NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568947546|ref|XP_006540794|]
View 

alpha-2,8-sialyltransferase 8B isoform X1 [Mus musculus]

Protein Classification

glycosyltransferase family 29 protein (domain architecture ID 10466376)

glycosyltransferase family 29 protein similar to sialyltransferase 8F, an enzyme involved in protein glycosylation that prefers O-glycans to N-glycans or glycolipids as acceptor substrates

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Glyco_transf_29 pfam00777
Glycosyltransferase family 29 (sialyltransferase); Members of this family belong to ...
88-347 4.79e-93

Glycosyltransferase family 29 (sialyltransferase); Members of this family belong to glycosyltransferase family 29.


:

Pssm-ID: 395627  Cd Length: 267  Bit Score: 278.35  E-value: 4.79e-93
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568947546   88 DISVLKGTLKPGDIIHYIF-DRDSTMNVSQNLYELLPR-TSPLKNKH---FQTCAIVGNSGVLLNSGCGQEIDTHSFVIR 162
Cdd:pfam00777   1 PLFLTKENFPLGEWLRYWWgEFKGSYKVLEELLKLLPKpDSPFENKRpdrCRRCAVVGNGGILRGSGCGKEIDSHDFVIR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568947546  163 CNLAPVQEYARDVGLKTDLVTMNP-SVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGgkERVEWVNALILKH 241
Cdd:pfam00777  81 CNLAPTKGYEKDVGSKTTLRTMNPeSIIQSRFGKLKIPLDRDVFLVLLPFKGRDFLWLPAFLTKG--EVSLGVRYFLWKR 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568947546  242 HVNVRTAYPS-LRLLH-----AVRGYWL-TNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFpldQNQNPVKYHYYDSL 314
Cdd:pfam00777 159 VKSYIPADPDkVRILHpdflrYVADFWLrSKGLKARRPSTGALALTLALHLCDEVSLYGFGPF---LDSPGNSYHYYDNK 235
                         250       260       270
                  ....*....|....*....|....*....|...
gi 568947546  315 KYGYTSQASpHTMPLEFKALKSLHEQGALKLTV 347
Cdd:pfam00777 236 MGAMRFTGV-HDMPFEFKLLKKLHKEGVIKLHT 267
 
Name Accession Description Interval E-value
Glyco_transf_29 pfam00777
Glycosyltransferase family 29 (sialyltransferase); Members of this family belong to ...
88-347 4.79e-93

Glycosyltransferase family 29 (sialyltransferase); Members of this family belong to glycosyltransferase family 29.


Pssm-ID: 395627  Cd Length: 267  Bit Score: 278.35  E-value: 4.79e-93
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568947546   88 DISVLKGTLKPGDIIHYIF-DRDSTMNVSQNLYELLPR-TSPLKNKH---FQTCAIVGNSGVLLNSGCGQEIDTHSFVIR 162
Cdd:pfam00777   1 PLFLTKENFPLGEWLRYWWgEFKGSYKVLEELLKLLPKpDSPFENKRpdrCRRCAVVGNGGILRGSGCGKEIDSHDFVIR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568947546  163 CNLAPVQEYARDVGLKTDLVTMNP-SVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGgkERVEWVNALILKH 241
Cdd:pfam00777  81 CNLAPTKGYEKDVGSKTTLRTMNPeSIIQSRFGKLKIPLDRDVFLVLLPFKGRDFLWLPAFLTKG--EVSLGVRYFLWKR 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568947546  242 HVNVRTAYPS-LRLLH-----AVRGYWL-TNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFpldQNQNPVKYHYYDSL 314
Cdd:pfam00777 159 VKSYIPADPDkVRILHpdflrYVADFWLrSKGLKARRPSTGALALTLALHLCDEVSLYGFGPF---LDSPGNSYHYYDNK 235
                         250       260       270
                  ....*....|....*....|....*....|...
gi 568947546  315 KYGYTSQASpHTMPLEFKALKSLHEQGALKLTV 347
Cdd:pfam00777 236 MGAMRFTGV-HDMPFEFKLLKKLHKEGVIKLHT 267
 
Name Accession Description Interval E-value
Glyco_transf_29 pfam00777
Glycosyltransferase family 29 (sialyltransferase); Members of this family belong to ...
88-347 4.79e-93

Glycosyltransferase family 29 (sialyltransferase); Members of this family belong to glycosyltransferase family 29.


Pssm-ID: 395627  Cd Length: 267  Bit Score: 278.35  E-value: 4.79e-93
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568947546   88 DISVLKGTLKPGDIIHYIF-DRDSTMNVSQNLYELLPR-TSPLKNKH---FQTCAIVGNSGVLLNSGCGQEIDTHSFVIR 162
Cdd:pfam00777   1 PLFLTKENFPLGEWLRYWWgEFKGSYKVLEELLKLLPKpDSPFENKRpdrCRRCAVVGNGGILRGSGCGKEIDSHDFVIR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568947546  163 CNLAPVQEYARDVGLKTDLVTMNP-SVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGgkERVEWVNALILKH 241
Cdd:pfam00777  81 CNLAPTKGYEKDVGSKTTLRTMNPeSIIQSRFGKLKIPLDRDVFLVLLPFKGRDFLWLPAFLTKG--EVSLGVRYFLWKR 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568947546  242 HVNVRTAYPS-LRLLH-----AVRGYWL-TNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFpldQNQNPVKYHYYDSL 314
Cdd:pfam00777 159 VKSYIPADPDkVRILHpdflrYVADFWLrSKGLKARRPSTGALALTLALHLCDEVSLYGFGPF---LDSPGNSYHYYDNK 235
                         250       260       270
                  ....*....|....*....|....*....|...
gi 568947546  315 KYGYTSQASpHTMPLEFKALKSLHEQGALKLTV 347
Cdd:pfam00777 236 MGAMRFTGV-HDMPFEFKLLKKLHKEGVIKLHT 267
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH