NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1034659269|ref|XP_016868583|]
View 

alpha-1A adrenergic receptor isoform X1 [Homo sapiens]

Protein Classification

7tmA_alpha1A_AR domain-containing protein (domain architecture ID 11607400)

7tmA_alpha1A_AR domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_alpha1A_AR cd15325
alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G ...
27-337 0e+00

alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


:

Pssm-ID: 320448 [Multi-domain]  Cd Length: 261  Bit Score: 507.12  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15325     1 IVLGVILGGFILFGVLGNILVILSVACHRHLQTVTHYFIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVL 186
Cdd:cd15325    81 VLCCTASIMSLCIISIDRYIGVSYPLRYPSIMTERRGLLALLCVWVLSLVISIGPLFGWKEPAPEDETICQITEEPGYAL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 187 FSALGSFYLPLAIILVMYCRVYVVAkresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrlLKFSR 266
Cdd:cd15325   161 FSALGSFYLPLAIILVMYCRVYVVA--------------------------------------------------LKFSR 190
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1034659269 267 EKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15325   191 EKKAAKTLGIVVGCFVLCWLPFFLVMPIGSIFPAYKPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAF 261
 
Name Accession Description Interval E-value
7tmA_alpha1A_AR cd15325
alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G ...
27-337 0e+00

alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320448 [Multi-domain]  Cd Length: 261  Bit Score: 507.12  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15325     1 IVLGVILGGFILFGVLGNILVILSVACHRHLQTVTHYFIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVL 186
Cdd:cd15325    81 VLCCTASIMSLCIISIDRYIGVSYPLRYPSIMTERRGLLALLCVWVLSLVISIGPLFGWKEPAPEDETICQITEEPGYAL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 187 FSALGSFYLPLAIILVMYCRVYVVAkresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrlLKFSR 266
Cdd:cd15325   161 FSALGSFYLPLAIILVMYCRVYVVA--------------------------------------------------LKFSR 190
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1034659269 267 EKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15325   191 EKKAAKTLGIVVGCFVLCWLPFFLVMPIGSIFPAYKPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAF 261
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
43-326 8.49e-78

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 394960 [Multi-domain]  Cd Length: 256  Bit Score: 243.36  E-value: 8.49e-78
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVL-GYWAFGRVFCNIWAAVDVLCCTASIMGLCIIS 121
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFGLLTLPFWLVYYLLhGDWPFGSALCKLVGALFYVNMYASILLLTAIS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 122 IDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPL-FGWRQPAPEDE-TICQIN------EEPGYVLFSALGSF 193
Cdd:pfam00001  81 IDRYLAIVHPLRYRRIRTPRRAKVLILLVWVLALLLSLPPLlFGWTLTVPEGNvTVCLIDfpedlvKPVSYTLLISVLGF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 194 YLPLAIILVMYCRVYVVAKRESRGLKSGLKTDksdseqvtlrihrknapaggsgmasaktkthfsvrllkfsREKKAAKT 273
Cdd:pfam00001 161 LLPLLVILVCYTRIYRTLRKSASKQKSEERTQ----------------------------------------RRRKALKT 200
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1034659269 274 LGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVF---WLGYLNSCINPIIY 326
Cdd:pfam00001 201 LAVVVVVFILCWLPYHIVLLLDSLALDCELSRLLDKALSvtlWLAYVNSCLNPIIY 256
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
18-343 2.05e-24

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 103.70  E-value: 2.05e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  18 PAPVNI---SKAILLGVILGGLILFGVLGNILVILsVACHRHLHSVTHYYIVNLAVADLLLTSTvLPFSAIFEVLGYWAF 94
Cdd:PHA03087   29 DCDLNIgydTNSTILIVVYSTIFFFGLVGNIIVIY-VLTKTKIKTPMDIYLLNLAVSDLLFVMT-LPFQIYYYILFQWSF 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  95 GRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDET 174
Cdd:PHA03087  107 GEFACKIVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKDHETL 186
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 175 ICQI------NEEPGYVLF--SALGsFYLPLAIILVMYCRVYVVAKRESrglksglktdksdseqvtlrihrknapaggs 246
Cdd:PHA03087  187 ICCMfynnktMNWKLFINFeiNIIG-MLIPLTILLYCYSKILITLKGIN------------------------------- 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 247 gmasaktkthfsvrllKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFP-DFKPSETVFKIVFWLGY-------LN 318
Cdd:PHA03087  235 ----------------KSKKNKKAIKLVLIIVILFVIFWLPFNVSVFVYSLHIlHFKSGCKAVKYIQYALHvteiislSH 298
                         330       340
                  ....*....|....*....|....*
gi 1034659269 319 SCINPIIYPCSSQEFKKAFQNVLRI 343
Cdd:PHA03087  299 CCINPLIYAFVSEFFNKHKKKSLKL 323
 
Name Accession Description Interval E-value
7tmA_alpha1A_AR cd15325
alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G ...
27-337 0e+00

alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320448 [Multi-domain]  Cd Length: 261  Bit Score: 507.12  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15325     1 IVLGVILGGFILFGVLGNILVILSVACHRHLQTVTHYFIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVL 186
Cdd:cd15325    81 VLCCTASIMSLCIISIDRYIGVSYPLRYPSIMTERRGLLALLCVWVLSLVISIGPLFGWKEPAPEDETICQITEEPGYAL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 187 FSALGSFYLPLAIILVMYCRVYVVAkresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrlLKFSR 266
Cdd:cd15325   161 FSALGSFYLPLAIILVMYCRVYVVA--------------------------------------------------LKFSR 190
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1034659269 267 EKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15325   191 EKKAAKTLGIVVGCFVLCWLPFFLVMPIGSIFPAYKPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAF 261
7tmA_alpha1_AR cd15062
alpha-1 adrenergic receptors, member of the class A family of seven-transmembrane G ...
27-337 5.30e-159

alpha-1 adrenergic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320190 [Multi-domain]  Cd Length: 261  Bit Score: 450.79  E-value: 5.30e-159
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15062     1 IVVGVALGAFILFAIGGNLLVILSVACNRHLRTPTHYFIVNLAVADLLLSFTVLPFSATLEVLGYWAFGRIFCDVWAAVD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVL 186
Cdd:cd15062    81 VLCCTASIMSLCVISVDRYIGVRYPLNYPTIVTARRATVALLIVWVLSLVISIGPLLGWKEPAPADEQACGVNEEPGYVL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 187 FSALGSFYLPLAIILVMYCRVYVVAkresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrlLKFSR 266
Cdd:cd15062   161 FSSLGSFYLPLAIILVMYCRVYVVA--------------------------------------------------FKFSR 190
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1034659269 267 EKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15062   191 EKKAAKTLGIVVGAFVLCWFPFFVVLPLGSLFSTLKPPEPVFKVVFWLGYFNSCLNPIIYPCSSREFKRAF 261
7tmA_alpha1B_AR cd15326
alpha-1 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G ...
27-337 8.07e-148

alpha-1 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320449 [Multi-domain]  Cd Length: 261  Bit Score: 422.38  E-value: 8.07e-148
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15326     1 ILLGLVLGAFILFAIVGNILVILSVVCNRHLRIPTNYFIVNLAIADLLLSFTVLPFSATLEILGYWVFGRIFCDIWAAVD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVL 186
Cdd:cd15326    81 VLCCTASILSLCAISIDRYIGVRHSLQYPTIVTRKRAILALLGVWVLSTVISIGPLLGWKEPAPPDDKVCEITEEPFYAL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 187 FSALGSFYLPLAIILVMYCRVYVVAkresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrlLKFSR 266
Cdd:cd15326   161 FSSLGSFYIPLIVILVMYCRVYIVA--------------------------------------------------LKFSR 190
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1034659269 267 EKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15326   191 EKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSHLKPPETLFKIIFWLGYFNSCLNPIIYPCSSKEFKRAF 261
7tmA_alpha1D_AR cd15327
alpha-1 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G ...
29-337 1.43e-140

alpha-1 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320450 [Multi-domain]  Cd Length: 261  Bit Score: 403.91  E-value: 1.43e-140
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  29 LGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVL 108
Cdd:cd15327     3 VGVFLAIFILMAIVGNILVILSVACNRHLQTVTNYFIVNLAIADLLLSTTVLPFSATLEVLGFWAFGRVFCDIWAAVDVL 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 109 CCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFS 188
Cdd:cd15327    83 CCTASILSLCVISVDRYVGVKHSLKYPTIMTERKAGVILVLLWVSSMVISIGPLLGWKEPPPPDESICSITEEPGYALFS 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 189 ALGSFYLPLAIILVMYCRVYVVAkresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrlLKFSREK 268
Cdd:cd15327   163 SLFSFYLPLMVILVMYFRVYVVA--------------------------------------------------LKFSREK 192
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1034659269 269 KAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15327   193 KAAKTLAIVVGVFILCWFPFFFVLPLGSFFPALKPSEMVFKVIFWLGYFNSCVNPIIYPCSSKEFKRAF 261
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
28-337 9.62e-113

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098 [Multi-domain]  Cd Length: 259  Bit Score: 332.99  E-value: 9.62e-113
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  28 LLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDV 107
Cdd:cd14967     1 LLAVFLSLIILVTVFGNLLVILAVYRNRRLRTVTNYFIVSLAVADLLVALLVMPFSAVYTLLGYWPFGPVLCRFWIALDV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 108 LCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPA--PEDETICQINEEPGYV 185
Cdd:cd14967    81 LCCTASILNLCAISLDRYLAITRPLRYRQLMTKKRALIMIAAVWVYSLLISLPPLVGWRDETqpSVVDCECEFTPNKIYV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 186 LFSALGSFYLPLAIILVMYCRVYVVAKresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrllkfs 265
Cdd:cd14967   161 LVSSVISFFIPLLIMIVLYARIFRVAR----------------------------------------------------- 187
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1034659269 266 REKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd14967   188 RELKAAKTLAIIVGAFLLCWLPFFIIYLVSAFCPPDCVPPILYAVFFWLGYLNSALNPIIYALFNRDFRRAF 259
7tmA_5-HT1_5_7 cd15064
serotonin receptor subtypes 1, 5 and 7, member of the class A family of seven-transmembrane G ...
27-337 1.61e-102

serotonin receptor subtypes 1, 5 and 7, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes serotonin receptor subtypes 1, 5, and 7 that are activated by the neurotransmitter serotonin. The 5-HT1 and 5-HT5 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family. The 5-HT1 receptor subfamily includes 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as 5-HT2C receptor. The 5-HT5A and 5-HT5B receptors have been cloned from rat and mouse, but only the 5-HT5A isoform has been identified in human because of the presence of premature stop codons in the human 5-HT5B gene, which prevents a functional receptor from being expressed. The 5-HT7 receptor is coupled to Gs, which positively stimulates adenylate cyclase activity, leading to increased intracellular cAMP formation and calcium influx. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320192 [Multi-domain]  Cd Length: 258  Bit Score: 306.95  E-value: 1.61e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15064     1 VLISVLLSLIILATILGNALVIAAILLTRKLHTPANYLIASLAVADLLVAVLVMPLSAVYELTGRWILGQVLCDIWISLD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVL 186
Cdd:cd15064    81 VTCCTASILHLCVIALDRYWAITDAVEYAHKRTPKRAAVMIALVWTLSICISLPPLFGWRTPDSEDPSECLISQDIGYTI 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 187 FSALGSFYLPLAIILVMYCRVYVVAKresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrllkfsR 266
Cdd:cd15064   161 FSTFGAFYIPLLLMLILYWKIYRAAA-----------------------------------------------------R 187
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1034659269 267 EKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15064   188 ERKAAKTLGIILGAFIVCWLPFFLVALIVPLCSHCWIPLALKSFFLWLGYFNSLINPLIYTFFNKDFRKAF 258
7tmA_Dop1R2-like cd15067
dopamine 1-like receptor 2 from Drosophila melanogaster and similar proteins, member of the ...
28-337 1.61e-91

dopamine 1-like receptor 2 from Drosophila melanogaster and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled dopamine 1-like receptor 2 is expressed in Drosophila heads and it shows significant sequence similarity with vertebrate and invertebrate dopamine receptors. Although the Drosophila Dop1R2 receptor does not cluster into the D1-like structural group, it does show pharmacological properties similar to D1-like receptors. As shown in vertebrate D1-like receptors, agonist stimulation of Dop1R2 activates adenylyl cyclase to increase cAMP levels and also generates a calcium signal through stimulation of phospholipase C.


Pssm-ID: 320195 [Multi-domain]  Cd Length: 262  Bit Score: 278.86  E-value: 1.61e-91
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  28 LLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLG-YWAFGRVFCNIWAAVD 106
Cdd:cd15067     1 LLGVVLSLFCLVTVAGNLLVILAVLRERYLRTVTNYFIVSLAVADLLVGSIVMPFSILHEMTGgYWLFGRDWCDVWHSFD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWR--QPAPEDETICQINEEPGY 184
Cdd:cd15067    81 VLASTASILNLCVISLDRYWAITDPISYPSRMTKRRALIMIALVWICSALISFPAIAWWRavDPGPSPPNQCLFTDDSGY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 185 VLFSALGSFYLPLAIILVMYCRVYVVAkresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrllkf 264
Cdd:cd15067   161 LIFSSCVSFYIPLVVMLFTYYRIYRAA----------------------------------------------------- 187
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1034659269 265 SREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD--FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15067   188 AKEQKAAKTLGIVMGVFILCWLPFFVTNILIGFCPSncVSNPDILFPLVTWLGYINSGMNPIIYACSSRDFRRAF 262
7tmA_alpha2_AR cd15059
alpha-2 adrenergic receptors, member of the class A family of seven-transmembrane G ...
27-337 2.38e-89

alpha-2 adrenergic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320187 [Multi-domain]  Cd Length: 261  Bit Score: 273.06  E-value: 2.38e-89
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15059     1 VAISSIVSVVILLIIVGNVLVIVAVLTSRKLRAPQNWFLVSLAVADILVGLLIMPFSLVNELMGYWYFGSVWCEIWLALD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWR--QPAPEDETICQINEEPGY 184
Cdd:cd15059    81 VLFCTASIVNLCAISLDRYWSVTQAVEYNLKRTPRRAKAMIAAVWIISAVISLPPLFGWKdeQPWHGAEPQCELSDDPGY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 185 VLFSALGSFYLPLAIILVMYCRVYVVAKResrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrllkf 264
Cdd:cd15059   161 VLFSSIGSFYIPLLIMIIVYARIYRAAKR--------------------------------------------------- 189
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034659269 265 sREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15059   190 -KERRFTLVLGVVMGAFVLCWLPFFFTYPLVVVCKTCGVPELLFKFFFWLGYCNSALNPVIYTIFNKDFRRAF 261
7tmA_Histamine_H2R cd15051
histamine subtype H2 receptor, member of the class A family of seven-transmembrane G ...
27-337 4.79e-89

histamine subtype H2 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine receptor subtype H2R, a member of histamine receptor family, which belongs to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). The H2R subtype selectively interacts with the G(s)-type G protein that activates adenylate cyclase, leading to increased cAMP production and activation of Protein Kinase A. H2R is found in various tissues such as the brain, stomach, and heart. Its most prominent role is in histamine-induced gastric acid secretion. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320179 [Multi-domain]  Cd Length: 287  Bit Score: 273.44  E-value: 4.79e-89
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15051     1 IVLGVVLAVIILLTVIGNVLVCLAVAVNRRLRNLTNYFIVSLAVTDLLLGLLVLPFSAIYELRGEWPLGPVFCNIYISLD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPL-FGWRQPAP-----EDETICQINE 180
Cdd:cd15051    81 VMLCTASILNLFAISLDRYLAITAPLRYPSRVTPRRVAIALAAIWVVSLAVSFLPIhLGWNTPDGrvqngDTPNQCRFEL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 181 EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQvtlrihrknapaggsgmaSAKTKthfsvr 260
Cdd:cd15051   161 NPPYVLLVAIGTFYLPLLIMCGVYLRIFRIAREQAKRINALTPASTANSSK------------------SAATA------ 216
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1034659269 261 llkfsREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDfKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15051   217 -----REHKATVTLAAVLGAFIICWFPYFTYFTYRGLCGD-NINETALSVVLWLGYANSALNPILYAFLNRDFRRAF 287
7tmA_5-HT7 cd15329
serotonin receptor subtype 7, member of the class A family of seven-transmembrane G ...
27-337 7.12e-88

serotonin receptor subtype 7, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT7 receptor, one of 14 mammalian serotonin receptors, is a member of the class A of GPCRs and is activated by the neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). 5-HT7 receptor mainly couples to Gs protein, which positively stimulates adenylate cyclase, leading to increased intracellular cAMP formation and calcium influx. 5-HT7 receptor is expressed in various human tissues, mainly in the brain, the lower gastrointestinal tract and in vital blood vessels including the coronary artery. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320452 [Multi-domain]  Cd Length: 260  Bit Score: 269.14  E-value: 7.12e-88
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15329     1 VLIGIVLLIIILGTVVGNALVIIAVCLVKKLRTPSNYLIVSLAVSDLLVALLVMPLAIIYELSGYWPFGEILCDVWISFD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPApEDETICQINEEPGYVL 186
Cdd:cd15329    81 VLLCTASILNLCAISVDRYLVITRPLTYAVKRTPKRMALMIAIVWLLSALISIPPLFGWKNKV-NDPGVCQVSQDFGYQI 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 187 FSALGSFYLPLAIILVMYCRVYVVAKresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrllkfsR 266
Cdd:cd15329   160 YATFGAFYIPLIVMLVLYYKIYRAAK-----------------------------------------------------S 186
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1034659269 267 EKKAAKTLGIVVGCFVLCWLPFF---LVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15329   187 ERKAIKTLGIIMGAFTLCWLPFFilaLLRPFLKPIKCSCIPLWLSRLFLWLGYANSFLNPIIYAKFNREFRTPF 260
7tmA_Ap5-HTB1-like cd15065
serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of ...
28-337 8.81e-86

serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes Aplysia californica serotonin receptors Ap5-HTB1 and Ap5-HTB2, and similar proteins from bilateria including insects, mollusks, annelids, and worms. Ap5-HTB1 is one of the several different receptors for 5-hydroxytryptamine (5HT, serotonin). In Aplysia, serotonin plays important roles in a variety of behavioral and physiological processes mediated by the central nervous system. These include circadian clock, feeding, locomotor movement, cognition and memory, synaptic growth and synaptic plasticity. Both Ap5-HTB1 and Ap5-HTB2 receptors are coupled to G-proteins that stimulate phospholipase C, leading to the activation of phosphoinositide metabolism. Ap5-HTB1 is expressed in the reproductive system, whereas Ap5-HTB2 is expressed in the central nervous system.


Pssm-ID: 320193 [Multi-domain]  Cd Length: 300  Bit Score: 265.37  E-value: 8.81e-86
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  28 LLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDV 107
Cdd:cd15065     1 LIGIFLSLIIVLAIFGNVLVCLAIFTDRRLRKKSNLFIVSLAVADLLVALLVMTFAVVNDLLGYWLFGETFCNIWISFDV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 108 LCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLF-GWRQPAPE----------DETIC 176
Cdd:cd15065    81 MCSTASILNLCAISLDRYIHIKKPLKYERWMTTRRALVVIASVWILSALISFLPIHlGWHRLSQDeikglnhasnPKPSC 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 177 QINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSgmasaktkth 256
Cdd:cd15065   161 ALDLNPTYAVVSSLISFYIPCLVMLLIYSRLYLYARKHVVNIKSQKLPSESGSKFQVPSLSSKHNNQGVS---------- 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 257 fsvrllkfsrEKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSEtVFKIVFWLGYLNSCINPIIYPCSSQEFKKA 336
Cdd:cd15065   231 ----------DHKAAVTLGIIMGVFLICWLPFFIINIIAAFCKTCIPPK-CFKILTWLGYFNSCLNPIIYSIFNSEFRRA 299

                  .
gi 1034659269 337 F 337
Cdd:cd15065   300 F 300
7tmA_D1-like_dopamine_R cd15057
D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G ...
27-337 1.34e-85

D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. In contrast, activation of D2-like family receptors is linked to G proteins of the G(i) family, which inhibit adenylate cyclase. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320185 [Multi-domain]  Cd Length: 299  Bit Score: 265.06  E-value: 1.34e-85
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHS-VTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRvFCNIWAAV 105
Cdd:cd15057     1 IITGCILYLLVLLTLLGNALVIAAVLRFRHLRSkVTNYFIVSLAVSDLLVAILVMPWAAVNEVAGYWPFGS-FCDVWVSF 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 106 DVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPL-FGWRQPAP--------EDETIC 176
Cdd:cd15057    80 DIMCSTASILNLCVISVDRYWAISSPFRYERRMTRRRAFIMIAVAWTLSALISFIPVqLGWHRADDtsealalyADPCQC 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 177 QINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSglktdksdseqvtlrIHRknapaggSGMASAKTKTH 256
Cdd:cd15057   160 DSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIARRQIRRIAA---------------LER-------AAQESTNPDSS 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 257 FSVRllkFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKP-----SETVFKIVFWLGYLNSCINPIIYpCSSQ 331
Cdd:cd15057   218 LRSS---LRRETKALKTLSIIMGVFVCCWLPFFILNCVLPFCDLRTAqfpcvPDTTFIVFVWLGWANSSLNPIIY-AFNA 293

                  ....*.
gi 1034659269 332 EFKKAF 337
Cdd:cd15057   294 DFRKAF 299
7tmA_tyramine_R-like cd15061
tyramine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
28-337 8.96e-83

tyramine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes tyramine-specific receptors and similar proteins found in insects and other invertebrates. These tyramine receptors form a distinct receptor family that is phylogenetically different from the other tyramine/octopamine receptors which also found in invertebrates. Both octopamine and tyramine mediate their actions via G protein-coupled receptors (GPCRs) and are the invertebrate equivalent of vertebrate adrenergic neurotransmitters. In Drosophila, octopamine is involved in ovulation by mediating an egg release from the ovary, while a physiological role for tyramine in this process is not fully understood. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320189 [Multi-domain]  Cd Length: 256  Bit Score: 256.13  E-value: 8.96e-83
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  28 LLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDV 107
Cdd:cd15061     1 ILISFLILAIIFTIFGNLLVILAVATTRRLRTITNCYIVSLATADLLVGVLVLPLAIIRQLLGYWPLGSHLCDFWISLDV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 108 LCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLF 187
Cdd:cd15061    81 LLCTASILNLCCISLDRYFAITYPLKYRTKRSRRLAITMILAVWVISLLITSPPLVGPSWHGRRGLGSCYYTYDKGYRIY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 188 SALGSFYLPLAIILVMYCRVYVVAKresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrllkfsRE 267
Cdd:cd15061   161 SSMGSFFLPLLLMLFVYLRIFRVIA-----------------------------------------------------KE 187
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 268 KKAAKTLGIVVGCFVLCWLPFFLvMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15061   188 RKTAKTLAIVVGCFIVCWLPFFI-MYLIEPFCDCQFSEALSTAFTWLGYFNSVINPFIYAFYNKDFRRAF 256
7tmA_5-HT1A_invertebrates cd15331
serotonin receptor subtype 1A from invertebrates, member of the class A family of ...
27-337 9.79e-81

serotonin receptor subtype 1A from invertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320454 [Multi-domain]  Cd Length: 261  Bit Score: 251.12  E-value: 9.79e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15331     1 VLTSIILGLLILATIIGNVFVIAAILLERSLQGVSNYLILSLAVADLMVAVLVMPLSAVYEVSQHWFLGPEVCDMWISMD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSyPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPA----PEDETICQINEEP 182
Cdd:cd15331    81 VLCCTASILHLVAIALDRYWAVT-NIDYIRRRTAKRILIMIAVVWFVSLIISIAPLFGWKDEDdldrVLKTGVCLISQDY 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 183 GYVLFSALGSFYLPLAIILVMYCRVYVVAKresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrll 262
Cdd:cd15331   160 GYTIFSTVGAFYVPLLLMIIIYWKIYQAAK-------------------------------------------------- 189
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1034659269 263 kfsREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15331   190 ---RERKAARTLAIITGAFVVCWLPFFLVALVMPFCGAWQISRFLESFFLWLGYFNSLLNPIIYTIFSPDFRGAF 261
7tmA_Octopamine_R cd15063
octopamine receptors in invertebrates, member of the class A family of seven-transmembrane G ...
31-337 7.65e-79

octopamine receptors in invertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor for octopamine (OA), which functions as a neurotransmitter, neurohormone, and neuromodulator in invertebrate nervous system. Octopamine (also known as beta, 4-dihydroxyphenethylamine) is an endogenous trace amine that is highly similar to norepinephrine, but lacks a hydroxyl group, and has effects on the adrenergic and dopaminergic nervous systems. Based on the pharmacological and signaling profiles, the octopamine receptors can be classified into at least two groups: OA1 receptors elevate intracellular calcium levels in muscle, whereas OA2 receptors activate adenylate cyclase and increase cAMP production.


Pssm-ID: 320191 [Multi-domain]  Cd Length: 266  Bit Score: 246.25  E-value: 7.65e-79
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  31 VILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCC 110
Cdd:cd15063     5 LVLTFLNVLVVLGNLLVIAAVLCSRKLRTVTNLFIVSLACADLLVGTLVLPFSAVNEVLDVWIFGHTWCQIWLAVDVWMC 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 111 TASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGW---------RQPAPEDETICQINEE 181
Cdd:cd15063    85 TASILNLCAISLDRYLAITRPIRYPSLMSTKRAKCLIAGVWVLSFVICFPPLVGWndgkdgimdYSGSSSLPCTCELTNG 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 182 PGYVLFSALGSFYLPLAIILVMYCRVYVVAkresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrl 261
Cdd:cd15063   165 RGYVIYSALGSFYIPMLVMLFFYFRIYRAA-------------------------------------------------- 194
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1034659269 262 lkfSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPsETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15063   195 ---RMETKAAKTVAIIVGCFIFCWLPFFTVYLVRAFCEDCIP-PLLFSVFFWLGYCNSALNPCIYALFSRDFRFAF 266
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
43-326 8.49e-78

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 394960 [Multi-domain]  Cd Length: 256  Bit Score: 243.36  E-value: 8.49e-78
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVL-GYWAFGRVFCNIWAAVDVLCCTASIMGLCIIS 121
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFGLLTLPFWLVYYLLhGDWPFGSALCKLVGALFYVNMYASILLLTAIS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 122 IDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPL-FGWRQPAPEDE-TICQIN------EEPGYVLFSALGSF 193
Cdd:pfam00001  81 IDRYLAIVHPLRYRRIRTPRRAKVLILLVWVLALLLSLPPLlFGWTLTVPEGNvTVCLIDfpedlvKPVSYTLLISVLGF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 194 YLPLAIILVMYCRVYVVAKRESRGLKSGLKTDksdseqvtlrihrknapaggsgmasaktkthfsvrllkfsREKKAAKT 273
Cdd:pfam00001 161 LLPLLVILVCYTRIYRTLRKSASKQKSEERTQ----------------------------------------RRRKALKT 200
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1034659269 274 LGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVF---WLGYLNSCINPIIY 326
Cdd:pfam00001 201 LAVVVVVFILCWLPYHIVLLLDSLALDCELSRLLDKALSvtlWLAYVNSCLNPIIY 256
7tmA_tyramine_octopamine_R-like cd15060
tyramine/octopamine receptor-like, member of the class A family of seven-transmembrane G ...
27-337 1.29e-77

tyramine/octopamine receptor-like, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes tyramine/octopamine receptors and similar proteins found in insects and other invertebrates. Both octopamine and tyramine mediate their actions via G protein-coupled receptors (GPCRs) and are the invertebrate equivalent of vertebrate adrenergic neurotransmitters. In Drosophila, octopamine is involved in ovulation by mediating an egg release from the ovary, while a physiological role for tyramine in this process is not fully understood. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320188 [Multi-domain]  Cd Length: 260  Bit Score: 243.11  E-value: 1.29e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15060     1 VVTTILLSVIIAFTIVGNILVILSVFTYRPLRIVQNFFIVSLAVADLAVAIFVLPLNVAYFLLGKWLFGIHLCQMWLTCD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWR--QPAPEDETICQINEEPGY 184
Cdd:cd15060    81 ILCCTASILNLCAIALDRYWAIHDPINYAQKRTLKRVLLMIVVVWALSALISVPPLIGWNdwPENFTETTPCTLTEEKGY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 185 VLFSALGSFYLPLAIILVMYCRVYVVAkresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrllkf 264
Cdd:cd15060   161 VIYSSSGSFFIPLLIMTIVYVKIFIAT----------------------------------------------------- 187
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034659269 265 SREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15060   188 SKERRAARTLGIIMGVFVVCWLPFFLMYVILPFCETCSPSAKVVNFITWLGYVNSALNPVIYTIFNLDFRRAF 260
7tmA_Beta_AR cd15058
beta adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane ...
28-337 4.73e-77

beta adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta adrenergic receptor (beta adrenoceptor), also known as beta AR, is activated by hormone adrenaline (epinephrine) and plays important roles in regulating cardiac function and heart rate, as well as pulmonary physiology. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of beta-ARs can lead to cardiac dysfunction such as arrhythmias or heart failure. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320186 [Multi-domain]  Cd Length: 305  Bit Score: 243.13  E-value: 4.73e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  28 LLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDV 107
Cdd:cd15058     2 GLLLLLALIILAIVVGNLLVIIAIARTSRLQTMTNIFITSLACADLVMGLLVVPLGATIVVTGKWQLGNFWCELWTSVDV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 108 LCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFG--WRQPAPE------DETICQIN 179
Cdd:cd15058    82 LCVTASIETLCVIAVDRYIAITRPLRYQVLLTKRRARVIVCVVWIVSALVSFVPIMNqwWRANDPEandcyqDPTCCDFR 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 180 EEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRglksglKTDKSdseqvTLRIHRKNaPAGGSGMASAKTKTHFSV 259
Cdd:cd15058   162 TNMAYAIASSVVSFYIPLLIMIFVYARVFLIATRQLQ------LIDKR-----RLRFQSEC-PAPQTTSPEGKRSSGRRP 229
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1034659269 260 RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSEtVFKIVFWLGYLNSCINPIIYpCSSQEFKKAF 337
Cdd:cd15058   230 SRLTVVKEHKALKTLGIIMGTFTLCWLPFFIANIINVFNRNLPPGE-VFLLLNWLGYINSGLNPIIY-CRSPEFRTAF 305
7tmA_TAARs cd15055
trace amine-associated receptors, member of the class A family of seven-transmembrane G ...
27-337 3.49e-74

trace amine-associated receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The trace amine-associated receptors (TAARs) are a distinct subfamily within the class A G protein-coupled receptor family. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. Trace amines, including p-tyramine, beta-phenylethylamine, and tryptamine, are also thought to act as chemical messengers to exert their biological effects in vertebrates. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320183 [Multi-domain]  Cd Length: 285  Bit Score: 235.14  E-value: 3.49e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15055     1 VLLYIVLSSISLLTVLGNLLVIISISHFKQLHTPTNLLLLSLAVADFLVGLLVMPFSMIRSIETCWYFGDTFCKLHSSLD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRR-GLMALLCvWALSLVISIGPLF-GWRQPAPEDETICQ------I 178
Cdd:cd15055    81 YILTSASIFNLVLIAIDRYVAVCDPLLYPTKITIRRvKICICLC-WFVSALYSSVLLYdNLNQPGLIRYNSCYgecvvvV 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 179 NEepGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSglKTDKSDSEQVTLRIHRKnapaggsgmasaktkthfs 258
Cdd:cd15055   160 NF--IWGVVDLVLTFILPCTVMIVLYMRIFVVARSQARAIRS--HTAQVSLEGSSKKVSKK------------------- 216
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1034659269 259 vrllkfsREKKAAKTLGIVVGCFVLCWLPFFLVMPIGsffPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15055   217 -------SERKAAKTLGIVVGVFLLCWLPYYIVSLVD---PYISTPSSVFDVLIWLGYFNSCLNPLIYALFYPWFRKAL 285
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
29-326 3.54e-73

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 232.18  E-value: 3.54e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  29 LGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVL 108
Cdd:cd00637     1 LAVLYILIFVVGLVGNLLVILVILRNRRLRTVTNYFILNLAVADLLVGLLVIPFSLVSLLLGRWWFGDALCKLLGFLQSV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 109 CCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETIC-----QINEEPG 183
Cdd:cd00637    81 SLLASILTLTAISVDRYLAIVHPLRYRRRFTRRRAKLLIALIWLLSLLLALPPLLGWGVYDYGGYCCCclcwpDLTLSKA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 184 YVLFSALGSFYLPLAIILVMYCRVYVVAKResrglksglktdksdseqvtlriHRKNAPAGGSGMASAKtkthfsvrllK 263
Cdd:cd00637   161 YTIFLFVLLFLLPLLVIIVCYVRIFRKLRR-----------------------HRRRIRSSSSNSSRRR----------R 207
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1034659269 264 FSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKP-SETVFKIVFWLGYLNSCINPIIY 326
Cdd:cd00637   208 RRRERKVTKTLLIVVVVFLLCWLPYFILLLLDVFGPDPSPlPRILYFLALLLAYLNSAINPIIY 271
7tmA_D2-like_dopamine_R cd15053
D2-like dopamine receptors, member of the class A family of seven-transmembrane G ...
30-337 3.74e-73

D2-like dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. In contrast, activation of D2-like family receptors is linked to G proteins of the G(i) family, which inhibit adenylate cyclase. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320181 [Multi-domain]  Cd Length: 263  Bit Score: 231.47  E-value: 3.74e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  30 GVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVL-GYWAFGRVFCNIWAAVDVL 108
Cdd:cd15053     4 ALFLLLLPLLTVFGNVLVIMSVFRERSLQTATNYFIVSLAVADLLVAILVMPFAVYVEVNgGKWYLGPILCDIYIAMDVM 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 109 CCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQInEEPGYVLFS 188
Cdd:cd15053    84 CSTASIFNLCAISIDRYIAVTQPIKYARQKNSKRVLLTIAIVWVVSAAIACPLLFGLNNVPYRDPEECRF-YNPDFIIYS 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 189 ALGSFYLPLAIILVMYCRVYVVAKresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrllkfsREK 268
Cdd:cd15053   163 SISSFYIPCIVMLLLYYRIFRALR-----------------------------------------------------REK 189
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1034659269 269 KAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFK-----PSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15053   190 KATKTLAIVLGVFLFCWLPFFTLNILNAICPKLQnqschVGPALFSLTTWLGYVNSFLNPIIYTIFNIEFRKAF 263
7tmA_DmOct-betaAR-like cd15066
Drosophila melanogaster beta-adrenergic receptor-like octopamine receptors and similar ...
30-337 6.39e-73

Drosophila melanogaster beta-adrenergic receptor-like octopamine receptors and similar receptors in bilateria; member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Drosophila beta-adrenergic-like octopamine receptors and similar proteins. The biogenic amine octopamine is the invertebrate equivalent of vertebrate adrenergic neurotransmitters and exerts its effects through different G protein-coupled receptor types. Insect octopamine receptors are involved in the modulation of carbohydrate metabolism, muscular tension, cognition and memory. The activation of octopamine receptors mediating these actions leads to an increase in adenylate cyclase activity, thereby increasing cAMP levels. In Drosophila melanogaster, three subgroups have been classified on the basis of their structural homology and functional equivalents with vertebrate beta-adrenergic receptors: DmOctBeta1R, DmOctBeta2R, and DmOctBeta3R.


Pssm-ID: 320194 [Multi-domain]  Cd Length: 265  Bit Score: 231.11  E-value: 6.39e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  30 GVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLC 109
Cdd:cd15066     3 GFAMTLIILAAIFGNLLVIISVMRHRKLRVITNYFVVSLAMADMLVALCAMTFNASVEITGRWMFGYFMCDVWNSLDVYF 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 110 CTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLF-GW------RQPAPEDETICQINEEP 182
Cdd:cd15066    83 STASILHLCCISVDRYYAIVQPLEYPSKMTKRRVAIMLANVWISPALISFLPIFlGWytteehLQYRKTHPDQCEFVVNK 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 183 GYVLFSALGSFYLPLAIILVMYCRVYVVAKresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrll 262
Cdd:cd15066   163 IYALISSSVSFWIPCIVMIFTYYRIYLEAK-------------------------------------------------- 192
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1034659269 263 kfsREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPS-ETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15066   193 ---REHKAAKTLGIIMGAFILCWLPFFLWYVTTTLCGDACPYpPILVSILFWIGYFNSTLNPLIYAYFNRDFREAF 265
7tmA_TAAR1 cd15314
trace amine-associated receptor 1 and similar receptors, member of the class A family of ...
27-337 7.02e-70

trace amine-associated receptor 1 and similar receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The trace amine-associated receptor 1 (TAAR1) is one of the 15 identified trace amine-associated receptor subtypes, which form a distinct subfamily within the class A G protein-coupled receptor family. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. TAAR1 is coupled to the Gs protein, which leads to activation of adenylate cyclase, and is thought to play functional role in the regulation of brain monoamines. TAAR1 is also shown to be activated by psychoactive compounds such as Ecstasy (MDMA), amphetamine and LSD. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320438 [Multi-domain]  Cd Length: 282  Bit Score: 223.66  E-value: 7.02e-70
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15314     1 VLLYIFLGLISLVTVCGNLLVIISIAHFKQLHTPTNYLILSLAVADLLVGGLVMPPSMVRSVETCWYFGDLFCKIHSSFD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLF------GWRQPAPEDETICQINE 180
Cdd:cd15314    81 ITLCTASILNLCFISIDRYYAVCQPLLYRSKITVRVVLVMILISWSVSALVGFGIIFlelnikGIYYNHVACEGGCLVFF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 181 EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTdksdseqvtlrihrknapaggSGMASAKtkthfsvr 260
Cdd:cd15314   161 SKVSSVVGSVFSFYIPAVIMLCIYLKIFLVAQRQARSIQSARTK---------------------SGASSSK-------- 211
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1034659269 261 llkfsREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSeTVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15314   212 -----MERKATKTLAIVMGVFLLCWTPFFLCNIIDPFINYSIPP-VLIEVLNWLGYSNSTLNPFIYAFFYSWFRKAF 282
7tmA_Beta3_AR cd15959
beta-3 adrenergic receptors (adrenoceptors), member of the class A family of ...
28-337 2.92e-68

beta-3 adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta-3 adrenergic receptor (beta-3 adrenoceptor), also known as beta-3 AR, is activated by adrenaline and plays important roles in regulating cardiac function and heart rate. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of betrayers can lead to cardiac dysfunction such as arrhythmias or heart failure.


Pssm-ID: 320625 [Multi-domain]  Cd Length: 302  Bit Score: 220.16  E-value: 2.92e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  28 LLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDV 107
Cdd:cd15959     2 LAGALLSLAILVIVGGNLLVIVAIAKTPRLQTMTNVFVTSLACADLVMGLLVVPPGATILLTGHWPLGTTVCELWTSVDV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 108 LCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFG--WRQPAPEDETICQIN------ 179
Cdd:cd15959    82 LCVTASIETLCAIAVDRYLAITNPLRYEALVTKRRARTAVCLVWAISAAISFLPIMNqwWRDGADEEAQRCYDNprccdf 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 180 -EEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLktdksdseqvtLRIHRKNAPAGGSGMASAKTKThfs 258
Cdd:cd15959   162 vTNMPYAIVSSTVSFYVPLLVMIFVYVRVFVVATRQVRLIRKDK-----------VRFPPEESPPAESRPACGRRPS--- 227
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1034659269 259 vRLLKFsREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSEtVFKIVFWLGYLNSCINPIIYpCSSQEFKKAF 337
Cdd:cd15959   228 -RLLAI-KEHKALKTLGIIMGTFTLCWLPFFVANIIKVFCRSLVPDP-AFLFLNWLGYANSAFNPIIY-CRSPDFRSAF 302
7tmA_alpha2B_AR cd15321
alpha-2 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G ...
36-337 3.64e-67

alpha-2 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320444 [Multi-domain]  Cd Length: 268  Bit Score: 216.33  E-value: 3.64e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  36 LILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIM 115
Cdd:cd15321    16 LILFTIFGNVLVIIAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELMGYWYFRKTWCEIYLALDVLFCTSSIV 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 116 GLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLF--GWRQPAPEDETICQINEEPGYVLFSALGSF 193
Cdd:cd15321    96 HLCAISLDRYWSVSRAIEYNSKRTPRRIKCIILIVWLIAAVISLPPLIykGKQKDEQGGLPQCKLNEEAWYILSSSIGSF 175
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 194 YLPLAIILVMYCRVYVVAKresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrllkfSREKKAAKT 273
Cdd:cd15321   176 FAPCLIMILVYLRIYLIAK----------------------------------------------------NREKRFTFV 203
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1034659269 274 LGIVVGCFVLCWLPFFLVMPIGSFFPDF-KPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15321   204 LAVVIGVFVLCWFPFFFSYSLGAICPELcKVPHSLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAF 268
7tmA_Beta2_AR cd15957
beta-2 adrenergic receptors (adrenoceptors), member of the class A family of ...
27-337 5.39e-67

beta-2 adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; Beta-2 AR is activated by adrenaline that plays important roles in cardiac function and pulmonary physiology. While beta-1 AR and beta-2 AR are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway, beta-2 AR can couple to both G(s) and G(i) proteins in the heart. Moreover, beta-2 AR activation leads to smooth muscle relaxation and bronchodilation in the lung. The beta adrenergic receptors are a subfamily of the class A rhodopsin-like G protein-coupled receptors.


Pssm-ID: 341355 [Multi-domain]  Cd Length: 301  Bit Score: 217.04  E-value: 5.39e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15957     1 VGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILLKTWTFGNFWCEFWTSID 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGP--LFGWRQPAPE------DETICQI 178
Cdd:cd15957    81 VLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPiqMHWYRATHQEaincyaEETCCDF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 179 NEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRglksglKTDKSDSeqvtlRIHRKNAPAGGSGMASAKTKthfs 258
Cdd:cd15957   161 FTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQ------KIDKSEG-----RFHNQNIDQNGSGGGGGNRR---- 225
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1034659269 259 vRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSEtVFKIVFWLGYLNSCINPIIYpCSSQEFKKAF 337
Cdd:cd15957   226 -RSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKE-VYILLNWIGYVNSGFNPLIY-CRSPDFRIAF 301
7tmA_5-HT1A_vertebrates cd15330
serotonin receptor subtype 1A from vertebrates, member of the class A family of ...
27-337 7.88e-67

serotonin receptor subtype 1A from vertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320453 [Multi-domain]  Cd Length: 260  Bit Score: 215.23  E-value: 7.88e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15330     1 IITSLFLGTLILCAIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPE-DETICQINEEPGYV 185
Cdd:cd15330    81 VLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISLTWLIGFSISIPPMLGWRTPEDRsDPDACTISKDPGYT 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 186 LFSALGSFYLPLAIILVMYCRVYVVAkresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrllkfS 265
Cdd:cd15330   161 IYSTFGAFYIPLILMLVLYGRIFKAA-----------------------------------------------------A 187
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1034659269 266 REKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD--FKPsETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15330   188 RERKTVKTLGIIMGTFILCWLPFFIVALVLPFCEStcHMP-ELLGAIINWLGYSNSLLNPIIYAYFNKDFQSAF 260
7tmA_D1A_dopamine_R cd15320
D1A (or D1) subtype dopamine receptor, member of the class A family of seven-transmembrane G ...
27-337 1.45e-65

D1A (or D1) subtype dopamine receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320443 [Multi-domain]  Cd Length: 319  Bit Score: 213.71  E-value: 1.45e-65
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHS-VTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGrVFCNIWAAV 105
Cdd:cd15320     2 VLTGCFLSVLILSTLLGNTLVCAAVIRFRHLRSkVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFG-SFCNIWVAF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 106 DVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPL-FGWRQPAP----------EDET 174
Cdd:cd15320    81 DIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKVAFIMISVAWTLSVLISFIPVqLNWHKAKPtsfldlnaslRDLT 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 175 I--CQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLksglktdkSDSEQVTlrIHRKNAPAGGSGMASAK 252
Cdd:cd15320   161 MdnCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRI--------SALERAA--VHAKNCQNSTGNRGSGD 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 253 TKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD-----FKPSETVFKIVFWLGYLNSCINPIIYP 327
Cdd:cd15320   231 CQQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCKPtstepFCISSTTFDVFVWFGWANSSLNPIIYA 310
                         330
                  ....*....|
gi 1034659269 328 CSSqEFKKAF 337
Cdd:cd15320   311 FNA-DFRKAF 319
7tmA_Beta1_AR cd15958
beta-1 adrenergic receptors (adrenoceptors), member of the class A family of ...
29-337 9.03e-65

beta-1 adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta-1 adrenergic receptor (beta-1 adrenoceptor), also known as beta-1 AR, is activated by adrenaline (epinephrine) and plays important roles in regulating cardiac function and heart rate. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of betrayers can lead to cardiac dysfunction such as arrhythmias or heart failure.


Pssm-ID: 320624 [Multi-domain]  Cd Length: 298  Bit Score: 211.30  E-value: 9.03e-65
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  29 LGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVL 108
Cdd:cd15958     3 MSLLMALIVLLIVAGNVLVIVAIGRTQRLQTLTNLFITSLACADLVMGLLVVPFGATLVVRGRWLYGSFFCELWTSVDVL 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 109 CCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLF--GWRQPAP------EDETICQINE 180
Cdd:cd15958    83 CVTASIETLCVIAIDRYLAITSPFRYQSLLTRARAKGIVCTVWAISALVSFLPIMmhWWRDEDDqalkcyEDPGCCDFVT 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 181 EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRglksglKTDKSDSeqvtlRIHRKNAPAGGSGMASAKtkthfsvR 260
Cdd:cd15958   163 NRAYAIASSIISFYIPLLIMIFVYLRVYREAKKQIK------KIDKCEG-----RFHNTLTGLGRKCKRRPS-------R 224
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1034659269 261 LLKFsREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPsETVFKIVFWLGYLNSCINPIIYpCSSQEFKKAF 337
Cdd:cd15958   225 ILAL-REQKALKTLGIIMGVFTLCWLPFFLVNVVNVFNRELVP-DWLFVFFNWLGYANSAFNPIIY-CRSPDFRKAF 298
7tmA_5-HT1B_1D cd15333
serotonin receptor subtypes 1B and 1D, member of the class A family of seven-transmembrane G ...
27-337 5.88e-64

serotonin receptor subtypes 1B and 1D, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320455 [Multi-domain]  Cd Length: 265  Bit Score: 207.73  E-value: 5.88e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269  27 ILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVD 106
Cdd:cd15333     5 ISLAVLLALITLATTLSNAFVIATIYLTRKLHTPANYLIASLAVTDLLVSILVMPISIVYTVTGTWTLGQVVCDIWLSSD 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 107 VLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFgWRQ-PAPEDETICQIN-EEPGY 184
Cdd:cd15333    85 ITCCTASILHLCVIALDRYWAITDAVEYSKKRTPKRAAVMIALVWVISISISLPPFF-WRQaKAEEEVSECVVNtDHILY 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034659269 185 VLFSALGSFYLPLAIILVMYCRVYVVAKresrglksglktdksdseqvtlrihrknapaggsgmasaktkthfsvrllkf 264
Cdd:cd15333   164 TVYSTVGAFYIPTLLLIALYGRIYVEAR---------------------------------------------------- 191
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1034659269 265 SREKKAAKTLGIVVGCFVLCWLPFF---LVMPIGSFFPDFKPSetVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337
Cdd:cd15333   192 ARERKATKTLGIILGAFIVCWLPFFiisLVLPICKDACWFHLA--IFDFFTWLGYLNSLINPIIYTMSNEDFKQAF 265
7tmA_alpha2C_AR cd15323
alpha-2 adrenergic receptors subtype C, member of the class A family of seven-transmembrane G ...
29-337 1.21e-62

alpha-2 adrenergic receptors subtype C, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and