NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1370468124|ref|XP_024305965|]
View 

pyridoxal-dependent decarboxylase domain-containing protein 1 isoform X10 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
AAT_I super family cl18945
Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP) ...
130-352 9.71e-22

Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the substrate in four kinds of reactions (1) transamination (movement of amino groups), (2) racemization (redistribution of enantiomers), (3) decarboxylation (removing COOH groups), and (4) various side-chain reactions depending on the enzyme involved. Pyridoxal phosphate (PLP) dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalyzed. The availability of several structures allowed a comprehensive analysis of the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary history of these enzymes. Structure and sequence analysis has revealed that the PLP dependent enzymes can be classified into four major groups of different evolutionary origin: aspartate aminotransferase superfamily (fold type I), tryptophan synthase beta superfamily (fold type II), alanine racemase superfamily (fold type III), and D-amino acid superfamily (fold type IV) and Glycogen phophorylase family (fold type V).


The actual alignment was detected with superfamily member cd06450:

Pssm-ID: 418510  Cd Length: 345  Bit Score: 95.73  E-value: 9.71e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 130 KKPVIYLSAAARPGL---GQYLCNQLglpfpclCRVPCNtvfgSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVG 206
Cdd:cd06450    94 DKLVIVCSDQAHVSVekaAAYLDVKV-------RLVPVD----EDGRMDPEALEAAIDEDKAEGLNPIMVVATAGTTDTG 162
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 207 HTDKIGRLKELCEQYGIWLHVEGvnlatlALGyvsSSVLaaakcdsMTMTPGPWL-GLPAVPAVT------LYKHDDPAL 279
Cdd:cd06450   163 AIDPLEEIADLAEKYDLWLHVDA------AYG---GFLL-------PFPEPRHLDfGIERVDSISvdphkyGLVPLGCSA 226
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1370468124 280 TLVagltsnkptdklRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKILVEDELssPVVVFRF 352
Cdd:cd06450   227 VLV------------RALKLWATLRRFGRDGYGEHIDRIVDLAKYLAELIRADPGFELLGEPNL--SLVCFRL 285
 
Name Accession Description Interval E-value
DOPA_deC_like cd06450
DOPA decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent ...
130-352 9.71e-22

DOPA decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to DOPA/tyrosine decarboxylase (DDC), histidine decarboxylase (HDC), and glutamate decarboxylase (GDC). DDC is active as a dimer and catalyzes the decarboxylation of tyrosine. GDC catalyzes the decarboxylation of glutamate and HDC catalyzes the decarboxylation of histidine.


Pssm-ID: 99743  Cd Length: 345  Bit Score: 95.73  E-value: 9.71e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 130 KKPVIYLSAAARPGL---GQYLCNQLglpfpclCRVPCNtvfgSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVG 206
Cdd:cd06450    94 DKLVIVCSDQAHVSVekaAAYLDVKV-------RLVPVD----EDGRMDPEALEAAIDEDKAEGLNPIMVVATAGTTDTG 162
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 207 HTDKIGRLKELCEQYGIWLHVEGvnlatlALGyvsSSVLaaakcdsMTMTPGPWL-GLPAVPAVT------LYKHDDPAL 279
Cdd:cd06450   163 AIDPLEEIADLAEKYDLWLHVDA------AYG---GFLL-------PFPEPRHLDfGIERVDSISvdphkyGLVPLGCSA 226
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1370468124 280 TLVagltsnkptdklRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKILVEDELssPVVVFRF 352
Cdd:cd06450   227 VLV------------RALKLWATLRRFGRDGYGEHIDRIVDLAKYLAELIRADPGFELLGEPNL--SLVCFRL 285
GadA COG0076
Glutamate or tyrosine decarboxylase or a related PLP-dependent protein [Amino acid transport ...
122-352 1.89e-18

Glutamate or tyrosine decarboxylase or a related PLP-dependent protein [Amino acid transport and metabolism];


Pssm-ID: 223154 [Multi-domain]  Cd Length: 460  Bit Score: 87.43  E-value: 1.89e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 122 DGFNVLYNKKPVIYLSAAARPGLgQYLCNQLGLPFPCLCRVPCNtvfgsqHQMDVAFLEKLIKDDIERGrlplLLVANAG 201
Cdd:COG0076   148 LAESGKPGGKPNIVCSETAHFSF-EKAARYLGLGLRRVPTVPTD------YRIDVDALEEAIDENTIGG----VVVGTAG 216
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 202 TAAVGHTDKIGRLKELCEQYGIWLHVEGvnlatlALGyvsSSVLAAAKC-----------DSMTMTPGPWLGLPAVPAVT 270
Cdd:COG0076   217 TTDTGSIDDIEELADIAEEYGIWLHVDA------AFG---GFLLPFLEPdgrwdfglegvDSITVDGHKYGLAPIGCGVV 287
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 271 LYK----------HDDPALT----LVAGLTSNKPTDklRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIK 336
Cdd:COG0076   288 LFRdeealrriliFADYYLPgggiPNFTILGSRPGR--QALALYANLRRLGREGYRKLLDRTLELARYLAEELEKLGDFE 365
                         250
                  ....*....|....*.
gi 1370468124 337 ILVEDELssPVVVFRF 352
Cdd:COG0076   366 LVNEPEL--PIVAFRL 379
Pyridoxal_deC pfam00282
Pyridoxal-dependent decarboxylase conserved domain;
129-351 1.09e-12

Pyridoxal-dependent decarboxylase conserved domain;


Pssm-ID: 395219  Cd Length: 373  Bit Score: 68.98  E-value: 1.09e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 129 NKKPVIYLSAAArpglgQYLCNQLGLPFPCLCR-VPCNtvfgSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGH 207
Cdd:pfam00282 143 LAKLVAYTSDQA-----HSSIEKAALYGGVKLReIPSD----DNGKMRGMDLEKAIEEDKENGLIPFFVVATLGTTGSGA 213
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 208 TDKIGRLKELCEQYGIWLHVEGVNLATLALG-YVSSSVLAAAKCDSMTMTPGPWLGLPAvPAVTLYKHDDPALTLVAGL- 285
Cdd:pfam00282 214 FDDLQELGDICAKHNLWLHVDAAYGGSAFICpEFRHWLFGIERADSITFNPHKWMLVLL-DCSAVWVKDKEALQQAFQFn 292
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 286 -----TSNKPTD----------KLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKILVEDELssPVVVF 350
Cdd:pfam00282 293 plylgHTDSAYDtghkqiplsrRFRILKLWFVIRSLGVEGLQNQIRRHVELAQYLEALIRKDGRFEICAEVGL--GLVCF 370

                  .
gi 1370468124 351 R 351
Cdd:pfam00282 371 R 371
PRK13520 PRK13520
tyrosine decarboxylase MfnA;
170-365 1.51e-08

tyrosine decarboxylase MfnA;


Pssm-ID: 237409  Cd Length: 371  Bit Score: 56.43  E-value: 1.51e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 170 SQHQMDVAFLEKLIKDDIergrlpLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVE----GVNLATLALGYVSSSVL 245
Cdd:PRK13520  135 DDYRVDVKAVEDLIDDNT------IGIVGIAGTTELGQVDPIPELSKIALENGIFLHVDaafgGFVIPFLDDPPNFDFSL 208
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 246 AAAkcDSMTMTPGPwLGLPAVPA-VTLYKH---------DDPALT--LVAGLTSNKPtdKLRALPLWLSLQYLGLDGFVE 313
Cdd:PRK13520  209 PGV--DSITIDPHK-MGLAPIPAgGILFRDesyldalavDTPYLTskKQATLTGTRS--GAGVAATYAVMKYLGREGYRK 283
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1370468124 314 RIKHACQLSQRLQESLKKVNYiKILVEDELssPVVVFrffqELPGSDPVFKA 365
Cdd:PRK13520  284 VVERCMENTRWLAEELKERGF-EPVIEPVL--NIVAF----DDPNPDEVREK 328
 
Name Accession Description Interval E-value
DOPA_deC_like cd06450
DOPA decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent ...
130-352 9.71e-22

DOPA decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to DOPA/tyrosine decarboxylase (DDC), histidine decarboxylase (HDC), and glutamate decarboxylase (GDC). DDC is active as a dimer and catalyzes the decarboxylation of tyrosine. GDC catalyzes the decarboxylation of glutamate and HDC catalyzes the decarboxylation of histidine.


Pssm-ID: 99743  Cd Length: 345  Bit Score: 95.73  E-value: 9.71e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 130 KKPVIYLSAAARPGL---GQYLCNQLglpfpclCRVPCNtvfgSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVG 206
Cdd:cd06450    94 DKLVIVCSDQAHVSVekaAAYLDVKV-------RLVPVD----EDGRMDPEALEAAIDEDKAEGLNPIMVVATAGTTDTG 162
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 207 HTDKIGRLKELCEQYGIWLHVEGvnlatlALGyvsSSVLaaakcdsMTMTPGPWL-GLPAVPAVT------LYKHDDPAL 279
Cdd:cd06450   163 AIDPLEEIADLAEKYDLWLHVDA------AYG---GFLL-------PFPEPRHLDfGIERVDSISvdphkyGLVPLGCSA 226
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1370468124 280 TLVagltsnkptdklRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKILVEDELssPVVVFRF 352
Cdd:cd06450   227 VLV------------RALKLWATLRRFGRDGYGEHIDRIVDLAKYLAELIRADPGFELLGEPNL--SLVCFRL 285
GadA COG0076
Glutamate or tyrosine decarboxylase or a related PLP-dependent protein [Amino acid transport ...
122-352 1.89e-18

Glutamate or tyrosine decarboxylase or a related PLP-dependent protein [Amino acid transport and metabolism];


Pssm-ID: 223154 [Multi-domain]  Cd Length: 460  Bit Score: 87.43  E-value: 1.89e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 122 DGFNVLYNKKPVIYLSAAARPGLgQYLCNQLGLPFPCLCRVPCNtvfgsqHQMDVAFLEKLIKDDIERGrlplLLVANAG 201
Cdd:COG0076   148 LAESGKPGGKPNIVCSETAHFSF-EKAARYLGLGLRRVPTVPTD------YRIDVDALEEAIDENTIGG----VVVGTAG 216
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 202 TAAVGHTDKIGRLKELCEQYGIWLHVEGvnlatlALGyvsSSVLAAAKC-----------DSMTMTPGPWLGLPAVPAVT 270
Cdd:COG0076   217 TTDTGSIDDIEELADIAEEYGIWLHVDA------AFG---GFLLPFLEPdgrwdfglegvDSITVDGHKYGLAPIGCGVV 287
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 271 LYK----------HDDPALT----LVAGLTSNKPTDklRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIK 336
Cdd:COG0076   288 LFRdeealrriliFADYYLPgggiPNFTILGSRPGR--QALALYANLRRLGREGYRKLLDRTLELARYLAEELEKLGDFE 365
                         250
                  ....*....|....*.
gi 1370468124 337 ILVEDELssPVVVFRF 352
Cdd:COG0076   366 LVNEPEL--PIVAFRL 379
Pyridoxal_deC pfam00282
Pyridoxal-dependent decarboxylase conserved domain;
129-351 1.09e-12

Pyridoxal-dependent decarboxylase conserved domain;


Pssm-ID: 395219  Cd Length: 373  Bit Score: 68.98  E-value: 1.09e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 129 NKKPVIYLSAAArpglgQYLCNQLGLPFPCLCR-VPCNtvfgSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGH 207
Cdd:pfam00282 143 LAKLVAYTSDQA-----HSSIEKAALYGGVKLReIPSD----DNGKMRGMDLEKAIEEDKENGLIPFFVVATLGTTGSGA 213
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 208 TDKIGRLKELCEQYGIWLHVEGVNLATLALG-YVSSSVLAAAKCDSMTMTPGPWLGLPAvPAVTLYKHDDPALTLVAGL- 285
Cdd:pfam00282 214 FDDLQELGDICAKHNLWLHVDAAYGGSAFICpEFRHWLFGIERADSITFNPHKWMLVLL-DCSAVWVKDKEALQQAFQFn 292
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 286 -----TSNKPTD----------KLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKILVEDELssPVVVF 350
Cdd:pfam00282 293 plylgHTDSAYDtghkqiplsrRFRILKLWFVIRSLGVEGLQNQIRRHVELAQYLEALIRKDGRFEICAEVGL--GLVCF 370

                  .
gi 1370468124 351 R 351
Cdd:pfam00282 371 R 371
PRK13520 PRK13520
tyrosine decarboxylase MfnA;
170-365 1.51e-08

tyrosine decarboxylase MfnA;


Pssm-ID: 237409  Cd Length: 371  Bit Score: 56.43  E-value: 1.51e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 170 SQHQMDVAFLEKLIKDDIergrlpLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVE----GVNLATLALGYVSSSVL 245
Cdd:PRK13520  135 DDYRVDVKAVEDLIDDNT------IGIVGIAGTTELGQVDPIPELSKIALENGIFLHVDaafgGFVIPFLDDPPNFDFSL 208
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 246 AAAkcDSMTMTPGPwLGLPAVPA-VTLYKH---------DDPALT--LVAGLTSNKPtdKLRALPLWLSLQYLGLDGFVE 313
Cdd:PRK13520  209 PGV--DSITIDPHK-MGLAPIPAgGILFRDesyldalavDTPYLTskKQATLTGTRS--GAGVAATYAVMKYLGREGYRK 283
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1370468124 314 RIKHACQLSQRLQESLKKVNYiKILVEDELssPVVVFrffqELPGSDPVFKA 365
Cdd:PRK13520  284 VVERCMENTRWLAEELKERGF-EPVIEPVL--NIVAF----DDPNPDEVREK 328
PLN02880 PLN02880
tyrosine decarboxylase
130-387 7.44e-07

tyrosine decarboxylase


Pssm-ID: 215475  Cd Length: 490  Bit Score: 51.45  E-value: 7.44e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 130 KKPVIYLSAAARPGLgQYLCnQLGLPFPCLCRV---PCNTVFGSQHQMdvafLEKLIKDDIERGRLPLLLVANAGTAAVG 206
Cdd:PLN02880  180 EKLVVYASDQTHSAL-QKAC-QIAGIHPENCRLlktDSSTNYALAPEL----LSEAISTDLSSGLIPFFLCATVGTTSST 253
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 207 HTDKIGRLKELCEQYGIWLHVEGvnlatlalGYVSSSVL---------AAAKCDSMTMTPGPWLgLPAVPAVTLYKHDDP 277
Cdd:PLN02880  254 AVDPLLELGKIAKSNGMWFHVDA--------AYAGSACIcpeyrhyidGVEEADSFNMNAHKWF-LTNFDCSLLWVKDRN 324
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 278 ALTLVAG----LTSNKPTD----------------KLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQEslkkvnyiki 337
Cdd:PLN02880  325 ALIQSLStnpeFLKNKASQansvvdykdwqiplgrRFRSLKLWMVLRLYGVENLQSYIRNHIKLAKEFEQ---------- 394
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|
gi 1370468124 338 LVEDELSSPVVVFRFFqelpgSDPVFKAVPVPNMTPSGVGRERHSCDALN 387
Cdd:PLN02880  395 LVAQDSRFEVVTPRIF-----SLVCFRLVPPKNNEDNGNKLNHDLLDAVN 439
PRK02769 PRK02769
histidine decarboxylase; Provisional
159-334 3.19e-05

histidine decarboxylase; Provisional


Pssm-ID: 235068 [Multi-domain]  Cd Length: 380  Bit Score: 45.80  E-value: 3.19e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 159 LCRVPCNTVfGSQH--QMDVAFLEKLIKDDIERgrlPLLLVANAGTAAVGHTDKIGRLKELCEQYGI---WLHVEGVnLA 233
Cdd:PRK02769  129 LLRIKSRVI-TSLPngEIDYDDLISKIKENKNQ---PPIIFANIGTTMTGAIDNIKEIQEILKKIGIddyYIHADAA-LS 203
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 234 TLALGYV--SSSVLAAAKCDSMTMTPGPWLGLPaVPA---VTLYKHDDPALTLVAGLTSNKPT-----DKLRALPLWLSL 303
Cdd:PRK02769  204 GMILPFVnnPPPFSFADGIDSIAISGHKFIGSP-MPCgivLAKKKYVERISVDVDYIGSRDQTisgsrNGHTALLLWAAI 282
                         170       180       190
                  ....*....|....*....|....*....|.
gi 1370468124 304 QYLGLDGFVERIKHACQLSQRLQESLKKVNY 334
Cdd:PRK02769  283 RSLGSKGLRQRVQHCLDMAQYAVDRLQANGI 313
PLN02590 PLN02590
probable tyrosine decarboxylase
179-366 1.62e-04

probable tyrosine decarboxylase


Pssm-ID: 178200  Cd Length: 539  Bit Score: 43.93  E-value: 1.62e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 179 LEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLAL-GYVSSSVLAAAKCDSMTMTP 257
Cdd:PLN02590  274 LEEAISHDLAKGFIPFFICATVGTTSSAAVDPLVPLGNIAKKYGIWLHVDAAYAGNACIcPEYRKFIDGIENADSFNMNA 353
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 258 GPWLgLPAVPAVTLYKHDDPALtlvagltsnkpTDKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQeSLKKVNYIKI 337
Cdd:PLN02590  354 HKWL-FANQTCSPLWVKDRYSL-----------IDALKTNPEYLEFKVSKKDTVVNYKDWQISLSRRFR-SLKLWMVLRL 420
                         170       180       190
                  ....*....|....*....|....*....|...
gi 1370468124 338 LVEDELSS----PVVVFRFFQELPGSDPVFKAV 366
Cdd:PLN02590  421 YGSENLRNfirdHVNLAKHFEDYVAQDPSFEVV 453
PLN03032 PLN03032
serine decarboxylase; Provisional
193-372 3.82e-04

serine decarboxylase; Provisional


Pssm-ID: 166673 [Multi-domain]  Cd Length: 374  Bit Score: 42.51  E-value: 3.82e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 193 PLLLVANAGTAAVGHTDKIGRLKELCEQYGI-----WLHVEGVnLATLALGYVSSSVLAAAK--CDSMTMTPGPWLGLPa 265
Cdd:PLN03032  162 PAILNVNIGTTVKGAVDDLDRILRILKELGYtedrfYIHCDGA-LFGLMMPFVSRAPEVTFRkpIGSVSVSGHKFLGCP- 239
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 266 VP---AVTLYKHDDPALTLVAGLTSNKPT-----DKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKI 337
Cdd:PLN03032  240 MPcgvALTRKKHVKALSQNVEYLNSRDATimgsrNGHAPLYLWYTLRRKGYRGIKRDVQHCMRNAHYLKDRLTEAGLTCR 319
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 1370468124 338 LveDELSSPVVVFRFFQE-------LPGSDPVFKAVPVPNMT 372
Cdd:PLN03032  320 L--NELSSTVVFERPMDEafikkwqLACEGDIAHVVVMPNVT 359
TA_like cd06502
Low-specificity threonine aldolase (TA). This family belongs to pyridoxal phosphate (PLP) ...
166-254 5.33e-03

Low-specificity threonine aldolase (TA). This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). TA catalyzes the conversion of L-threonine or L-allo-threonine to glycine and acetaldehyde in a secondary glycine biosynthetic pathway.


Pssm-ID: 99748 [Multi-domain]  Cd Length: 338  Bit Score: 38.85  E-value: 5.33e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370468124 166 TVFGSQHQMDVAFLEKLI--KDDIERGRLPLLLVANAGTAAVGHT-DKIGRLKELCEQYGIWLHVEGVNLAtlalgyvss 242
Cdd:cd06502   100 PVPGENGKLTPEDLEAAIrpRDDIHFPPPSLVSLENTTEGGTVYPlDELKAISALAKENGLPLHLDGARLA--------- 170
                          90
                  ....*....|..
gi 1370468124 243 SVLAAAKCDSMT 254
Cdd:cd06502   171 NAAAALGVALKT 182
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH