NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|755548154|ref|XP_011243335|]
View 

homeobox-containing protein 1 isoform X5 [Mus musculus]

Protein Classification

HNF-1_N and homeodomain domain-containing protein (domain architecture ID 11153336)

HNF-1_N and homeodomain domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HNF-1_N pfam04814
Hepatocyte nuclear factor 1 (HNF-1), N-terminus; This family consists of the N-terminus of ...
25-227 5.56e-56

Hepatocyte nuclear factor 1 (HNF-1), N-terminus; This family consists of the N-terminus of homeobox-containing transcription factor HNF-1. This region contains a dimerization sequence and an acidic region that may be involved in transcription activation. Mutations and the common Ala/Val 98 polymorphism in HNF-1 cause the type 3 form of maturity-onset diabetes of the young (MODY3).


:

Pssm-ID: 398470  Cd Length: 167  Bit Score: 181.89  E-value: 5.56e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755548154   25 EQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK-FGRRSSYGGSSYGNStnnVPASSSTATASTQTQHSGMSPSPSN 103
Cdd:pfam04814   1 LQIELLQRLLRSGLTKEELIHALEDLEPLDPEFGVKlEKLPLSPGGSCDSKP---VFTTLPNGAGPSSKLSGDESSSDGN 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755548154  104 SYDTSPLPcttnqngrENNDRLSTsngkmspsryhansmgqrsysfeasEEDLDVDDKVEELMRRDSSVIKEEIKAFLAN 183
Cdd:pfam04814  78 DYDTPPIL--------KELEDLDT-------------------------EEAAHQRAEVERLLREDPWRVAEMIKGYLQQ 124
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 755548154  184 RRISQAVVAQVTGISQSRISHWLLqQGSDLSEQKKRAFYRWYQL 227
Cdd:pfam04814 125 HNIPQREVVDVTGLNQSHLSQHLN-KGTPMKTQKRAALYTWYVR 167
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
268-340 7.99e-10

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


:

Pssm-ID: 238039  Cd Length: 59  Bit Score: 54.17  E-value: 7.99e-10
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 755548154 268 RGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNaviqkpgkklsdlerVTSLKVYNWFANRRKEIKRR 340
Cdd:cd00086    1 RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELG---------------LTERQVKIWFQNRRAKLKRS 58
 
Name Accession Description Interval E-value
HNF-1_N pfam04814
Hepatocyte nuclear factor 1 (HNF-1), N-terminus; This family consists of the N-terminus of ...
25-227 5.56e-56

Hepatocyte nuclear factor 1 (HNF-1), N-terminus; This family consists of the N-terminus of homeobox-containing transcription factor HNF-1. This region contains a dimerization sequence and an acidic region that may be involved in transcription activation. Mutations and the common Ala/Val 98 polymorphism in HNF-1 cause the type 3 form of maturity-onset diabetes of the young (MODY3).


Pssm-ID: 398470  Cd Length: 167  Bit Score: 181.89  E-value: 5.56e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755548154   25 EQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK-FGRRSSYGGSSYGNStnnVPASSSTATASTQTQHSGMSPSPSN 103
Cdd:pfam04814   1 LQIELLQRLLRSGLTKEELIHALEDLEPLDPEFGVKlEKLPLSPGGSCDSKP---VFTTLPNGAGPSSKLSGDESSSDGN 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755548154  104 SYDTSPLPcttnqngrENNDRLSTsngkmspsryhansmgqrsysfeasEEDLDVDDKVEELMRRDSSVIKEEIKAFLAN 183
Cdd:pfam04814  78 DYDTPPIL--------KELEDLDT-------------------------EEAAHQRAEVERLLREDPWRVAEMIKGYLQQ 124
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 755548154  184 RRISQAVVAQVTGISQSRISHWLLqQGSDLSEQKKRAFYRWYQL 227
Cdd:pfam04814 125 HNIPQREVVDVTGLNQSHLSQHLN-KGTPMKTQKRAALYTWYVR 167
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
268-340 7.99e-10

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 54.17  E-value: 7.99e-10
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 755548154 268 RGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNaviqkpgkklsdlerVTSLKVYNWFANRRKEIKRR 340
Cdd:cd00086    1 RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELG---------------LTERQVKIWFQNRRAKLKRS 58
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
267-338 4.91e-08

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 49.17  E-value: 4.91e-08
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 755548154   267 RRGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNaviqkpgkkLSdlERVtslkVYNWFANRRKEIK 338
Cdd:smart00389   1 KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLG---------LS--ERQ----VKVWFQNRRAKWK 57
Homeobox pfam00046
Homeobox domain;
271-339 8.00e-08

Homeobox domain;


Pssm-ID: 395001  Cd Length: 55  Bit Score: 48.26  E-value: 8.00e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 755548154  271 RFTwrKECLAVMESYFNENQYPDEAKREEIANACNaviqkpgkkLSdlERVtslkVYNWFANRRKEIKR 339
Cdd:pfam00046   4 TFT--PEQLEELEKEFQKNPYPSREEREELAAQLG---------LT--ERQ----VKVWFQNRRAKWKR 55
HTH_XRE cd00093
Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the ...
175-205 9.26e-03

Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.


Pssm-ID: 238045 [Multi-domain]  Cd Length: 58  Bit Score: 34.45  E-value: 9.26e-03
                         10        20        30
                 ....*....|....*....|....*....|.
gi 755548154 175 EEIKAFLANRRISQAVVAQVTGISQSRISHW 205
Cdd:cd00093    2 ERLKELRKEKGLTQEELAEKLGVSRSTISRI 32
 
Name Accession Description Interval E-value
HNF-1_N pfam04814
Hepatocyte nuclear factor 1 (HNF-1), N-terminus; This family consists of the N-terminus of ...
25-227 5.56e-56

Hepatocyte nuclear factor 1 (HNF-1), N-terminus; This family consists of the N-terminus of homeobox-containing transcription factor HNF-1. This region contains a dimerization sequence and an acidic region that may be involved in transcription activation. Mutations and the common Ala/Val 98 polymorphism in HNF-1 cause the type 3 form of maturity-onset diabetes of the young (MODY3).


Pssm-ID: 398470  Cd Length: 167  Bit Score: 181.89  E-value: 5.56e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755548154   25 EQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK-FGRRSSYGGSSYGNStnnVPASSSTATASTQTQHSGMSPSPSN 103
Cdd:pfam04814   1 LQIELLQRLLRSGLTKEELIHALEDLEPLDPEFGVKlEKLPLSPGGSCDSKP---VFTTLPNGAGPSSKLSGDESSSDGN 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755548154  104 SYDTSPLPcttnqngrENNDRLSTsngkmspsryhansmgqrsysfeasEEDLDVDDKVEELMRRDSSVIKEEIKAFLAN 183
Cdd:pfam04814  78 DYDTPPIL--------KELEDLDT-------------------------EEAAHQRAEVERLLREDPWRVAEMIKGYLQQ 124
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 755548154  184 RRISQAVVAQVTGISQSRISHWLLqQGSDLSEQKKRAFYRWYQL 227
Cdd:pfam04814 125 HNIPQREVVDVTGLNQSHLSQHLN-KGTPMKTQKRAALYTWYVR 167
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
268-340 7.99e-10

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 54.17  E-value: 7.99e-10
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 755548154 268 RGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNaviqkpgkklsdlerVTSLKVYNWFANRRKEIKRR 340
Cdd:cd00086    1 RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELG---------------LTERQVKIWFQNRRAKLKRS 58
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
267-338 4.91e-08

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 49.17  E-value: 4.91e-08
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 755548154   267 RRGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNaviqkpgkkLSdlERVtslkVYNWFANRRKEIK 338
Cdd:smart00389   1 KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLG---------LS--ERQ----VKVWFQNRRAKWK 57
Homeobox pfam00046
Homeobox domain;
271-339 8.00e-08

Homeobox domain;


Pssm-ID: 395001  Cd Length: 55  Bit Score: 48.26  E-value: 8.00e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 755548154  271 RFTwrKECLAVMESYFNENQYPDEAKREEIANACNaviqkpgkkLSdlERVtslkVYNWFANRRKEIKR 339
Cdd:pfam00046   4 TFT--PEQLEELEKEFQKNPYPSREEREELAAQLG---------LT--ERQ----VKVWFQNRRAKWKR 55
HTH_37 pfam13744
Helix-turn-helix domain; Members of this family contains a DNA-binding helix-turn-helix domain.
154-217 2.71e-03

Helix-turn-helix domain; Members of this family contains a DNA-binding helix-turn-helix domain.


Pssm-ID: 404609  Cd Length: 80  Bit Score: 36.42  E-value: 2.71e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 755548154  154 EDLDVDDkvEELMRRDSSVIKEeIKAFLANRRISQAVVAQVTGISQSRISHWLLQQGSDLSEQK 217
Cdd:pfam13744   3 ADLGFED--AEELQAKAQLARA-IARLIEGRGLSQQEAAALLGIAQPKVSRLLRGKLSRFSLDR 63
HTH_XRE cd00093
Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the ...
175-205 9.26e-03

Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.


Pssm-ID: 238045 [Multi-domain]  Cd Length: 58  Bit Score: 34.45  E-value: 9.26e-03
                         10        20        30
                 ....*....|....*....|....*....|.
gi 755548154 175 EEIKAFLANRRISQAVVAQVTGISQSRISHW 205
Cdd:cd00093    2 ERLKELRKEKGLTQEELAEKLGVSRSTISRI 32
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH