NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1367300376|ref|XP_024212586|]
View 

sodium-dependent phosphate transport protein 2A isoform X3 [Pan troglodytes]

Protein Classification

sodium-dependent phosphate transport protein 2 (domain architecture ID 11490082)

sodium-dependent phosphate transport protein 2 may be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-476 1.78e-134

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


:

Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 398.46  E-value: 1.78e-134
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 108 LTFLYLFVCSLDMLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITRLMVASFNIHGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 268 KIITEPFTKLIIQLDESVITSIAtgdeSLRNHSLIRIWCHPDslqapTSMSRAEANSSQTlgnatmekcNHIFVDtglpd 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTL-----SSLPVPESNLPIE---------AHIFVN----- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 348 laVGLILLAGSLVLLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFTSAIT 427
Cdd:TIGR01013 218 --VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLDTPVPFLWVTGYEALLVGDAMTFIIQSSSVFTSALT 295
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*....
gi 1367300376 428 PLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQVAHS 476
Cdd:TIGR01013 296 PLVGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYC 344
 
Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-476 1.78e-134

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 398.46  E-value: 1.78e-134
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 108 LTFLYLFVCSLDMLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITRLMVASFNIHGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 268 KIITEPFTKLIIQLDESVITSIAtgdeSLRNHSLIRIWCHPDslqapTSMSRAEANSSQTlgnatmekcNHIFVDtglpd 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTL-----SSLPVPESNLPIE---------AHIFVN----- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 348 laVGLILLAGSLVLLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFTSAIT 427
Cdd:TIGR01013 218 --VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLDTPVPFLWVTGYEALLVGDAMTFIIQSSSVFTSALT 295
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*....
gi 1367300376 428 PLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQVAHS 476
Cdd:TIGR01013 296 PLVGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYC 344
Na_Pi_cotrans pfam02690
Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters ...
113-204 1.52e-16

Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.


Pssm-ID: 397008 [Multi-domain]  Cd Length: 137  Bit Score: 76.28  E-value: 1.52e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 113 LFVCSLDMLSSAFQlaggKVAGDIFKD--NAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMG 190
Cdd:pfam02690   1 LFLFGMKLMSDGLQ----KLAGGRLRRilEKLTSNPLKGLLVGLLVTALLQSSSATTVMVVGFVNAGLLTLRQAIGVIMG 76
                          90
                  ....*....|....
gi 1367300376 191 SNIGTSVTNTIVAL 204
Cdd:pfam02690  77 ANIGTTVTAQLIAF 90
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
106-465 2.47e-16

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 81.91  E-value: 2.47e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 106 LMLTFLYLFVCSLDMLSSAFQLAGGKVAGDIFkdNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAI 185
Cdd:COG1283     9 NLLGAVALLLFGIKMVGDGVQRAAGDRLRKIL--ARFTSNPILGVLAGIVATALLQSSTATTVLTIGFVAAGLLSLKQAI 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 186 PIIMGSNIGTSVTNTIVALmqaGDRTDFRRAFAGATVHDCFNWLSVLvllpleaatgylhhitrlmvasfnihggrdapd 265
Cdd:COG1283    87 GVILGANIGTTVTAWIVAL---DLSWLSPPLLAIGAILFFFGKSSKL--------------------------------- 130
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 266 llkiitepftkliiqldesvitsiatgdeslrnhsliriwchpdslqaptsmsraeanssQTLGNATMekcnhifvdtgl 345
Cdd:COG1283   131 ------------------------------------------------------------RQLGRVLF------------ 138
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 346 pdlAVGLILLAGSLvllctclillvkMLNSLLKGQVAKVIQKVINTDFPAPFTwvtgyfAMVVGASMTFVVQSSSVFTSA 425
Cdd:COG1283   139 ---GIGLIFLSLEL------------LGQATEPLRQSPAFSDFIAKLSDDPIV------ALLIGALLTALIQSSLAAIGI 197
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|
gi 1367300376 426 ITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPRE 465
Cdd:COG1283   198 LLSLTSQGLISLEAALALVLGANLGTTITAVLAALGASAA 237
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
110-204 2.28e-07

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 52.60  E-value: 2.28e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 110 FLYLFVCSLDMLSSA-FQLAGGKVAGDIFKdnaILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPII 188
Cdd:NF037997    4 YIAIFLLGMTVLRSGlFNLSGHKLKTWLLK---FTDTPLKGFLTGTVITAILQSSSAVMVLTVGLVSAGILTFRQSIGII 80
                          90
                  ....*....|....*.
gi 1367300376 189 MGSNIGTSVTNTIVAL 204
Cdd:NF037997   81 LGTNIGTTFTTEFITF 96
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
403-475 5.04e-07

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 51.45  E-value: 5.04e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1367300376 403 YFAMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFqvAH 475
Cdd:NF037997  165 LLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASIGSGKEAKLTAY--AH 235
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
145-237 1.98e-05

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 46.44  E-value: 1.98e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 145 NPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALmqAGDRTDFRRAFAgatvHD 224
Cdd:NF037997  163 SLLLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASI--GSGKEAKLTAYA----HI 236
                          90
                  ....*....|...
gi 1367300376 225 CFNWLSVLVLLPL 237
Cdd:NF037997  237 WLNVLGVLLFLPF 249
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
405-460 8.33e-03

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 38.35  E-value: 8.33e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1367300376 405 AMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAAL 460
Cdd:NF037997   41 GFLTGTVITAILQSSSAVMVLTVGLVSAGILTFRQSIGIILGTNIGTTFTTEFITF 96
 
Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-476 1.78e-134

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 398.46  E-value: 1.78e-134
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 108 LTFLYLFVCSLDMLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITRLMVASFNIHGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 268 KIITEPFTKLIIQLDESVITSIAtgdeSLRNHSLIRIWCHPDslqapTSMSRAEANSSQTlgnatmekcNHIFVDtglpd 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTL-----SSLPVPESNLPIE---------AHIFVN----- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 348 laVGLILLAGSLVLLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFTSAIT 427
Cdd:TIGR01013 218 --VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLDTPVPFLWVTGYEALLVGDAMTFIIQSSSVFTSALT 295
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*....
gi 1367300376 428 PLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQVAHS 476
Cdd:TIGR01013 296 PLVGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYC 344
Na_Pi_cotrans pfam02690
Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters ...
113-204 1.52e-16

Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.


Pssm-ID: 397008 [Multi-domain]  Cd Length: 137  Bit Score: 76.28  E-value: 1.52e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 113 LFVCSLDMLSSAFQlaggKVAGDIFKD--NAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMG 190
Cdd:pfam02690   1 LFLFGMKLMSDGLQ----KLAGGRLRRilEKLTSNPLKGLLVGLLVTALLQSSSATTVMVVGFVNAGLLTLRQAIGVIMG 76
                          90
                  ....*....|....
gi 1367300376 191 SNIGTSVTNTIVAL 204
Cdd:pfam02690  77 ANIGTTVTAQLIAF 90
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
106-465 2.47e-16

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 81.91  E-value: 2.47e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 106 LMLTFLYLFVCSLDMLSSAFQLAGGKVAGDIFkdNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAI 185
Cdd:COG1283     9 NLLGAVALLLFGIKMVGDGVQRAAGDRLRKIL--ARFTSNPILGVLAGIVATALLQSSTATTVLTIGFVAAGLLSLKQAI 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 186 PIIMGSNIGTSVTNTIVALmqaGDRTDFRRAFAGATVHDCFNWLSVLvllpleaatgylhhitrlmvasfnihggrdapd 265
Cdd:COG1283    87 GVILGANIGTTVTAWIVAL---DLSWLSPPLLAIGAILFFFGKSSKL--------------------------------- 130
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 266 llkiitepftkliiqldesvitsiatgdeslrnhsliriwchpdslqaptsmsraeanssQTLGNATMekcnhifvdtgl 345
Cdd:COG1283   131 ------------------------------------------------------------RQLGRVLF------------ 138
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 346 pdlAVGLILLAGSLvllctclillvkMLNSLLKGQVAKVIQKVINTDFPAPFTwvtgyfAMVVGASMTFVVQSSSVFTSA 425
Cdd:COG1283   139 ---GIGLIFLSLEL------------LGQATEPLRQSPAFSDFIAKLSDDPIV------ALLIGALLTALIQSSLAAIGI 197
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|
gi 1367300376 426 ITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPRE 465
Cdd:COG1283   198 LLSLTSQGLISLEAALALVLGANLGTTITAVLAALGASAA 237
Na_Pi_cotrans pfam02690
Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters ...
405-460 7.49e-10

Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.


Pssm-ID: 397008 [Multi-domain]  Cd Length: 137  Bit Score: 57.02  E-value: 7.49e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1367300376 405 AMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAAL 460
Cdd:pfam02690  35 GLLVGLLVTALLQSSSATTVMVVGFVNAGLLTLRQAIGVIMGANIGTTVTAQLIAF 90
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
110-204 2.28e-07

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 52.60  E-value: 2.28e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 110 FLYLFVCSLDMLSSA-FQLAGGKVAGDIFKdnaILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPII 188
Cdd:NF037997    4 YIAIFLLGMTVLRSGlFNLSGHKLKTWLLK---FTDTPLKGFLTGTVITAILQSSSAVMVLTVGLVSAGILTFRQSIGII 80
                          90
                  ....*....|....*.
gi 1367300376 189 MGSNIGTSVTNTIVAL 204
Cdd:NF037997   81 LGTNIGTTFTTEFITF 96
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
403-475 5.04e-07

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 51.45  E-value: 5.04e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1367300376 403 YFAMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFqvAH 475
Cdd:NF037997  165 LLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASIGSGKEAKLTAY--AH 235
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
87-246 6.35e-07

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 51.87  E-value: 6.35e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376  87 ESRLVPKLCQAGAMLL---------KVPLMLTFLYLFVCSLDMLSSAFQ-LAGGKVAGDIFKdnAILSNPVAGLVVGILV 156
Cdd:COG1283   107 LSWLSPPLLAIGAILFffgkssklrQLGRVLFGIGLIFLSLELLGQATEpLRQSPAFSDFIA--KLSDDPIVALLIGALL 184
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 157 TVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALmqAGDRTDFRRAFAgatvHDCFNWLSVLVLLP 236
Cdd:COG1283   185 TALIQSSLAAIGILLSLTSQGLISLEAALALVLGANLGTTITAVLAAL--GASAAARRVALG----NLLFNLIGVLIFLP 258
                         170
                  ....*....|
gi 1367300376 237 LeaaTGYLHH 246
Cdd:COG1283   259 V---IHLLAT 265
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
348-460 1.61e-06

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 50.71  E-value: 1.61e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 348 LAVGLILLAGSLVLLctclILLVKMLNSLLKGQVAKVIQKVINTDFPAPFtwvtgyFAMVVGASMTFVVQSSSVFTSAIT 427
Cdd:COG1283     3 KQLVLLNLLGAVALL----LFGIKMVGDGVQRAAGDRLRKILARFTSNPI------LGVLAGIVATALLQSSTATTVLTI 72
                          90       100       110
                  ....*....|....*....|....*....|...
gi 1367300376 428 PLIGLGVISIERAYPLTLGSNIGTTTTAILAAL 460
Cdd:COG1283    73 GFVAAGLLSLKQAIGVILGANIGTTVTAWIVAL 105
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
145-237 1.98e-05

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 46.44  E-value: 1.98e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1367300376 145 NPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALmqAGDRTDFRRAFAgatvHD 224
Cdd:NF037997  163 SLLLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASI--GSGKEAKLTAYA----HI 236
                          90
                  ....*....|...
gi 1367300376 225 CFNWLSVLVLLPL 237
Cdd:NF037997  237 WLNVLGVLLFLPF 249
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
405-460 8.33e-03

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 38.35  E-value: 8.33e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1367300376 405 AMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAAL 460
Cdd:NF037997   41 GFLTGTVITAILQSSSAVMVLTVGLVSAGILTFRQSIGIILGTNIGTTFTTEFITF 96
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH