NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1785337885|ref|XP_012825354|]
View 

two pore calcium channel protein 1 [Xenopus tropicalis]

Protein Classification

ion transporter (domain architecture ID 11997982)

ion transporter such as a voltage-gated cation channel, which enables the selective translocation of cations such as sodium, calcium, or potassium, across cell membranes

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
432-683 3.70e-23

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 98.88  E-value: 3.70e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 432 SRVFQYIMYAVVAINgFWILAETFMLQGGNYFPEGVPWSYIVFLTIYGSELLLKLTGLGPV-EYFTSGWNFFDCSVTLLA 510
Cdd:pfam00520   1 SRYFELFILLLILLN-TIFLALETYFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKkRYFRSPWNILDFVVVLPS 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 511 LLGLLVlaFNMKPFYFIVVLRPLQLLRLFKMKKR---YRTVLDTMFELLPRMASLGLTLLIFYYSFSIVGMEFFSGVLyp 587
Cdd:pfam00520  80 LISLVL--SSVGSLSGLRVLRLLRLLRLLRLIRRlegLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 588 nccntstvadsYRWLNRTVGNqtqfeegyyylNNFNNILNSFVTLFELTVVNNWYIIMEGVT-SQTSHWARLYFMVFYIV 666
Cdd:pfam00520 156 -----------KTWENPDNGR-----------TNFDNFPNAFLWLFQTMTTEGWGDIMYDTIdGKGEFWAYIYFVSFIIL 213
                         250
                  ....*....|....*...
gi 1785337885 667 TMVVLT-IIVACILDSFV 683
Cdd:pfam00520 214 GGFLLLnLFIAVIIDNFQ 231
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
144-322 1.05e-19

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 88.86  E-value: 1.05e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 144 VFELAMKMRWLG-GKTFLRHRRTMLKSAVLVVQFIEAIVVLVRQTSHV---RVTRALRPIFLVdcRYCGAVRRNLRQIFQ 219
Cdd:pfam00520  47 TLEMLLKIIAAGfKKRYFRSPWNILDFVVVLPSLISLVLSSVGSLSGLrvlRLLRLLRLLRLI--RRLEGLRTLVNSLIR 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 220 SLPPFIDILLLLLFFMVIFAILGFYLF--------SSDPNDPYFSTLENSLVSLFVLLTTANFPDVMMPAYSR--NPWSC 289
Cdd:pfam00520 125 SLKSLGNLLLLLLLFLFIFAIIGYQLFggklktweNPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGkgEFWAY 204
                         170       180       190
                  ....*....|....*....|....*....|...
gi 1785337885 290 IFFIIYLSIELYFIMNLLLAVVFDTFNDIEKKK 322
Cdd:pfam00520 205 IYFVSFIILGGFLLLNLFIAVIIDNFQELTERT 237
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
432-683 3.70e-23

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 98.88  E-value: 3.70e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 432 SRVFQYIMYAVVAINgFWILAETFMLQGGNYFPEGVPWSYIVFLTIYGSELLLKLTGLGPV-EYFTSGWNFFDCSVTLLA 510
Cdd:pfam00520   1 SRYFELFILLLILLN-TIFLALETYFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKkRYFRSPWNILDFVVVLPS 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 511 LLGLLVlaFNMKPFYFIVVLRPLQLLRLFKMKKR---YRTVLDTMFELLPRMASLGLTLLIFYYSFSIVGMEFFSGVLyp 587
Cdd:pfam00520  80 LISLVL--SSVGSLSGLRVLRLLRLLRLLRLIRRlegLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 588 nccntstvadsYRWLNRTVGNqtqfeegyyylNNFNNILNSFVTLFELTVVNNWYIIMEGVT-SQTSHWARLYFMVFYIV 666
Cdd:pfam00520 156 -----------KTWENPDNGR-----------TNFDNFPNAFLWLFQTMTTEGWGDIMYDTIdGKGEFWAYIYFVSFIIL 213
                         250
                  ....*....|....*...
gi 1785337885 667 TMVVLT-IIVACILDSFV 683
Cdd:pfam00520 214 GGFLLLnLFIAVIIDNFQ 231
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
144-322 1.05e-19

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 88.86  E-value: 1.05e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 144 VFELAMKMRWLG-GKTFLRHRRTMLKSAVLVVQFIEAIVVLVRQTSHV---RVTRALRPIFLVdcRYCGAVRRNLRQIFQ 219
Cdd:pfam00520  47 TLEMLLKIIAAGfKKRYFRSPWNILDFVVVLPSLISLVLSSVGSLSGLrvlRLLRLLRLLRLI--RRLEGLRTLVNSLIR 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 220 SLPPFIDILLLLLFFMVIFAILGFYLF--------SSDPNDPYFSTLENSLVSLFVLLTTANFPDVMMPAYSR--NPWSC 289
Cdd:pfam00520 125 SLKSLGNLLLLLLLFLFIFAIIGYQLFggklktweNPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGkgEFWAY 204
                         170       180       190
                  ....*....|....*....|....*....|...
gi 1785337885 290 IFFIIYLSIELYFIMNLLLAVVFDTFNDIEKKK 322
Cdd:pfam00520 205 IYFVSFIILGGFLLLNLFIAVIIDNFQELTERT 237
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
432-683 3.70e-23

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 98.88  E-value: 3.70e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 432 SRVFQYIMYAVVAINgFWILAETFMLQGGNYFPEGVPWSYIVFLTIYGSELLLKLTGLGPV-EYFTSGWNFFDCSVTLLA 510
Cdd:pfam00520   1 SRYFELFILLLILLN-TIFLALETYFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKkRYFRSPWNILDFVVVLPS 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 511 LLGLLVlaFNMKPFYFIVVLRPLQLLRLFKMKKR---YRTVLDTMFELLPRMASLGLTLLIFYYSFSIVGMEFFSGVLyp 587
Cdd:pfam00520  80 LISLVL--SSVGSLSGLRVLRLLRLLRLLRLIRRlegLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 588 nccntstvadsYRWLNRTVGNqtqfeegyyylNNFNNILNSFVTLFELTVVNNWYIIMEGVT-SQTSHWARLYFMVFYIV 666
Cdd:pfam00520 156 -----------KTWENPDNGR-----------TNFDNFPNAFLWLFQTMTTEGWGDIMYDTIdGKGEFWAYIYFVSFIIL 213
                         250
                  ....*....|....*...
gi 1785337885 667 TMVVLT-IIVACILDSFV 683
Cdd:pfam00520 214 GGFLLLnLFIAVIIDNFQ 231
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
144-322 1.05e-19

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 88.86  E-value: 1.05e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 144 VFELAMKMRWLG-GKTFLRHRRTMLKSAVLVVQFIEAIVVLVRQTSHV---RVTRALRPIFLVdcRYCGAVRRNLRQIFQ 219
Cdd:pfam00520  47 TLEMLLKIIAAGfKKRYFRSPWNILDFVVVLPSLISLVLSSVGSLSGLrvlRLLRLLRLLRLI--RRLEGLRTLVNSLIR 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1785337885 220 SLPPFIDILLLLLFFMVIFAILGFYLF--------SSDPNDPYFSTLENSLVSLFVLLTTANFPDVMMPAYSR--NPWSC 289
Cdd:pfam00520 125 SLKSLGNLLLLLLLFLFIFAIIGYQLFggklktweNPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGkgEFWAY 204
                         170       180       190
                  ....*....|....*....|....*....|...
gi 1785337885 290 IFFIIYLSIELYFIMNLLLAVVFDTFNDIEKKK 322
Cdd:pfam00520 205 IYFVSFIILGGFLLLNLFIAVIIDNFQELTERT 237
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH