NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1622948440|ref|XP_028705782|]
View 

sodium-dependent phosphate transport protein 2A isoform X1 [Macaca mulatta]

Protein Classification

sodium-dependent phosphate transport protein 2 (domain architecture ID 11490082)

sodium-dependent phosphate transport protein 2 may be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-551 1.84e-155

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


:

Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 453.93  E-value: 1.84e-155
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 108 LSFLYLFICSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITQLVVASFNIHGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 268 KIITEPFTKLIIQLDKSVITSIAtgdeSLRNHSLIRIWCHPDsleapTSMSRAEANSSQTlgnatmekcNHIFVDtslpd 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTL-----SSLPVPESNLPIE---------AHIFVN----- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 348 laVGLILLAGSLVLLCTCLILLVKMLNSLLKGQVAKVIQKVINT------------------------------------ 391
Cdd:TIGR01013 218 --VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLdtpvpflwvtgyeallvgdamtfiiqsssvftsalt 295
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 392 ---GLDVISIERAYPLTLGSNIGTTTTAILAALASPKEKLFSAFQIALCHFFFNISGILLWYPVPCTRLPIRMAKALGER 468
Cdd:TIGR01013 296 plvGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYCHNLFNISGIVLFYPLPCTRKPIAAARGFGDD 375
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 469 TAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQVMVGVGTPFGALLAFVVLINVLQSRSPGhlPKWLQTWDFLPRWMHSLK 548
Cdd:TIGR01013 376 GSKYRWFLIVYLVLNFLLAPSLLFGLDLNLARRLVGVKIPFRILELFSSLLHVLQLRCPR--PQSLQTWSFLPDWLRSLK 453

                  ...
gi 1622948440 549 PLD 551
Cdd:TIGR01013 454 RLD 456
 
Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-551 1.84e-155

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 453.93  E-value: 1.84e-155
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 108 LSFLYLFICSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITQLVVASFNIHGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 268 KIITEPFTKLIIQLDKSVITSIAtgdeSLRNHSLIRIWCHPDsleapTSMSRAEANSSQTlgnatmekcNHIFVDtslpd 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTL-----SSLPVPESNLPIE---------AHIFVN----- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 348 laVGLILLAGSLVLLCTCLILLVKMLNSLLKGQVAKVIQKVINT------------------------------------ 391
Cdd:TIGR01013 218 --VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLdtpvpflwvtgyeallvgdamtfiiqsssvftsalt 295
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 392 ---GLDVISIERAYPLTLGSNIGTTTTAILAALASPKEKLFSAFQIALCHFFFNISGILLWYPVPCTRLPIRMAKALGER 468
Cdd:TIGR01013 296 plvGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYCHNLFNISGIVLFYPLPCTRKPIAAARGFGDD 375
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 469 TAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQVMVGVGTPFGALLAFVVLINVLQSRSPGhlPKWLQTWDFLPRWMHSLK 548
Cdd:TIGR01013 376 GSKYRWFLIVYLVLNFLLAPSLLFGLDLNLARRLVGVKIPFRILELFSSLLHVLQLRCPR--PQSLQTWSFLPDWLRSLK 453

                  ...
gi 1622948440 549 PLD 551
Cdd:TIGR01013 454 RLD 456
Na_Pi_cotrans pfam02690
Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters ...
113-204 1.18e-15

Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.


Pssm-ID: 397008 [Multi-domain]  Cd Length: 137  Bit Score: 73.97  E-value: 1.18e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 113 LFICSLDVLSSAFQlaggKVAGDIFKD--NAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMG 190
Cdd:pfam02690   1 LFLFGMKLMSDGLQ----KLAGGRLRRilEKLTSNPLKGLLVGLLVTALLQSSSATTVMVVGFVNAGLLTLRQAIGVIMG 76
                          90
                  ....*....|....
gi 1622948440 191 SNIGTSVTNTIVAL 204
Cdd:pfam02690  77 ANIGTTVTAQLIAF 90
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
106-452 1.80e-14

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 76.13  E-value: 1.80e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 106 LMLSFLYLFICSLDVLSSAFQLAGGKVAGDIFkdNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAI 185
Cdd:COG1283     9 NLLGAVALLLFGIKMVGDGVQRAAGDRLRKIL--ARFTSNPILGVLAGIVATALLQSSTATTVLTIGFVAAGLLSLKQAI 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 186 PIIMGSNIGTSVTNTIVALmqaGDRTDFRRAFAGATVHDCFNWLSVLVllpleaatgylhhitQLVVASFNIHGGRDAPD 265
Cdd:COG1283    87 GVILGANIGTTVTAWIVAL---DLSWLSPPLLAIGAILFFFGKSSKLR---------------QLGRVLFGIGLIFLSLE 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 266 LLKIITEPFTKliiqldksvitSIATGDeslrnhsliriwchpdsleaptsmsraeanssqtlgnatmeKCNHIFVDtsl 345
Cdd:COG1283   149 LLGQATEPLRQ-----------SPAFSD-----------------------------------------FIAKLSDD--- 173
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 346 PDLAVGLILLAGSLVLLCTCLILLVKMLnsllkgqvakviqkvinTGLDVISIERAYPLTLGSNIGTTTTAILAALASPK 425
Cdd:COG1283   174 PIVALLIGALLTALIQSSLAAIGILLSL-----------------TSQGLISLEAALALVLGANLGTTITAVLAALGASA 236
                         330       340
                  ....*....|....*....|....*..
gi 1622948440 426 eklfSAFQIALCHFFFNISGILLWYPV 452
Cdd:COG1283   237 ----AARRVALGNLLFNLIGVLIFLPV 259
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
110-204 5.16e-07

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 51.45  E-value: 5.16e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 110 FLYLFICSLDVLSSA-FQLAGGKVAGDIFKdnaILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPII 188
Cdd:NF037997    4 YIAIFLLGMTVLRSGlFNLSGHKLKTWLLK---FTDTPLKGFLTGTVITAILQSSSAVMVLTVGLVSAGILTFRQSIGII 80
                          90
                  ....*....|....*.
gi 1622948440 189 MGSNIGTSVTNTIVAL 204
Cdd:NF037997   81 LGTNIGTTFTTEFITF 96
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
145-237 5.34e-05

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 45.28  E-value: 5.34e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 145 NPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALmqAGDRTDFRRAFAgatvHD 224
Cdd:NF037997  163 SLLLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASI--GSGKEAKLTAYA----HI 236
                          90
                  ....*....|...
gi 1622948440 225 CFNWLSVLVLLPL 237
Cdd:NF037997  237 WLNVLGVLLFLPF 249
 
Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-551 1.84e-155

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 453.93  E-value: 1.84e-155
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 108 LSFLYLFICSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITQLVVASFNIHGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 268 KIITEPFTKLIIQLDKSVITSIAtgdeSLRNHSLIRIWCHPDsleapTSMSRAEANSSQTlgnatmekcNHIFVDtslpd 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTL-----SSLPVPESNLPIE---------AHIFVN----- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 348 laVGLILLAGSLVLLCTCLILLVKMLNSLLKGQVAKVIQKVINT------------------------------------ 391
Cdd:TIGR01013 218 --VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLdtpvpflwvtgyeallvgdamtfiiqsssvftsalt 295
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 392 ---GLDVISIERAYPLTLGSNIGTTTTAILAALASPKEKLFSAFQIALCHFFFNISGILLWYPVPCTRLPIRMAKALGER 468
Cdd:TIGR01013 296 plvGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYCHNLFNISGIVLFYPLPCTRKPIAAARGFGDD 375
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 469 TAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQVMVGVGTPFGALLAFVVLINVLQSRSPGhlPKWLQTWDFLPRWMHSLK 548
Cdd:TIGR01013 376 GSKYRWFLIVYLVLNFLLAPSLLFGLDLNLARRLVGVKIPFRILELFSSLLHVLQLRCPR--PQSLQTWSFLPDWLRSLK 453

                  ...
gi 1622948440 549 PLD 551
Cdd:TIGR01013 454 RLD 456
Na_Pi_cotrans pfam02690
Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters ...
113-204 1.18e-15

Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.


Pssm-ID: 397008 [Multi-domain]  Cd Length: 137  Bit Score: 73.97  E-value: 1.18e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 113 LFICSLDVLSSAFQlaggKVAGDIFKD--NAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMG 190
Cdd:pfam02690   1 LFLFGMKLMSDGLQ----KLAGGRLRRilEKLTSNPLKGLLVGLLVTALLQSSSATTVMVVGFVNAGLLTLRQAIGVIMG 76
                          90
                  ....*....|....
gi 1622948440 191 SNIGTSVTNTIVAL 204
Cdd:pfam02690  77 ANIGTTVTAQLIAF 90
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
106-452 1.80e-14

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 76.13  E-value: 1.80e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 106 LMLSFLYLFICSLDVLSSAFQLAGGKVAGDIFkdNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAI 185
Cdd:COG1283     9 NLLGAVALLLFGIKMVGDGVQRAAGDRLRKIL--ARFTSNPILGVLAGIVATALLQSSTATTVLTIGFVAAGLLSLKQAI 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 186 PIIMGSNIGTSVTNTIVALmqaGDRTDFRRAFAGATVHDCFNWLSVLVllpleaatgylhhitQLVVASFNIHGGRDAPD 265
Cdd:COG1283    87 GVILGANIGTTVTAWIVAL---DLSWLSPPLLAIGAILFFFGKSSKLR---------------QLGRVLFGIGLIFLSLE 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 266 LLKIITEPFTKliiqldksvitSIATGDeslrnhsliriwchpdsleaptsmsraeanssqtlgnatmeKCNHIFVDtsl 345
Cdd:COG1283   149 LLGQATEPLRQ-----------SPAFSD-----------------------------------------FIAKLSDD--- 173
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 346 PDLAVGLILLAGSLVLLCTCLILLVKMLnsllkgqvakviqkvinTGLDVISIERAYPLTLGSNIGTTTTAILAALASPK 425
Cdd:COG1283   174 PIVALLIGALLTALIQSSLAAIGILLSL-----------------TSQGLISLEAALALVLGANLGTTITAVLAALGASA 236
                         330       340
                  ....*....|....*....|....*..
gi 1622948440 426 eklfSAFQIALCHFFFNISGILLWYPV 452
Cdd:COG1283   237 ----AARRVALGNLLFNLIGVLIFLPV 259
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
110-204 5.16e-07

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 51.45  E-value: 5.16e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 110 FLYLFICSLDVLSSA-FQLAGGKVAGDIFKdnaILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPII 188
Cdd:NF037997    4 YIAIFLLGMTVLRSGlFNLSGHKLKTWLLK---FTDTPLKGFLTGTVITAILQSSSAVMVLTVGLVSAGILTFRQSIGII 80
                          90
                  ....*....|....*.
gi 1622948440 189 MGSNIGTSVTNTIVAL 204
Cdd:NF037997   81 LGTNIGTTFTTEFITF 96
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
92-278 6.72e-07

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 52.25  E-value: 6.72e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440  92 SKLRQAGAMLLKVPLMLsflylfiCSLDVLSSAFQ-LAGGKVAGDIFKdnAILSNPVAGLVVGILVTVLVQSSSTSTSII 170
Cdd:COG1283   128 SKLRQLGRVLFGIGLIF-------LSLELLGQATEpLRQSPAFSDFIA--KLSDDPIVALLIGALLTALIQSSLAAIGIL 198
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 171 VSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALmqAGDRTDFRRAFAgatvHDCFNWLSVLVLLPLeaaTGYLHHIT-- 248
Cdd:COG1283   199 LSLTSQGLISLEAALALVLGANLGTTITAVLAAL--GASAAARRVALG----NLLFNLIGVLIFLPV---IHLLATFAsk 269
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1622948440 249 -------QLVVAS--FNIhggrdapdLLKIITEPFTKLI 278
Cdd:COG1283   270 lslppaaLIAHAHllFNI--------VLALAALPFTGLL 300
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
145-237 5.34e-05

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 45.28  E-value: 5.34e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1622948440 145 NPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALmqAGDRTDFRRAFAgatvHD 224
Cdd:NF037997  163 SLLLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASI--GSGKEAKLTAYA----HI 236
                          90
                  ....*....|...
gi 1622948440 225 CFNWLSVLVLLPL 237
Cdd:NF037997  237 WLNVLGVLLFLPF 249
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH