVVPLKAYADLEKL 266
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  187 KSLTLSFVNER----KYLNEKEKENEKIIKELTQKLEQNKKMNRDHMRNASTFLERNDL------RIEDGISS-TLSSKE 255
Cdd:COG1293   267 FNEALDEKFERdkikQLASELEKKLEKELKKLENKLEKQEDELEELEKAAEELRQKGELlyanlqLIEEGLKSvRLADFY 346
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  256 SKRKGSLDylkqvENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDnylTELNRNR 335
Cdd:COG1293   347 GNEEIKIE-----LDKSKTPSENAQRYFKKYKKLKGAKVNLDRQLSELKEAIAYYESAKTALEKAEGKKA---IEEIREE 418
                         250
                  ....*....|....*...
gi 568931356  336 SLASQLEEIKLQVRKQKE 353
Cdd:COG1293   419 LIEEGLLKSKKKKRKKKE 436
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
121-353 2.51e-04

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 45.01  E-value: 2.51e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   121 EKLEEALSRSKNECSQLCLSL-NEERNLTKKISsELEMLRVKVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKY 199
Cdd:TIGR04523   36 KQLEKKLKTIKNELKNKEKELkNLDKNLNKDEE-KINNSNNKIKILEQQIKDLNDKLKKNKDKINKLNSDLSKINSEIKN 114
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   200 LNEKEKENEKIIKELTQKLEQNKKmnrdhmrNASTFLerNDLRIEDGISSTLSSKES---KRKGSL-DYLKQVENETRDK 275
Cdd:TIGR04523  115 DKEQKNKLEVELNKLEKQKKENKK-------NIDKFL--TEIKKKEKELEKLNNKYNdlkKQKEELeNELNLLEKEKLNI 185
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 568931356   276 SENEKNRNQEDNKvkdLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:TIGR04523  186 QKNIDKIKNKLLK---LELLLSNLKKKIQKNKSLESQISELKKQNNQLKDNIEKKQQEINEKTTEISNTQTQLNQLKD 260
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
43-354 3.08e-04

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 44.29  E-value: 3.08e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    43 ELLDLQDKVIQAEGSDSSTLAEIEVLRQRV----LKIEGKDEEIK----RAEDLCHtmkekleeeenltreLKSEIERLQ 114
Cdd:pfam15742   63 ELKQAQQKLLDSTKMCSSLTAEWEHCQQKIreleLEVLKQAQSIKsqnsLQEKLAQ---------------EKSKVAEAE 127
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   115 KRMVDL-EKLEEALSRSKNECSQLCLSLNEERnlTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSELEKL--KSLTL 191
Cdd:pfam15742  128 KKILELqQKLEHAHKVCLTETCILEKKQLEEE--IKEAQENEAKLKQQYQEEQQKRKLLDQNVNELQQQVRILqdKEAQL 205
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   192 SFVNERKYLNEKEKEnekiikELTQKLEQNKKMNRDHMRNASTFLERndlriedgISSTLSSKESKRKGSLDYLKQVENE 271
Cdd:pfam15742  206 ERTNSQQQLRIQQQE------AQLKQLENEKRKSDEHLKSNQELSEK--------LSSLQQEKEALQEELQQFLKQLDVH 271
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   272 TRDKSENEKNRNQEDNKVKD-LNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTE----LNRNRSLASQLEEIKL 346
Cdd:pfam15742  272 VRKYNEKHHHHKAKLRRAKDrLLHEVEQRDERIKQLENEIRILQSQIEKEKAFQDQVTAEnetlLLEKRKLLEQLSEQEE 351

                   ....*...
gi 568931356   347 QVRKQKEL 354
Cdd:pfam15742  352 VIKNNKWT 359
PRK01156 PRK01156
chromosome segregation protein; Provisional
29-360 3.27e-04

chromosome segregation protein; Provisional


Pssm-ID: 100796 [Multi-domain]  Cd Length: 895  Bit Score: 44.89  E-value: 3.27e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   29 ELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLR-QRVLKIEGKDEEIKRAEDLCHTMKEKLEEEENLTRELK 107
Cdd:PRK01156  410 ELNEINVKLQDISSKVSSLNQRIRALRENLDELSRNMEMLNgQSVCPVCGTTLGEEKSNHIINHYNEKKSRLEEKIREIE 489
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  108 SEIERLQKRMVDLEKLEEALSRSKNEcsqlclSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVS-ELEKL 186
Cdd:PRK01156  490 IEVKDIDEKIVDLKKRKEYLESEEIN------KSINEYNKIESARADLEDIKIKINELKDKHDKYEEIKNRYKSlKLEDL 563
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  187 KSLTLSFVNERKYLNEKEKENEKiikelTQKLEQNKKMNRdhmrnastfLERNDLRIEDGISSTLSSKESkrkgsldYLK 266
Cdd:PRK01156  564 DSKRTSWLNALAVISLIDIETNR-----SRSNEIKKQLND---------LESRLQEIEIGFPDDKSYIDK-------SIR 622
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  267 QVENETRDkSENEKNRNQEDNKVKD-LNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNY------LTELNRNRSLAS 339
Cdd:PRK01156  623 EIENEANN-LNNKYNEIQENKILIEkLRGKIDNYKKQIAEIDSIIPDLKEITSRINDIEDNLkksrkaLDDAKANRARLE 701
                         330       340
                  ....*....|....*....|.
gi 568931356  340 QLEEIKLQVRKQKELGNGDIE 360
Cdd:PRK01156  702 STIEILRTRINELSDRINDIN 722
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
21-361 6.21e-04

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 43.95  E-value: 6.21e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    21 QSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRV---------LKIEGkdEEIKRAEDLCHT 91
Cdd:pfam15921  475 EMLRKVVEELTAKKMTLESSERTVSDLTASLQEKERAIEATNAEITKLRSRVdlklqelqhLKNEG--DHLRNVQTECEA 552
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    92 MKEKLEEEENLTRELKSEIERLQK------RMVDLEKLEEAlsRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKEL 165
Cdd:pfam15921  553 LKLQMAEKDKVIEILRQQIENMTQlvgqhgRTAGAMQVEKA--QLEKEINDRRLELQEFKILKDKKDAKIRELEARVSDL 630
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   166 ESSEDRLDKTEQSLVSELEKLKSLTLSFVNE----RKYLNEKEKENEKIIKELTQKLEQNKKMN---RDHMRNASTFLE- 237
Cdd:pfam15921  631 ELEKVKLVNAGSERLRAVKDIKQERDQLLNEvktsRNELNSLSEDYEVLKRNFRNKSEEMETTTnklKMQLKSAQSELEq 710
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   238 -RNDLRIEDG-------ISSTLSSKESKRKGSLDYLKQ--------VENETRDKSENEKNRNQEDNKVKDLNQEIEKLKT 301
Cdd:pfam15921  711 tRNTLKSMEGsdghamkVAMGMQKQITAKRGQIDALQSkiqfleeaMTNANKEKHFLKEEKNKLSQELSTVATEKNKMAG 790
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   302 QIKHFESLEEELKKMRAKNNDLQDNYLTELNRNRSLASQLEEIKLQVRKQKELGNGDIEG 361
Cdd:pfam15921  791 ELEVLRSQERRLKEKVANMEVALDKASLQFAECQDIIQRQEQESVRLKLQHTLDVKELQG 850
235kDa-fam TIGR01612
reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in ...
73-374 7.94e-04

reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in plasmodium species alternately annotated as reticulocyte binding protein, 235-kDa family protein and rhoptry protein. Rhoptry protein is localized on the cell surface and is extremely large (although apparently lacking in repeat structure) and is important for the process of invasion of the RBCs by the parasite. These proteins are found in P. falciparum, P. vivax and P. yoelii.


Pssm-ID: 130673 [Multi-domain]  Cd Length: 2757  Bit Score: 43.89  E-value: 7.94e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    73 LKIEGKDEEIKRAEDLCHTMKEKLEEEENlTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQL-CLSLNEERNLTKKI 151
Cdd:TIGR01612 1226 LFLEKIDEEKKKSEHMIKAMEAYIEDLDE-IKEKSPEIENEMGIEMDIKAEMETFNISHDDDKDHhIISKKHDENISDIR 1304
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   152 SSELEMLRVKVKEleSSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKEN--EKII---KELTQKLEQNKKMNR 226
Cdd:TIGR01612 1305 EKSLKIIEDFSEE--SDINDIKKELQKNLLDAQKHNSDINLYLNEIANIYNILKLNkiKKIIdevKEYTKEIEENNKNIK 1382
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   227 DHMRNASTFLE--RNDLRIED---GISSTLSSKE-----SKRKGSLDYL--KQVENETRDKSENEKNRN----------- 283
Cdd:TIGR01612 1383 DELDKSEKLIKkiKDDINLEEcksKIESTLDDKDideciKKIKELKNHIlsEESNIDTYFKNADENNENvlllfkniema 1462
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   284 ----------QEDNKVKDLNQEIEKLKTQIKHFESLEEEL---KKMRAKNNDLQDNYLTELNR--NRSLASQLEEIKLQV 348
Cdd:TIGR01612 1463 dnksqhilkiKKDNATNDHDFNINELKEHIDKSKGCKDEAdknAKAIEKNKELFEQYKKDVTEllNKYSALAIKNKFAKT 1542
                          330       340
                   ....*....|....*....|....*..
gi 568931356   349 RKQKELGNGDI-EGEDAFLLGRGRHER 374
Cdd:TIGR01612 1543 KKDSEIIIKEIkDAHKKFILEAEKSEQ 1569
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
3-223 8.14e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 43.55  E-value: 8.14e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    3 ELTNYKDAASNRHLRFKLQSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVLKIEgkdEEI 82
Cdd:COG1196   803 EEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELE---DEL 879
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   83 KRAEDLCHTMKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALsrsKNECSQLCLSLNEERNLTkkISSELEMlrvKV 162
Cdd:COG1196   880 KELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERL---EVELPELEEELEEEYEDT--LETELER---EI 951
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 568931356  163 KELESSEDRLDKTEQSLVSELEKLKsltlsfvNERKYLNEKEKENEKI---IKELTQKLEQNKK 223
Cdd:COG1196   952 ERLEEEIEALGPVNLRAIEEYEEVE-------ERYEELKSQREDLEEAkekLLEVIEELDKEKR 1008
COG5022 COG5022
Myosin heavy chain [General function prediction only];
14-347 9.45e-04

Myosin heavy chain [General function prediction only];


Pssm-ID: 227355 [Multi-domain]  Cd Length: 1463  Bit Score: 43.53  E-value: 9.45e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   14 RHLRFKLQSLSRRLDELEEATKNL---QRAEDELLDLQDKVIQAEGSDSSTLAEievLRQRVLKIEGKDEEIKRAEDLCH 90
Cdd:COG5022   758 RYLRRRYLQALKRIKKIQVIQHGFrlrRLVDYELKWRLFIKLQPLLSLLGSRKE---YRSYLACIIKLQKTIKREKKLRE 834
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   91 TMKEKLEEEENLTRELKSEIERLQKRMVDLEKlEEALSRSKNEcsqlclSLNEERNLT--KKISSELEMLRVKVKELESS 168
Cdd:COG5022   835 TEEVEFSLKAEVLIQKFGRSLKAKKRFSLLKK-ETIYLQSAQR------VELAERQLQelKIDVKSISSLKLVNLELESE 907
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  169 EDRLDKTEQSlvSELEKLKSLTLSFVNERKYLNEKEKENEKIIKeltqkLEQNKKMNRDHMRNAS---TFLERNDLRIED 245
Cdd:COG5022   908 IIELKKSLSS--DLIENLEFKTELIARLKKLLNNIDLEEGPSIE-----YVKLPELNKLHEVESKlkeTSEEYEDLLKKS 980
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  246 GIS-STLSSKESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRA---KNN 321
Cdd:COG5022   981 TILvREGNKANSELKNFKKELAELSKQYGALQESTKQLKELPVEVAELQSASKIISSESTELSILKPLQKLKGLlllENN 1060
                         330       340
                  ....*....|....*....|....*.
gi 568931356  322 DLQDNYLTELNRNRSLASQLEEIKLQ 347
Cdd:COG5022  1061 QLQARYKALKLRRENSLLDDKQLYQL 1086
PTZ00440 PTZ00440
reticulocyte binding protein 2-like protein; Provisional
81-413 9.64e-04

reticulocyte binding protein 2-like protein; Provisional


Pssm-ID: 240419 [Multi-domain]  Cd Length: 2722  Bit Score: 43.28  E-value: 9.64e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   81 EIKRAEDLCHTMKE---KLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEM 157
Cdd:PTZ00440  496 YQEKVDELLQIINSikeKNNIVNNNFKNIEDYYITIEGLKNEIEGLIELIKYYLQSIETLIKDEKLKRSMKNDIKNKIKY 575
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  158 LR---VKVKELESSEDRLDKTEQslvsELEKLKSLTLSfvNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHMrnaST 234
Cdd:PTZ00440  576 IEenvDHIKDIISLNDEIDNIIQ----QIEELINEALF--NKEKFINEKNDLQEKVKYILNKFYKGDLQELLDEL---SH 646
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  235 FLERNdlriedgisstlsSKESKRKGSLDYLKQVENETRDKSENEKNRNQEDNkvkdlNQEIEKLKTQIKHFESLEEELK 314
Cdd:PTZ00440  647 FLDDH-------------KYLYHEAKSKEDLQTLLNTSKNEYEKLEFMKSDNI-----DNIIKNLKKELQNLLSLKENII 708
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  315 KMRAKN--NDLQDNYLTELNRNRSLASQLEEIKLQVRKQKELGNGDIEGEDAFLLGRGRHERTKLKGHGSEASVSKHtsr 392
Cdd:PTZ00440  709 KKQLNNieQDISNSLNQYTIKYNDLKSSIEEYKEEEEKLEVYKHQIINRKNEFILHLYENDKDLPDGKNTYEEFLQY--- 785
                         330       340
                  ....*....|....*....|.
gi 568931356  393 elspqhkRERLRNREFALSNE 413
Cdd:PTZ00440  786 -------KDTILNKENKISND 799
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
154-354 9.78e-04

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 43.21  E-value: 9.78e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  154 ELEMLRVKVKELESS-EDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHMRNA 232
Cdd:COG0419   168 KYEKLSELLKEVIKEaKAKIEELEGQLSELLEDIEDLLEALEEELKELKKLEEIQEEQEEEELEQEIEALEERLAELEEE 247
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  233 STFLERNDLRIEDGISStlsskeskrkgsldylkqvenetrdKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEE 312
Cdd:COG0419   248 KERLEELKARLLEIESL-------------------------ELEALKIREEELRELERLLEELEEKIERLEELEREIEE 302
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 568931356  313 LKKMRAKNNDLQDNYLTELNRNRSLASQLEEIKLQVRKQKEL 354
Cdd:COG0419   303 LEEELEGLRALLEELEELLEKLKSLEERLEKLEEKLEKLESE 344
COG2433 COG2433
Possible nuclease of RNase H fold, RuvC/YqgF family [General function prediction only];
4-226 1.05e-03

Possible nuclease of RNase H fold, RuvC/YqgF family [General function prediction only];


Pssm-ID: 225288  Cd Length: 652  Bit Score: 43.15  E-value: 1.05e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    4 LTNYKDAASNRHLRFKLQSLSRRLDELEEATKNLQR-AEDELLDLQDKVIQAEGSDSSTLAEieVLRQRVLKIEGKDEEI 82
Cdd:COG2433   331 LRTLKISVSDDHERDALAAAYKAYLAYKPKLEKVERkLPELGIWKDVERIKALVIRGYPLAE--ALSKVKEEERPREKEG 408
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   83 KRAEDlchtmKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRsknecsqlclslneernltkkissELEMLRVKV 162
Cdd:COG2433   409 TEEEE-----RREITVYEKRIKKLEETVERLEEENSELKRELEELKR------------------------EIEKLESEL 459
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568931356  163 KEL---ESSEDRLDKTEQSLVSELEKLksltlsfvnERKYLNEKEKenekiIKELTQKLEQNKKMNR 226
Cdd:COG2433   460 ERFrreVRDKVRKDREIRARDRRIERL---------EKELEEKKKR-----VEELERKLAELRKMRK 512
rad50 TIGR00606
rad50; All proteins in this family for which functions are known are involvedin recombination, ...
28-349 1.37e-03

rad50; All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).


Pssm-ID: 129694 [Multi-domain]  Cd Length: 1311  Bit Score: 42.73  E-value: 1.37e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    28 DELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVLKIEGKDEEIKRAEDLchtmkekleeeENLTRELK 107
Cdd:TIGR00606  577 DWLHSKSKEINQTRDRLAKLNKELASLEQNKNHINNELESKEEQLSSYEDKLFDVCGSQDE-----------ESDLERLK 645
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   108 SEIERLQKRMVDL-------EKLEEALSRSKNECSQLC----LSLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTE 176
Cdd:TIGR00606  646 EEIEKSSKQRAMLagatavySQFITQLTDENQSCCPVCqrvfQTEAELQEFISDLQSKLRLAPDKLKSTESELKKKEKRR 725
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   177 QSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHM-RNASTFLERNDLRIEDGISSTLSSKE 255
Cdd:TIGR00606  726 DEMLGLAPGRQSIIDLKEKEIPELRNKLQKVNRDIQRLKNDIEEQETLLGTIMpEEESAKVCLTDVTIMERFQMELKDVE 805
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   256 SKRKGSLDYLKQVENEtRDKSENEKNRNQEDNKVKDLNQEIEKLKtqiKHFESLEEELKKMRAKNNDLQDNYL---TELN 332
Cdd:TIGR00606  806 RKIAQQAAKLQGSDLD-RTVQQVNQEKQEKQHELDTVVSKIELNR---KLIQDQQEQIQHLKSKTNELKSEKLqigTNLQ 881
                          330
                   ....*....|....*..
gi 568931356   333 RNRSLASQLEEIKLQVR 349
Cdd:TIGR00606  882 RRQQFEEQLVELSTEVQ 898
PRK12704 PRK12704
phosphodiesterase; Provisional
108-220 1.41e-03

phosphodiesterase; Provisional


Pssm-ID: 237177 [Multi-domain]  Cd Length: 520  Bit Score: 42.46  E-value: 1.41e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  108 SEIERLQKRMVDLEKLE------EALSRSKNECSQLCLSLNEERNLTKKISSELEmLRVKVKE--LESSEDRLDKTEQSL 179
Cdd:PRK12704   34 KEAEEEAKRILEEAKKEaeaikkEALLEAKEEIHKLRNEFEKELRERRNELQKLE-KRLLQKEenLDRKLELLEKREEEL 112
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 568931356  180 VSELEKLKsltlsfvNERKYLNEKEKENEKIIKELTQKLEQ 220
Cdd:PRK12704  113 EKKEKELE-------QKQQELEKKEEELEELIEEQLQELER 146
PTZ00121 PTZ00121
MAEBL; Provisional
25-364 1.52e-03

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 42.82  E-value: 1.52e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   25 RRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAE-----------IEVLRQRVLKiegKDEEIKRAEDLCHTMK 93
Cdd:PTZ00121 1134 RKAEDARKAEEARKAEDAKRVEIARKAEDARKAEEARKAEdakkaeaarkaEEVRKAEELR---KAEDARKAEAARKAEE 1210
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   94 EKLEEEENLTRELK--SEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRvKVKELESSEDR 171
Cdd:PTZ00121 1211 ERKAEEARKAEDAKkaEAVKKAEEAKKDAEEAKKAEEERNNEEIRKFEEARMAHFARRQAAIKAEEAR-KADELKKAEEK 1289
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  172 LDKTEQSLVSELEKLKSLtlsfvnerkylnEKEKENEKIIKELTQKLEQNKKMNRDHMRNASTFLERNDLRIEDGISSTL 251
Cdd:PTZ00121 1290 KKADEAKKAEEKKKADEA------------KKKAEEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAAD 1357
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  252 SSKESKRKGSLDYLKQveNETRDKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKM-RAKNNDLQDNYLTE 330
Cdd:PTZ00121 1358 EAEAAEEKAEAAEKKK--EEAKKKADAAKKKAEEKKKADEAKKKAEEDKKKADELKKAAAAKKKAdEAKKKAEEKKKADE 1435
                         330       340       350
                  ....*....|....*....|....*....|....
gi 568931356  331 LNRNRSLASQLEEIKLQVRKQKELGNGDIEGEDA 364
Cdd:PTZ00121 1436 AKKKAEEAKKADEAKKKAEEAKKAEEAKKKAEEA 1469
rad50 TIGR00606
rad50; All proteins in this family for which functions are known are involvedin recombination, ...
16-353 1.85e-03

rad50; All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).


Pssm-ID: 129694 [Multi-domain]  Cd Length: 1311  Bit Score: 42.34  E-value: 1.85e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    16 LRFKLQSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTL-------AEIEVLRQRVLKIEGKDEEIKRAEDL 88
Cdd:TIGR00606  191 LRQVRQTQGQKVQEHQMELKYLKQYKEKACEIRDQITSKEAQLESSReivksyeNELDPLKNRLKEIEHNLSKIMKLDNE 270
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    89 CHTMKEKLEEEENLTRELKSEIERL----QKRMVDLEKLEEALSRSKNE----CSQLCLSLNEERNLTKKISSELEmlrV 160
Cdd:TIGR00606  271 IKALKSRKKQMEKDNSELELKMEKVfqgtDEQLNDLYHNHQRTVREKERelvdCQRELEKLNKERRLLNQEKTELL---V 347
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   161 KVKELESSEDRLDktEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHMrnastflernd 240
Cdd:TIGR00606  348 EQGRLQLQADRHQ--EHIRARDSLIQSLATRLELDGFERGPFSERQIKNFHTLVIERQEDEAKTAAQLC----------- 414
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   241 lriedgisSTLSSKESKRKGSLDYLKQVENETRDKSENEKNR-NQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMRAK 319
Cdd:TIGR00606  415 --------ADLQSKERLKQEQADEIRDEKKGLGRTIELKKEIlEKKQEELKFVIKELQQLEGSSDRILELDQELRKAERE 486
                          330       340       350
                   ....*....|....*....|....*....|....
gi 568931356   320 NNDLQDNYLTELNRNRSLASQLEEIKLQVRKQKE 353
Cdd:TIGR00606  487 LSKAEKNSLTETLKKEVKSLQNEKADLDRKLRKL 520
PTZ00121 PTZ00121
MAEBL; Provisional
25-315 2.01e-03

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 42.44  E-value: 2.01e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   25 RRLDELEEATKNLQRAEDELLDLQDKVIQAEGSDSSTLAEIEVLRQRVLKIE--GKDEEIKRAEDLCHTMKEKLEEEENL 102
Cdd:PTZ00121 1230 KKAEEAKKDAEEAKKAEEERNNEEIRKFEEARMAHFARRQAAIKAEEARKADelKKAEEKKKADEAKKAEEKKKADEAKK 1309
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  103 TRELKSEIERLQKRMVDLEKLEEALSRSKNEcsqlclslNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLVSE 182
Cdd:PTZ00121 1310 KAEEAKKADEAKKKAEEAKKKADAAKKKAEE--------AKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKKAD 1381
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  183 LEKLKSLTLSFVNERKylnEKEKENEKIIKELTQKLEQNKKMnrDHMRNASTFLERND---LRIEDGISSTLSSKESKRK 259
Cdd:PTZ00121 1382 AAKKKAEEKKKADEAK---KKAEEDKKKADELKKAAAAKKKA--DEAKKKAEEKKKADeakKKAEEAKKADEAKKKAEEA 1456
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 568931356  260 GSLDYLKQVENETRdKSENEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKK 315
Cdd:PTZ00121 1457 KKAEEAKKKAEEAK-KADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEAKKK 1511
rad50 TIGR00606
rad50; All proteins in this family for which functions are known are involvedin recombination, ...
19-354 2.38e-03

rad50; All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).


Pssm-ID: 129694 [Multi-domain]  Cd Length: 1311  Bit Score: 41.96  E-value: 2.38e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    19 KLQSLSRRLDELEEATKNLQRAEDELLDlqdkviQAEGSDSSTLAEIEVLRQRVLKIEGKDEEIKRAEDLCHTMKEKLEE 98
Cdd:TIGR00606  406 EAKTAAQLCADLQSKERLKQEQADEIRD------EKKGLGRTIELKKEILEKKQEELKFVIKELQQLEGSSDRILELDQE 479
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    99 EENLTREL-----KSEIERLQKRMVDLEKLEEALSRSKNECSQLclslNEERNLTKKISSELEML-RVKVKELESSEDRL 172
Cdd:TIGR00606  480 LRKAERELskaekNSLTETLKKEVKSLQNEKADLDRKLRKLDQE----MEQLNHHTTTRTQMEMLtKDKMDKDEQIRKIK 555
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   173 DKTEQSLVSELEKL---KSLTLSFVNERKYLNEKEKENEKIIKELtQKLEQNKkmnrDHMRNASTFLERNDLRIEDGISS 249
Cdd:TIGR00606  556 SRHSDELTSLLGYFpnkKQLEDWLHSKSKEINQTRDRLAKLNKEL-ASLEQNK----NHINNELESKEEQLSSYEDKLFD 630
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   250 TLSSKESKRK-------------------GSLDYLKQVENETRDKSENEKNRNQEDNKVK-DLNQEIEKLKTQIKHF--- 306
Cdd:TIGR00606  631 VCGSQDEESDlerlkeeieksskqramlaGATAVYSQFITQLTDENQSCCPVCQRVFQTEaELQEFISDLQSKLRLApdk 710
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 568931356   307 -ESLEEELKK-------------MRAKNNDLQDNYLTEL-NRNRSLASQLEEIKLQVRKQKEL 354
Cdd:TIGR00606  711 lKSTESELKKkekrrdemlglapGRQSIIDLKEKEIPELrNKLQKVNRDIQRLKNDIEEQETL 773
CwlO1 COG3883
Uncharacterized N-terminal domain of peptidoglycan hydrolase CwlO [Function unknown];
28-217 3.47e-03

Uncharacterized N-terminal domain of peptidoglycan hydrolase CwlO [Function unknown];


Pssm-ID: 226400 [Multi-domain]  Cd Length: 265  Bit Score: 40.47  E-value: 3.47e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   28 DELEEATKNLQRAEDELLDLQDKViqaegsdSSTLAEIEVLRQRVLKIEgkdEEIKraedlchtmkekleeeenltrELK 107
Cdd:COG3883    38 SKLSELQKEKKNIQNEIESLDNQI-------EEIQSKIDELQKEIDQSK---AEIK---------------------KLQ 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  108 SEIERLQKRMVDLEKLEEALSRS--KNECSQLCL-------SLNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQS 178
Cdd:COG3883    87 KEIAELKENIVERQELLKKRARAmqVNGTATSYIdvilnskSFSDLISRVTAISVIVDADKKILEQQKEDKKSLEEKQAA 166
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 568931356  179 LVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQK 217
Cdd:COG3883   167 LEDKLETLVALQNELETQLNSLNSQKAEKNALIAALAAK 205
Spc7 smart00787
Spc7 kinetochore protein; This domain is found in cell division proteins which are required ...
262-346 4.64e-03

Spc7 kinetochore protein; This domain is found in cell division proteins which are required for kinetochore-spindle association.


Pssm-ID: 197874 [Multi-domain]  Cd Length: 312  Bit Score: 40.39  E-value: 4.64e-03
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    262 LDYLKQVENETRDKSENEKNRNQEdnKVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNrnrSLASQL 341
Cdd:smart00787  188 LRQLKQLEDELEDCDPTELDRAKE--KLKKLLQEIMIKVKKLEELEEELQELESKIEDLTNKKSELNTEIA---EAEKKL 262

                    ....*
gi 568931356    342 EEIKL 346
Cdd:smart00787  263 EQCRG 267
COG1340 COG1340
Uncharacterized coiled-coil protein, contains DUF342 domain [Function unknown];
22-223 4.87e-03

Uncharacterized coiled-coil protein, contains DUF342 domain [Function unknown];


Pssm-ID: 224259 [Multi-domain]  Cd Length: 294  Bit Score: 40.05  E-value: 4.87e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   22 SLSRRLDELEEATKNLQRAEDELLDLQDKVIQaegsDSSTLAEievlrqrvlKIEGKDEEIKRAEDLCHTMKEKLEEEEN 101
Cdd:COG1340     3 AMLDKLDELELKRKQLKEEIEELKEKRDELRK----EASELAE---------KRDELNAKVRELREKAQELREERDEINE 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  102 LTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQ---------------------LCLSLNEERNLTKKISSELEMLRV 160
Cdd:COG1340    70 EVQELKEKRDEINAKLQELRKEYRELKEKRNEFNLggrsikslereierlekkqqtSVLTPEEERELVQKIKELRKELED 149
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 568931356  161 KVKELESSEDRldkteQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKK 223
Cdd:COG1340   150 AKKALEENEKL-----KELKAEIDELKKKAREIHEKIQELANEAQEYHEEMIKLFEEADELRK 207
PRK12704 PRK12704
phosphodiesterase; Provisional
197-353 5.85e-03

phosphodiesterase; Provisional


Pssm-ID: 237177 [Multi-domain]  Cd Length: 520  Bit Score: 40.53  E-value: 5.85e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  197 RKYLNEKEKENEKIIKELTQKLEQNKKmnrDHMRNASTflERNDLRIEdgisstlSSKESKRKgsLDYLKQVENETRDKS 276
Cdd:PRK12704   30 EAKIKEAEEEAKRILEEAKKEAEAIKK---EALLEAKE--EIHKLRNE-------FEKELRER--RNELQKLEKRLLQKE 95
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 568931356  277 ENEKNRNQednkvkDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNRNRSLASqlEEIKLQVRKQKE 353
Cdd:PRK12704   96 ENLDRKLE------LLEKREEELEKKEKELEQKQQELEKKEEELEELIEEQLQELERISGLTA--EEAKEILLEKVE 164
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
15-354 6.37e-03

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 40.72  E-value: 6.37e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    15 HLRFKLQSLSRRLDELEEATKNLQRAEDELLDLQDKVIQAEGSD-------------SSTLAEIEVLRQRVL-----KIE 76
Cdd:TIGR00618  390 TLTQKLQSLCKELDILQREQATIDTRTSAFRDLQGQLAHAKKQQelqqryaelcaaaITCTAQCEKLEKIHLqesaqSLK 469
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    77 GKDEEIKRAEDLCHTMKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTK---KISS 153
Cdd:TIGR00618  470 EREQQLQTKEQIHLQETRKKAVVLARLLELQEEPCPLCGSCIHPNPARQDIDNPGPLTRRMQRGEQTYAQLETseeDVYH 549
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   154 ELEMLRVKVKELESSEDRLDKTEQSLVSELEKLKSL---TLSFVNERKYLNEKEKENEKIIKELTQKL------EQNKKM 224
Cdd:TIGR00618  550 QLTSERKQRASLKEQMQEIQQSFSILTQCDNRSKEDipnLQNITVRLQDLTEKLSEAEDMLACEQHALlrklqpEQDLQD 629
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   225 NRDHMRNAS-------TFLERNDL-----RIEDGISSTLSSKESKRKGSLDYLKQVENETRDKSENEKNRNQEDNKVKDL 292
Cdd:TIGR00618  630 VRLHLQQCSqelalklTALHALQLtltqeRVREHALSIRVLPKELLASRQLALQKMQSEKEQLTYWKEMLAQCQTLLREL 709
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 568931356   293 NQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNRNRSLASQLEEIKLQVRKQKEL 354
Cdd:TIGR00618  710 ETHIEEYDREFNEIENASSSLGSDLAAREDALNQSLKELMHQARTVLKARTEAHFNNNEEVT 771
Tropomyosin pfam00261
Tropomyosin; Tropomyosin is an alpha-helical protein that forms a coiled-coil structure of 2 ...
28-245 6.47e-03

Tropomyosin; Tropomyosin is an alpha-helical protein that forms a coiled-coil structure of 2 parallel helices containing 2 sets of 7 alternating actin binding sites. The protein is best known for its role in regulating the interaction between actin and myosin in muscle contraction, but is also involved in the organisation and dynamics of the cytoskeleton in non-muscle cells. There are multiple cell-specific isoforms, expressed by alternative promoters and alternative RNA processing of at least four genes. Muscle isoforms of tropomyosin are characterized by having 284 amino acid residues and a highly conserved N-terminal region, whereas non-muscle forms are generally smaller and are heterogeneous in their N-terminal region.


Pssm-ID: 395200 [Multi-domain]  Cd Length: 235  Bit Score: 39.24  E-value: 6.47e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    28 DELEEATKNLQRAEDELLDLQDKVIQAEgsdsstlAEIEVLRQRVLKIEgkdEEIKRAEDLCHTMKEKLEEEENLTrelk 107
Cdd:pfam00261    8 EELDEAEERLKEAMKKLEEAEKRAEKAE-------AEVAALNRRIQLLE---EELERTEERLAEALEKLEEAEKAA---- 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   108 SEIERLQKrmvdleKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVK----ELESSEDRLDKTEqSLVSEL 183
Cdd:pfam00261   74 DESERGRK------VLENRALKDEEKMEILEAQLKEAKEIAEEADRKYEEVARKLVvvegDLERAEERAELAE-SKIVEL 146
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   184 EK--------LKSLTLSfvnERKYlNEKEKENEKIIKELTQKLEQNKKMNRDHMRNASTfLERNDLRIED 245
Cdd:pfam00261  147 EEelkvvgnnLKSLEAS---EEKA-SEREDKYEEQIRFLTEKLKEAETRAEFAERSVQK-LEKEVDRLED 211
MAD pfam05557
Mitotic checkpoint protein; This family consists of several eukaryotic mitotic checkpoint ...
37-380 7.66e-03

Mitotic checkpoint protein; This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins. The mitotic spindle checkpoint monitors proper attachment of the bipolar spindle to the kinetochores of aligned sister chromatids and causes a cell cycle arrest in prometaphase when failures occur. Multiple components of the mitotic spindle checkpoint have been identified in yeast and higher eukaryotes. In S.cerevisiae, the existence of a Mad1-dependent complex containing Mad2, Mad3, Bub3 and Cdc20 has been demonstrated.


Pssm-ID: 368498 [Multi-domain]  Cd Length: 660  Bit Score: 40.11  E-value: 7.66e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    37 LQRAEDELLDLQDKVIQAEGSDSSTLAEIEvlRQRVLKIEGKDEEIKRAEDLCHTMKEKLEEEENLTRELKSEIERLQKR 116
Cdd:pfam05557    4 LIESKARLSQLQNEKKQMELEHKRARIELE--KKASALKRQLDRESDRNQELQKRIRLLEKREAEAEEALREQAELNRLK 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   117 MvdleKLEEALSRSKNECSQLCLSLNE-ERNLTKKIS--------SELEmLRVKVKELESSEDRLDKTEQSLvSELEKLK 187
Cdd:pfam05557   82 K----KYLEALNKKLNEKESQLADAREvISCLKNELSelrrqiqrAELE-LQSTNSELEELQERLDLLKAKA-SEAEQLR 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   188 SLTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKKMNRDHMRNAStfLERNDLRIEDGISSTLSSKESKrkgslDYLKQ 267
Cdd:pfam05557  156 QNLEKQQSSLAEAEQRIKELEFEIQSQEQDSEIVKNSKSELARIPE--LEKELERLREHNKHLNENIENK-----LLLKE 228
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   268 VENETRDKSENEKNRNQEdnkVKDLNQEIEKLKTQIKHFESLEEELKKMRAKNNDLQDNYLTELNRNRSLASQLEEIKLQ 347
Cdd:pfam05557  229 EVEDLKRKLEREEKYREE---AATLELEKEKLEQELQSWVKLAQDTGLNLRSPEDLSRRIEQLQQREIVLKEENSSLTSS 305
                          330       340       350
                   ....*....|....*....|....*....|...
gi 568931356   348 VRkQKELGNGDIEGEDAFLLGRGRHERTKLKGH 380
Cdd:pfam05557  306 AR-QLEKARRELEQELAQYLKKIEDLNKKLKRH 337
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
11-223 8.39e-03

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 40.05  E-value: 8.39e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    11 ASNRHLRFKLQSLSRRLDELEEATKNLQRAEDElLDLQDKVIQAEGSDS-----STLAEIEVLRQRVLKIEGKDEEIKRA 85
Cdd:TIGR02169  812 ARLREIEQKLNRLTLEKEYLEKEIQELQEQRID-LKEQIKSIEKEIENLngkkeELEEELEELEAALRDLESRLGDLKKE 890
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    86 EDlchTMKEKLEEEENLTRELKSEIERLQKRMVDL-EKLEEALSRSKnecsqlclSLNEERNLTKKISSELEMLRVKVKE 164
Cdd:TIGR02169  891 RD---ELEAQLRELERKIEELEAQIEKKRKRLSELkAKLEALEEELS--------EIEDPKGEDEEIPEEELSLEDVQAE 959
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 568931356   165 LESSEDRLDKTEQSLVSELEKLKSlTLSFVNERKYLNEKEKENEKIIKELTQKLEQNKK 223
Cdd:TIGR02169  960 LQRVEEEIRALEPVNMLAIQEYEE-VLKRLDELKEKRAKLEEERKAILERIEEYEKKKR 1017
MukB COG3096
Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 ...
8-188 8.68e-03

Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 substr. MG1655 [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 225638 [Multi-domain]  Cd Length: 1480  Bit Score: 40.25  E-value: 8.68e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356    8 KDAASNRHLRFKLQSLSRRLDELEEATKNLQRAEDELLDL---QDKVIQAEgsdsstlaEIEVLRQRVlkiegkdeeikr 84
Cdd:COG3096   503 REGPDQRHLAEQVQPLRMRLSELEQRLRQQQSAERLLADFckrQGKNLDAE--------ELEALHQEL------------ 562
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   85 aEDLCHTMKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISSELEMLRVKVKE 164
Cdd:COG3096   563 -EALIESLSDSVSNAREQRMALRQEQEQLQSRIQSLMQRAPVWLAAQNALEQLSEQSGEEFTDSQDVTEYMQQLLERERE 641
                         170       180
                  ....*....|....*....|....
gi 568931356  165 LESSEDRLDKTEQSLVSELEKLKS 188
Cdd:COG3096   642 ATVERDELGARKNALDEEIERLSQ 665
NIP100 COG5244
Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell cycle ...
72-351 9.53e-03

Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227569 [Multi-domain]  Cd Length: 669  Bit Score: 40.05  E-value: 9.53e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   72 VLKIEGKDEEIKRAEDLCHTMKEKLEEEENLTRELKSEIERLQKRmvdleKLEEALSRSKNecsqlclSLNEERNLTKKI 151
Cdd:COG5244    71 LLNGNAAYEKIKGGLVCESKGMDKDGEIKQENHEDRIHFEESKIR-----RLEETIEALKS-------TEKEEIVELRRE 138
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  152 SSELEMLRVKVKELESSEDRLDKTEQSLVSELEKLKSLTLSFVnerkylneKEKENEKIIKELTQKLEQNKKMNRDHMRN 231
Cdd:COG5244   139 NEELDKINLSLRERISSEEPELNKDGSKLSYDELKEFVEESRV--------QVYDMVELVSDISETLNRNGSIQRSSVRE 210
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  232 ASTFLERNDLRIEDGIsstLSSKESKRKGSLDYLKQVENETRDKSENEKNRNQED----NKVKDLNQEIEKL---KTQIK 304
Cdd:COG5244   211 CERSNIHDVLFLVNGI---LDGVIDELNGELERLRRQLVSLMSSHGIEVEENSRLkatlEKFQSLELKVNTLqeeLYQNK 287
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*..
gi 568931356  305 HFESLEEELKKMRAKNNDLQDNYLTELNRNrSLASQLEEIKLQVRKQ 351
Cdd:COG5244   288 LLKKFYQIYEPFAQAALSSQLQYLAEVIES-ENFGKLENIEIHIILK 333
mycoplas_twoTM TIGR04527
two transmembrane protein; Members of this family are uncharacterized proteins from the genus ...
263-348 9.71e-03

two transmembrane protein; Members of this family are uncharacterized proteins from the genus Mycoplasma, typically about 260 amino acids long, with a hydrophobic predicted transmembrane alpha helix toward each end. Often two family members are encoded in tandem, e.g. MG_279 and MG_280 from Mycoplasma genitalium.


Pssm-ID: 275320 [Multi-domain]  Cd Length: 245  Bit Score: 38.92  E-value: 9.71e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   263 DYLKQVENETRDKSENEKNRNQE-DNKVKDLNQEIEKLKTQI----KHFESLEEELKKMRAKNNDLQDNYLTELNrnrSL 337
Cdd:TIGR04527   40 NYYKQGVNSISSLNNEIKKILDNiNNIIPKITNNLNSLKTDLnktlENVEDVLKELEELKGIANNTDSNIKSTLN---EL 116
                           90
                   ....*....|.
gi 568931356   338 ASQLEEIKLQV 348
Cdd:TIGR04527  117 EGTLRKINNSV 127
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
74-312 9.99e-03

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 39.89  E-value: 9.99e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356   74 KIEGKDEEIKRAEDLCHTMKEKLEEEENLTRELKSEIERLQKRMVDLEKLEEALSRSKNECSQLCLSLNEERNLTKKISS 153
Cdd:NF033930   64 KKKAEDAQKKYDEDQKKTEEKAKKEKKASEEEQKANLAVQKAYVKYRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKA 143
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  154 ELEMLRVKV----KELESSEDRLDKTEQSLVSELEKLKSLTLSFVNERKYLNEKEKENEKIIKELT-------------Q 216
Cdd:NF033930  144 EFNKVRAKVvpeaEELAETKKKAEEAKAEEPVAKKKVDEAKKKVEEAKKKVEAEEAEIEKLQNEEValeakiaelenqvD 223
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568931356  217 KLEQN-KKMNRDHMRNASTFLERNDLRIE-DGISSTLSSKESKRKGSLDYLKQvENETRDKSENEKNRNQEDNKVKDLNQ 294
Cdd:NF033930  224 NLEKElAEIDESDSEDYIKEGLRAPLESElDAKQAKLAKKQTELEKLLDSLDP-EGKTQDELDKEAAEEELSKKIDELDN 302
                         250
                  ....*....|....*...
gi 568931356  295 EIEKLKTQIKHFESLEEE 312
Cdd:NF033930  303 EVAKLEKEVSDLENSDNN 320
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH