NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1370488266|ref|XP_024310089|]
View 

LHFPL tetraspan subfamily member 2 protein isoform X1 [Homo sapiens]

Protein Classification

LHFPL tetraspan protein (domain architecture ID 10563002)

LHFPL (lipoma HMGIC fusion partner-like) tetraspan protein similar to human LHFPL5 that may be a component of hair cell's mechanotransduction machinery that functionally couples PCDH15 to the transduction channel

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
L_HMGIC_fpl pfam10242
Lipoma HMGIC fusion partner-like protein; This is a group of proteins expressed from a series ...
9-204 3.05e-66

Lipoma HMGIC fusion partner-like protein; This is a group of proteins expressed from a series of genes referred to as Lipoma HMGIC fusion partner-like. The proteins carry four highly conserved transmembrane domains in this entry. In certain instances, eg in LHFPL5, mutations cause deafness in humans and hypospadias, and LHFPL1 is transcribed in six liver tumor cell lines.


:

Pssm-ID: 370913  Cd Length: 181  Bit Score: 202.56  E-value: 3.05e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370488266   9 RSMLWTLLSIVVAFAELIAFMSADWLigkarsrggvepagpGGGSPEPYHPTLGIYARCIRnpgvQHFQRDTLCGPYAES 88
Cdd:pfam10242   1 VGVLWALLTICFAILSVVAFVQPYWL---------------GGSVDSPQAGSFGLYSRCIG----VMLQMELTCGGYALD 61
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370488266  89 FGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCG 168
Cdd:pfam10242  62 FLAIPSSAWQAAMFFVGLGTFLLLLIACLSLFTFCRQSIISKSVFKICGWLQLVAGLCLMLGCMLYPDGWDSPEVRRLCG 141
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 1370488266 169 HYASAYKPGDCSLGWAFYTAI----GGTVLTFICAVFSAQ 204
Cdd:pfam10242 142 PESGKYSLGLCSIGWAYYLAIigilDALLLTFLAFVLSLR 181
 
Name Accession Description Interval E-value
L_HMGIC_fpl pfam10242
Lipoma HMGIC fusion partner-like protein; This is a group of proteins expressed from a series ...
9-204 3.05e-66

Lipoma HMGIC fusion partner-like protein; This is a group of proteins expressed from a series of genes referred to as Lipoma HMGIC fusion partner-like. The proteins carry four highly conserved transmembrane domains in this entry. In certain instances, eg in LHFPL5, mutations cause deafness in humans and hypospadias, and LHFPL1 is transcribed in six liver tumor cell lines.


Pssm-ID: 370913  Cd Length: 181  Bit Score: 202.56  E-value: 3.05e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370488266   9 RSMLWTLLSIVVAFAELIAFMSADWLigkarsrggvepagpGGGSPEPYHPTLGIYARCIRnpgvQHFQRDTLCGPYAES 88
Cdd:pfam10242   1 VGVLWALLTICFAILSVVAFVQPYWL---------------GGSVDSPQAGSFGLYSRCIG----VMLQMELTCGGYALD 61
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370488266  89 FGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCG 168
Cdd:pfam10242  62 FLAIPSSAWQAAMFFVGLGTFLLLLIACLSLFTFCRQSIISKSVFKICGWLQLVAGLCLMLGCMLYPDGWDSPEVRRLCG 141
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 1370488266 169 HYASAYKPGDCSLGWAFYTAI----GGTVLTFICAVFSAQ 204
Cdd:pfam10242 142 PESGKYSLGLCSIGWAYYLAIigilDALLLTFLAFVLSLR 181
 
Name Accession Description Interval E-value
L_HMGIC_fpl pfam10242
Lipoma HMGIC fusion partner-like protein; This is a group of proteins expressed from a series ...
9-204 3.05e-66

Lipoma HMGIC fusion partner-like protein; This is a group of proteins expressed from a series of genes referred to as Lipoma HMGIC fusion partner-like. The proteins carry four highly conserved transmembrane domains in this entry. In certain instances, eg in LHFPL5, mutations cause deafness in humans and hypospadias, and LHFPL1 is transcribed in six liver tumor cell lines.


Pssm-ID: 370913  Cd Length: 181  Bit Score: 202.56  E-value: 3.05e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370488266   9 RSMLWTLLSIVVAFAELIAFMSADWLigkarsrggvepagpGGGSPEPYHPTLGIYARCIRnpgvQHFQRDTLCGPYAES 88
Cdd:pfam10242   1 VGVLWALLTICFAILSVVAFVQPYWL---------------GGSVDSPQAGSFGLYSRCIG----VMLQMELTCGGYALD 61
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370488266  89 FGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCG 168
Cdd:pfam10242  62 FLAIPSSAWQAAMFFVGLGTFLLLLIACLSLFTFCRQSIISKSVFKICGWLQLVAGLCLMLGCMLYPDGWDSPEVRRLCG 141
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 1370488266 169 HYASAYKPGDCSLGWAFYTAI----GGTVLTFICAVFSAQ 204
Cdd:pfam10242 142 PESGKYSLGLCSIGWAYYLAIigilDALLLTFLAFVLSLR 181
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH