NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1720429481|ref|XP_030099770|]
View 

cell surface glycoprotein 1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PHA03247 super family cl33720
large tegument protein UL36; Provisional
229-652 4.63e-08

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 56.87  E-value: 4.63e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  229 PAGVEPTTSSQCAPDCEDPAVIEPTHSTCA----ADSRAPADAEPNSSTCAAVNGAPADVEPTTSQlvPDSGAPADVEPT 304
Cdd:PHA03247  2562 AAPDRSVPPPRPAPRPSEPAVTSRARRPDAppqsARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPP--PPSPSPAANEPD 2639
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  305 TSHCAPDCEDPAviepthstcAADSRAPADAEPNSSTCADVNGAPADDEPNSSTCAAvngAPADDEPTTSQCVPDCEDPA 384
Cdd:PHA03247  2640 PHPPPTVPPPER---------PRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRA---ARPTVGSLTSLADPPPPPPT 2707
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  385 VIEPTHSTCAADSRAPADAEPNSSTCAAVNGAAADAEPTTSSQCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAA 464
Cdd:PHA03247  2708 PEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPA 2787
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  465 VngAPADVEPTTSQLVPDSGAPADVEPTTSQCAPDCDDPAVIE--PTHSNCAADSRAPADAEPNSSTCAAVngatadvep 542
Cdd:PHA03247  2788 V--ASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLppPTSAQPTAPPPPPGPPPPSLPLGGSV--------- 2856
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  543 ttsqlvpVSGAPADVDPTTSQCAPDCEDPAVIEPTHSTCAADSRAPAHIEPTPSQLAPDRGAPADVEPTHSTCAADTRIP 622
Cdd:PHA03247  2857 -------APGGDVRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQP 2929
                          410       420       430
                   ....*....|....*....|....*....|
gi 1720429481  623 ADIEPSPSQcaPDSPAPSDIGEEPSPVADP 652
Cdd:PHA03247  2930 QPPPPPPPR--PQPPLAPTTDPAGAGEPSG 2957
Ank_2 super family cl39094
Ankyrin repeats (3 copies);
2-50 1.06e-03

Ankyrin repeats (3 copies);


The actual alignment was detected with superfamily member pfam12796:

Pssm-ID: 423045 [Multi-domain]  Cd Length: 91  Bit Score: 38.56  E-value: 1.06e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 1720429481   2 LLEHNVDIEAKTEYGLTPLQLATFEQKPEMVEFLAAKCAKSSVTPSWSP 50
Cdd:pfam12796  16 LLENGADANLQDKNGRTALHLAAKNGHLEIVKLLLEHADVNLKDNGRTA 64
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
229-652 4.63e-08

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 56.87  E-value: 4.63e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  229 PAGVEPTTSSQCAPDCEDPAVIEPTHSTCA----ADSRAPADAEPNSSTCAAVNGAPADVEPTTSQlvPDSGAPADVEPT 304
Cdd:PHA03247  2562 AAPDRSVPPPRPAPRPSEPAVTSRARRPDAppqsARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPP--PPSPSPAANEPD 2639
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  305 TSHCAPDCEDPAviepthstcAADSRAPADAEPNSSTCADVNGAPADDEPNSSTCAAvngAPADDEPTTSQCVPDCEDPA 384
Cdd:PHA03247  2640 PHPPPTVPPPER---------PRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRA---ARPTVGSLTSLADPPPPPPT 2707
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  385 VIEPTHSTCAADSRAPADAEPNSSTCAAVNGAAADAEPTTSSQCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAA 464
Cdd:PHA03247  2708 PEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPA 2787
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  465 VngAPADVEPTTSQLVPDSGAPADVEPTTSQCAPDCDDPAVIE--PTHSNCAADSRAPADAEPNSSTCAAVngatadvep 542
Cdd:PHA03247  2788 V--ASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLppPTSAQPTAPPPPPGPPPPSLPLGGSV--------- 2856
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  543 ttsqlvpVSGAPADVDPTTSQCAPDCEDPAVIEPTHSTCAADSRAPAHIEPTPSQLAPDRGAPADVEPTHSTCAADTRIP 622
Cdd:PHA03247  2857 -------APGGDVRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQP 2929
                          410       420       430
                   ....*....|....*....|....*....|
gi 1720429481  623 ADIEPSPSQcaPDSPAPSDIGEEPSPVADP 652
Cdd:PHA03247  2930 QPPPPPPPR--PQPPLAPTTDPAGAGEPSG 2957
MSCRAMM_ClfB NF033845
MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial ...
270-549 1.32e-04

MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.


Pssm-ID: 411414 [Multi-domain]  Cd Length: 871  Bit Score: 45.32  E-value: 1.32e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 270 NSSTCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTS---HCAPDCE-----DPAVIEPTHSTCAADSRAPADAEPNSST 341
Cdd:NF033845  523 NNENVVRYGGGSADGDSAVNPKDPTPGPPVDPEPSPEpepEPTPDPEpspdpDPEPSPDPDPDSDSDSDSGSDSDSGSDS 602
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 342 CADVNGAPADDEPNSSTCAAVNGAPADDEPTTSQCVPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAAADAE 421
Cdd:NF033845  603 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDDSDSDSDSDSDSDSDSD 682
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 422 PTTSSQCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTSQCAPDCD 501
Cdd:NF033845  683 SDSDSDSDSDSDSDSDSDSSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 762
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*...
gi 1720429481 502 DPAVIEPTHSNCAADSRAPADAEPNSSTCAAVNGATADVEPTTSQLVP 549
Cdd:NF033845  763 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSRVTPPNNEQKAP 810
Streccoc_I_II NF033804
antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins ...
537-652 2.07e-04

antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.


Pssm-ID: 411384 [Multi-domain]  Cd Length: 1552  Bit Score: 44.93  E-value: 2.07e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  537 TADVEPTTSQLVPVSGAPA----DVDPTTSQCAPDCEDPAV-IEPTHSTCAADSRAPA----HIEPTPSQLAPDRGAPAD 607
Cdd:NF033804   839 TAPQAPTYEVEKPLEPAPVaptyENEPTPPVKTPDQPEPSKpEEPTYETEKPLEPAPVaptyENEPTPPVKTPDQPEPSK 918
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 1720429481  608 -VEPTHSTCAADTRIPA----DIEPSPSQCAPDSPAPSDIGEE-----PSPVADP 652
Cdd:NF033804   919 pEEPTYETEKPLEPAPVapsyENEPTPPVKTPDQPEPSKPVEPtydplPTPPVAP 973
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
481-650 4.39e-04

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 43.75  E-value: 4.39e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 481 PDSGAPADVEPTTSQCAPDCDDPAviePTHSNCAADSRAPADAEPNSSTCAAVNGATADvepTTSQLVPVSGAPADVDPT 560
Cdd:pfam05109 425 PESTTTSPTLNTTGFAAPNTTTGL---PSSTHVPTNLTAPASTGPTVSTADVTSPTPAG---TTSGASPVTPSPSPRDNG 498
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 561 TSQCAPDCEDP--AVIEPTHStcaADSRAPAHIEPTPSQLAPDRGAPADVEP-THSTCAADTRIPADIEPSPSQCAPD-- 635
Cdd:pfam05109 499 TESKAPDMTSPtsAVTTPTPN---ATSPTPAVTTPTPNATSPTLGKTSPTSAvTTPTPNATSPTPAVTTPTPNATIPTlg 575
                         170
                  ....*....|....*
gi 1720429481 636 SPAPSDIGEEPSPVA 650
Cdd:pfam05109 576 KTSPTSAVTTPTPNA 590
Ank_2 pfam12796
Ankyrin repeats (3 copies);
2-50 1.06e-03

Ankyrin repeats (3 copies);


Pssm-ID: 403870 [Multi-domain]  Cd Length: 91  Bit Score: 38.56  E-value: 1.06e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 1720429481   2 LLEHNVDIEAKTEYGLTPLQLATFEQKPEMVEFLAAKCAKSSVTPSWSP 50
Cdd:pfam12796  16 LLENGADANLQDKNGRTALHLAAKNGHLEIVKLLLEHADVNLKDNGRTA 64
MSCRAMM_ClfA NF033609
MSCRAMM family adhesin clumping factor ClfA; Clumping factor A is an MSCRAMM (Microbial ...
193-571 5.26e-03

MSCRAMM family adhesin clumping factor ClfA; Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.


Pssm-ID: 411231 [Multi-domain]  Cd Length: 934  Bit Score: 40.29  E-value: 5.26e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 193 EAPGDIEPThstcATDSRAPADAEPNSSTCAAVNGAPAGVEPTTSSQcapdcedpaviepthSTCAADSRAPADAEPNSS 272
Cdd:NF033609  549 DEPGEIEPI----PEDSDSDPGSDSGSDSSNSDSGSDSGSDSTSDSG---------------SDSASDSDSASDSDSASD 609
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 273 TCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTSHCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCADVNGAPADD 352
Cdd:NF033609  610 SDSASDSDSASDSDSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 689
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 353 EPNSSTCAAVNGAPADDEPTTSQcvpdcedpaviePTHSTCAADSRAPADAEPNSSTCAAVNGAAADAEPTTSSQCAPDC 432
Cdd:NF033609  690 SDSDSDSDSDSDSDSDSDSDSDS------------DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 757
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 433 EDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTSQCAPDCDDPAVIEPTHSN 512
Cdd:NF033609  758 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 837
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 1720429481 513 CAADSRAPADAEPNSSTCAAVNGATADVEPTTSQLVPVSGAPADVDPTTSQCAPDCEDP 571
Cdd:NF033609  838 SDSDSDSDSDSDSDSDSDSESDSNSDSESGSNNNVVPPNSPKNGTNASNKNEAKDSKEP 896
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
229-652 4.63e-08

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 56.87  E-value: 4.63e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  229 PAGVEPTTSSQCAPDCEDPAVIEPTHSTCA----ADSRAPADAEPNSSTCAAVNGAPADVEPTTSQlvPDSGAPADVEPT 304
Cdd:PHA03247  2562 AAPDRSVPPPRPAPRPSEPAVTSRARRPDAppqsARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPP--PPSPSPAANEPD 2639
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  305 TSHCAPDCEDPAviepthstcAADSRAPADAEPNSSTCADVNGAPADDEPNSSTCAAvngAPADDEPTTSQCVPDCEDPA 384
Cdd:PHA03247  2640 PHPPPTVPPPER---------PRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRA---ARPTVGSLTSLADPPPPPPT 2707
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  385 VIEPTHSTCAADSRAPADAEPNSSTCAAVNGAAADAEPTTSSQCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAA 464
Cdd:PHA03247  2708 PEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPA 2787
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  465 VngAPADVEPTTSQLVPDSGAPADVEPTTSQCAPDCDDPAVIE--PTHSNCAADSRAPADAEPNSSTCAAVngatadvep 542
Cdd:PHA03247  2788 V--ASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLppPTSAQPTAPPPPPGPPPPSLPLGGSV--------- 2856
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  543 ttsqlvpVSGAPADVDPTTSQCAPDCEDPAVIEPTHSTCAADSRAPAHIEPTPSQLAPDRGAPADVEPTHSTCAADTRIP 622
Cdd:PHA03247  2857 -------APGGDVRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQP 2929
                          410       420       430
                   ....*....|....*....|....*....|
gi 1720429481  623 ADIEPSPSQcaPDSPAPSDIGEEPSPVADP 652
Cdd:PHA03247  2930 QPPPPPPPR--PQPPLAPTTDPAGAGEPSG 2957
PHA03247 PHA03247
large tegument protein UL36; Provisional
194-650 3.23e-07

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 54.17  E-value: 3.23e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  194 APGDIEPthstcATDSRAPADAEPNSSTCAAVNGAPAGVEPTTSSQCAPDCEDPAVIEPthstcAADSRAPADAEPNSST 273
Cdd:PHA03247  2574 APRPSEP-----AVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPP-----PPSPSPAANEPDPHPP 2643
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  274 CAAVNGAPADVEPTTSQLVPDSGAPADVEPTTSHCAPDCEDPAVIEPTHSTCAADSRAPA-DAEPNSSTCADVNGAPADD 352
Cdd:PHA03247  2644 PTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAARPTVGSLTSLADPPPpPPTPEPAPHALVSATPLPP 2723
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  353 EPNSSTCA--AVNGAPADDEPTTSQCVPDCEDPAVIEPTHSTCAADS--RAPADAEPNSSTcaaVNGAAADAEPTTSSQC 428
Cdd:PHA03247  2724 GPAAARQAspALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAppAAPAAGPPRRLT---RPAVASLSESRESLPS 2800
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  429 APDCEDPAVIEPthstcaadsrAPADAEPNSSTCAAVNGAPADVEPTTSQLVPdsGAPADVEPTTSQCAPdcDDPAVIEP 508
Cdd:PHA03247  2801 PWDPADPPAAVL----------APAAALPPAASPAGPLPPPTSAQPTAPPPPP--GPPPPSLPLGGSVAP--GGDVRRRP 2866
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  509 THSNCAADSRAPADAEPNSSTCAAVNGATADVEPTTSQLVPVSGAPADVDPTTSQCAPDCEDPAVIEPT----HSTCAAD 584
Cdd:PHA03247  2867 PSRSPAAKPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPpprpQPPLAPT 2946
                          410       420       430       440       450       460
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720429481  585 SRAPAHIEPTPSQLAPDRGAPADVEpthsTCAADTRIPadiEPSPSQCAPDSPAPSDIGEEPSPVA 650
Cdd:PHA03247  2947 TDPAGAGEPSGAVPQPWLGALVPGR----VAVPRFRVP---QPAPSREAPASSTPPLTGHSLSRVS 3005
PHA03247 PHA03247
large tegument protein UL36; Provisional
210-659 3.10e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 51.09  E-value: 3.10e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  210 RAPADAEPNSSTCA---AVNGAPAGVEPTTSSQCAPDC-EDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAPADVE 285
Cdd:PHA03247  2482 RPAEARFPFAAGAApdpGGGGPPDPDAPPAPSRLAPAIlPDEPVGEPVHPRMLTWIRGLEELASDDAGDPPPPLPPAAPP 2561
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  286 PTTSQLVPdsgapadveptTSHCAPDCEDPAVIEPTHSTCA----ADSRAPADAEPNSSTCADVNGAPAD----DEPNSS 357
Cdd:PHA03247  2562 AAPDRSVP-----------PPRPAPRPSEPAVTSRARRPDAppqsARPRAPVDDRGDPRGPAPPSPLPPDthapDPPPPS 2630
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  358 TCAAVNGAPADDEPTTSQCVPDCEDPAVIEPT-HSTCAADSRAPADAEPNS--------STCAAVNGAAADAEPTTSSQC 428
Cdd:PHA03247  2631 PSPAANEPDPHPPPTVPPPERPRDDPAPGRVSrPRRARRLGRAAQASSPPQrprrraarPTVGSLTSLADPPPPPPTPEP 2710
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  429 APDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPdSGAPADVEPTTSQCAPdcddPAVIEP 508
Cdd:PHA03247  2711 APHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTT-AGPPAPAPPAAPAAGP----PRRLTR 2785
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  509 THSNCAADSRAPADAEPNSSTCAAVNGATADVEPTTSQlvPVSGAPAdvdPTTSQCAPDCEDPAVIEPTHSTCAA----- 583
Cdd:PHA03247  2786 PAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAAS--PAGPLPP---PTSAQPTAPPPPPGPPPPSLPLGGSvapgg 2860
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  584 ------DSRAPAHIEPTPSQLAPDRGAPADVEPTHSTCA----ADTRIPADIEPSPSQCAPDSPAPSDIGEEPSPVADPD 653
Cdd:PHA03247  2861 dvrrrpPSRSPAAKPAAPARPPVRRLARPAVSRSTESFAlppdQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQ 2940

                   ....*.
gi 1720429481  654 EDIAED 659
Cdd:PHA03247  2941 PPLAPT 2946
PHA03247 PHA03247
large tegument protein UL36; Provisional
212-599 1.63e-05

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 48.78  E-value: 1.63e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  212 PADAEPNSSTCAAVNGAPAGVEPTTSSQCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAPAD-VEPTTSQ 290
Cdd:PHA03247  2703 PPPPTPEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAApAAGPPRR 2782
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  291 LVPDSGAPADVEPTTSHCAPDCEDP--AVIEPTHSTCAADSRAPADAEPNSSTCADVNGAPADDEPNSSTCAAVN-GAPA 367
Cdd:PHA03247  2783 LTRPAVASLSESRESLPSPWDPADPpaAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVApGGDV 2862
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  368 DDEPTTSQCVPdcedpaviEPTHSTCAADSRAPADAEPNSSTCAAVNGAAADAEPTTSSQCAPDCEDPAVIEPTHSTC-A 446
Cdd:PHA03247  2863 RRRPPSRSPAA--------KPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPpP 2934
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  447 ADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPdsGAPADVEPTTSQCAPDCDDPAVIEPT---HSNCAADSRAPA-- 521
Cdd:PHA03247  2935 PPPRPQPPLAPTTDPAGAGEPSGAVPQPWLGALVP--GRVAVPRFRVPQPAPSREAPASSTPPltgHSLSRVSSWASSla 3012
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  522 ---DAEPNSSTCAAVNGATADVEPTTSQLVPVSGAPADVDPTTSQCAPDCEDPAVIEPTHSTCAADSRAPAHIEPTPSQL 598
Cdd:PHA03247  3013 lheETDPPPVSLKQTLWPPDDTEDSDADSLFDSDSERSDLEALDPLPPEPHDPFAHEPDPATPEAGARESPSSQFGPPPL 3092

                   .
gi 1720429481  599 A 599
Cdd:PHA03247  3093 S 3093
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
208-409 8.38e-05

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 46.02  E-value: 8.38e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 208 DSRAPADAEPNSSTCAAVNGAPAGVEPTTSSQCAPDCEDPAVIEPTHSTCAADSRA-PADAEPNSSTCAAVNGAPADVEP 286
Cdd:PRK12323  371 GAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRsPAPEALAAARQASARGPGGAPAP 450
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 287 TTSQL-VPDSGAPADVEPTTSHCAPDCEDPAVIEPTHSTCAADSRAP----ADAEPNSSTCADVNGAPADDEPNSSTCAA 361
Cdd:PRK12323  451 APAPAaAPAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPpweeLPPEFASPAPAQPDAAPAGWVAESIPDPA 530
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 1720429481 362 VNGAPADDEPTTSQCVPDCEDPAVIEPTHSTCAADSRAPADAEPNSST 409
Cdd:PRK12323  531 TADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPDMFD 578
MSCRAMM_ClfB NF033845
MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial ...
270-549 1.32e-04

MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.


Pssm-ID: 411414 [Multi-domain]  Cd Length: 871  Bit Score: 45.32  E-value: 1.32e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 270 NSSTCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTS---HCAPDCE-----DPAVIEPTHSTCAADSRAPADAEPNSST 341
Cdd:NF033845  523 NNENVVRYGGGSADGDSAVNPKDPTPGPPVDPEPSPEpepEPTPDPEpspdpDPEPSPDPDPDSDSDSDSGSDSDSGSDS 602
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 342 CADVNGAPADDEPNSSTCAAVNGAPADDEPTTSQCVPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAAADAE 421
Cdd:NF033845  603 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDDSDSDSDSDSDSDSDSD 682
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 422 PTTSSQCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTSQCAPDCD 501
Cdd:NF033845  683 SDSDSDSDSDSDSDSDSDSSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 762
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*...
gi 1720429481 502 DPAVIEPTHSNCAADSRAPADAEPNSSTCAAVNGATADVEPTTSQLVP 549
Cdd:NF033845  763 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSRVTPPNNEQKAP 810
Streccoc_I_II NF033804
antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins ...
537-652 2.07e-04

antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.


Pssm-ID: 411384 [Multi-domain]  Cd Length: 1552  Bit Score: 44.93  E-value: 2.07e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  537 TADVEPTTSQLVPVSGAPA----DVDPTTSQCAPDCEDPAV-IEPTHSTCAADSRAPA----HIEPTPSQLAPDRGAPAD 607
Cdd:NF033804   839 TAPQAPTYEVEKPLEPAPVaptyENEPTPPVKTPDQPEPSKpEEPTYETEKPLEPAPVaptyENEPTPPVKTPDQPEPSK 918
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 1720429481  608 -VEPTHSTCAADTRIPA----DIEPSPSQCAPDSPAPSDIGEE-----PSPVADP 652
Cdd:NF033804   919 pEEPTYETEKPLEPAPVapsyENEPTPPVKTPDQPEPSKPVEPtydplPTPPVAP 973
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
208-574 2.48e-04

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 44.78  E-value: 2.48e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  208 DSRAPADAEPNSSTCAAVNGAPAGVEPTTSSQCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAPADVEPT 287
Cdd:PHA03307    45 SDSAELAAVTVVAGAAACDRFEPPTGPPPGPGTEAPANESRSTPTWSLSTLAPASPAREGSPTPPGPSSPDPPPPTPPPA 124
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  288 TSQLVPDSGAPADVEPTTSHCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCADVNGAPADDEPNSSTCAAVNGAPA 367
Cdd:PHA03307   125 SPPPSPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASP 204
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  368 DDEPTTSQCVPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAAADAEPTTSSQCAPDCEDPAVIEPTHSTCAA 447
Cdd:PHA03307   205 RPPRRSSPISASASSPAPAPGRSAADDAGASSSDSSSSESSGCGWGPENECPLPRPAPITLPTRIWEASGWNGPSSRPGP 284
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  448 DSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTSQCAPDCDDPAVIEPTHSNCAADSRAPADAEPNS 527
Cdd:PHA03307   285 ASSSSSPRERSPSPSPSSPGSGPAPSSPRASSSSSSSRESSSSSTSSSSESSRGAAVSPGPSPSRSPSPSRPPPPADPSS 364
                          330       340       350       360
                   ....*....|....*....|....*....|....*....|....*..
gi 1720429481  528 STCAAvngatadveptTSQLVPVSGAPADVDPTTSQCAPDCEDPAVI 574
Cdd:PHA03307   365 PRKRP-----------RPSRAPSSPAASAGRPTRRRARAAVAGRARR 400
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
467-638 2.86e-04

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 44.46  E-value: 2.86e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 467 GAPADVEPTTSQLVPDSGAPADVEPTTSQCAPDCDDPAVIEPTHSNCAADSRAPADAEPNSSTCAAVNGATADVEPTTSQ 546
Cdd:PRK07003  367 APGGGVPARVAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPAPPATADRGDDAADGD 446
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 547 lVPVSGAPADVDPTTSQCAPDCEDPAVIEPTHSTCAADSRAPAHIEPTPSQLAP-DRGAPADVEPTHSTCAADTRIPADI 625
Cdd:PRK07003  447 -APVPAKANARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPsAATPAAVPDARAPAAASREDAPAAA 525
                         170
                  ....*....|...
gi 1720429481 626 EPSPSQCAPDSPA 638
Cdd:PRK07003  526 APPAPEARPPTPA 538
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
481-650 4.39e-04

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 43.75  E-value: 4.39e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 481 PDSGAPADVEPTTSQCAPDCDDPAviePTHSNCAADSRAPADAEPNSSTCAAVNGATADvepTTSQLVPVSGAPADVDPT 560
Cdd:pfam05109 425 PESTTTSPTLNTTGFAAPNTTTGL---PSSTHVPTNLTAPASTGPTVSTADVTSPTPAG---TTSGASPVTPSPSPRDNG 498
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 561 TSQCAPDCEDP--AVIEPTHStcaADSRAPAHIEPTPSQLAPDRGAPADVEP-THSTCAADTRIPADIEPSPSQCAPD-- 635
Cdd:pfam05109 499 TESKAPDMTSPtsAVTTPTPN---ATSPTPAVTTPTPNATSPTLGKTSPTSAvTTPTPNATSPTPAVTTPTPNATIPTlg 575
                         170
                  ....*....|....*
gi 1720429481 636 SPAPSDIGEEPSPVA 650
Cdd:pfam05109 576 KTSPTSAVTTPTPNA 590
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
348-554 5.99e-04

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 43.33  E-value: 5.99e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 348 APADDEPNSSTCAAVNGAPADDEPTTSQCVPDCEDPAVIEPTHSTCAADSRA-PADAEPNSSTCAAVNGAAADAEPTTSS 426
Cdd:PRK12323  375 ATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRsPAPEALAAARQASARGPGGAPAPAPAP 454
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 427 QCAPDCEDPAVIEPTHSTCAADSRAPADAEPnsstcaAVNGAPADVEPTTSQLVPdsGAPADVEPTTSQCAPdcdDPAVI 506
Cdd:PRK12323  455 AAAPAAAARPAAAGPRPVAAAAAAAPARAAP------AAAPAPADDDPPPWEELP--PEFASPAPAQPDAAP---AGWVA 523
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 1720429481 507 EPTHSNCAADSRAPADAEPNSSTCAAVNGATADVEPTTSQLVPVSGAP 554
Cdd:PRK12323  524 ESIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASAS 571
rne PRK10811
ribonuclease E; Reviewed
446-629 8.53e-04

ribonuclease E; Reviewed


Pssm-ID: 236766 [Multi-domain]  Cd Length: 1068  Bit Score: 42.72  E-value: 8.53e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  446 AADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTSQCAPDCDDPAVIEPTHSNCAAdsrAPADAEP 525
Cdd:PRK10811   852 DVQVEEQREAEEVQVQPVVAEVPVAAAVEPVVSAPVVEAVAEVVEEPVVVAEPQPEEVVVVETTHPEVIA---APVTEQP 928
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  526 nsstcAAVNGATADV-EPTTSQLVPVsgAPADVDPTTSQCAPDCEDPAVIEPTH-----STCAADSRAPAHIEPTPSQLA 599
Cdd:PRK10811   929 -----QVITESDVAVaQEVAEHAEPV--VEPQDETADIEEAAETAEVVVAEPEVvaqpaAPVVAEVAAEVETVTAVEPEV 1001
                          170       180       190
                   ....*....|....*....|....*....|.
gi 1720429481  600 PDRGAPADVEPTHSTCAADTRIPA-DIEPSP 629
Cdd:PRK10811  1002 APAQVPEATVEHNHATAPMTRAPApEYVPEA 1032
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
279-486 1.05e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 42.56  E-value: 1.05e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 279 GAPADVEPTTSQLVPDSGAPADVEPT-TSHCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCADVNGAPADDEPNSS 357
Cdd:PRK12323  373 GPATAAAAPVAQPAPAAAAPAAAAPApAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPAP 452
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 358 TCAAVngaPADDEPTTSQCVPDCEDPAVIEPTHSTCAADSRAPADAEPnsstcaavngaAADAEPTTSSQCAPDCEDPA- 436
Cdd:PRK12323  453 APAAA---PAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPP-----------PWEELPPEFASPAPAQPDAAp 518
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|...
gi 1720429481 437 ---VIEPTHSTCAADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPDSGAP 486
Cdd:PRK12323  519 agwVAESIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASAS 571
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
226-453 1.06e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 42.56  E-value: 1.06e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 226 NGAPAGVEPTTSSQCAPDCEDPAVIEPTHSTCAAdsrAPADAEPNSSTCAAVNGAPADVEPTTSQLVPDSGAPADVEPTT 305
Cdd:PRK12323  371 GAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPA---APAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGA 447
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 306 SHCAPdcedpaviepthstcaADSRAPADAEPNSSTCADVNGAPADDEPNSSTCAAVnGAPADDEPTTSQCVPdcEDPAV 385
Cdd:PRK12323  448 PAPAP----------------APAAAPAAAARPAAAGPRPVAAAAAAAPARAAPAAA-PAPADDDPPPWEELP--PEFAS 508
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720429481 386 IEPTHSTCAADSRAPADAEPNSSTCAAVNGAAADAEPTTSSQCAPDCEDPAVIEPTHSTCAADSRAPA 453
Cdd:PRK12323  509 PAPAQPDAAPAGWVAESIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPDM 576
Ank_2 pfam12796
Ankyrin repeats (3 copies);
2-50 1.06e-03

Ankyrin repeats (3 copies);


Pssm-ID: 403870 [Multi-domain]  Cd Length: 91  Bit Score: 38.56  E-value: 1.06e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 1720429481   2 LLEHNVDIEAKTEYGLTPLQLATFEQKPEMVEFLAAKCAKSSVTPSWSP 50
Cdd:pfam12796  16 LLENGADANLQDKNGRTALHLAAKNGHLEIVKLLLEHADVNLKDNGRTA 64
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
223-666 1.69e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 41.90  E-value: 1.69e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 223 AAVNGAPAGVEPTTSSQCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPDSGAPADVE 302
Cdd:PRK07764  396 AAAPSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPAPAPAAAPE 475
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 303 PTTShcapdcedPAVIEPTHSTCAADSRAPADAEPNsstcadvNGAPADDEPNSSTCAAVNGAPADDEPTTSQCVP---- 378
Cdd:PRK07764  476 PTAA--------PAPAPPAAPAPAAAPAAPAAPAAP-------AGADDAATLRERWPEILAAVPKRSRKTWAILLPeatv 540
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 379 -DCEDPAVIePTHSTcAADSRAPADAEPNSSTCAAVNGaaadaepTTSSQCAPDCedpaviepTHSTCAADSRAPADAEP 457
Cdd:PRK07764  541 lGVRGDTLV-LGFST-GGLARRFASPGNAEVLVTALAE-------ELGGDWQVEA--------VVGPAPGAAGGEGPPAP 603
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 458 NSSTCAAVNGAPADVEPTTSQLVPDSGAPadvePTTSQCAPDCDDPAVIEPTHSNCAADSRAPADAEPNSSTCAAVNGAT 537
Cdd:PRK07764  604 ASSGPPEEAARPAAPAAPAAPAAPAPAGA----AAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPA 679
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 538 ADVEPTTSQLVPVSGAPADVDPTTSQCAPdcedpAVIEPTHSTCAADSRAPAHIEPTPSQLAPDRGAPADVEPTHSTCAA 617
Cdd:PRK07764  680 APPPAPAPAAPAAPAGAAPAQPAPAPAAT-----PPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPPDPAGA 754
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|
gi 1720429481 618 DTRIPADIEPSPSQCAPDSPAPSDIGEEP-SPVADPDEDIAEDFYDALES 666
Cdd:PRK07764  755 PAQPPPPPAPAPAAAPAAAPPPSPPSEEEeMAEDDAPSMDDEDRRDAEEV 804
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
297-653 1.99e-03

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 41.70  E-value: 1.99e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  297 APADVEPTTSHCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCADVNGAPADDEPNSSTCAAvngAPADDEPTTSQC 376
Cdd:PHA03307    14 AAEGGEFFPRPPATPGDAADDLLSGSQGQLVSDSAELAAVTVVAGAAACDRFEPPTGPPPGPGTE---APANESRSTPTW 90
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  377 VPDCEDPAVIEPTHSTCAADS---RAPADAEPNSSTCAAVNGAAADAEPTTSSQCAPDCEDPAVIEPTHSTCAADSRAPA 453
Cdd:PHA03307    91 SLSTLAPASPAREGSPTPPGPsspDPPPPTPPPASPPPSPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSR 170
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  454 DAEPNSSTCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTSQCAPDCDDPAVIEPTHSNCAADSRAPADAEPNSSTCA-A 532
Cdd:PHA03307   171 QAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRPPRRSSPISASASSPAPAPGRSAADDAGASSSDSSSSESSGCGwG 250
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481  533 VNGATADVEPTTSQLVPVSGAPADVDPTTSQCAPDCEDPAVIEPTHSTCAADSRAPAHiePTPSQLAPDRGAPADVEPTH 612
Cdd:PHA03307   251 PENECPLPRPAPITLPTRIWEASGWNGPSSRPGPASSSSSPRERSPSPSPSSPGSGPA--PSSPRASSSSSSSRESSSSS 328
                          330       340       350       360
                   ....*....|....*....|....*....|....*....|.
gi 1720429481  613 STCAADTRIPADIEPSPSQCAPDSPAPsdigeePSPVADPD 653
Cdd:PHA03307   329 TSSSSESSRGAAVSPGPSPSRSPSPSR------PPPPADPS 363
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
233-405 2.00e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 41.37  E-value: 2.00e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 233 EPTTSSQCAPDCEDPAViePTHSTCAADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPdsGAPADVEPTTSHCAP-- 310
Cdd:PRK07003  359 EPAVTGGGAPGGGVPAR--VAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAA--AAATRAEAPPAAPAPpa 434
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 311 --DCEDPAVIEPTHSTCAADSRAPADAEPNSSTCADVNGAPADDEPNSSTCAAVNGAPA----DDEPTTSQCVPDCEDPA 384
Cdd:PRK07003  435 taDRGDDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPApraaAPSAATPAAVPDARAPA 514
                         170       180
                  ....*....|....*....|.
gi 1720429481 385 VIEPTHSTCAADSRAPADAEP 405
Cdd:PRK07003  515 AASREDAPAAAAPPAPEARPP 535
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
421-623 2.43e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 41.40  E-value: 2.43e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 421 EPTTSSQCAPDCEDPAVIEPTHSTC--AADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTSqcAP 498
Cdd:PRK12323  373 GPATAAAAPVAQPAPAAAAPAAAAPapAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAP--AP 450
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 499 DCDDPAVIEPTHSNCAADSRAPADAEPNSSTCAAVNGATADVEPTTSQLVPVSGAPADVDPTTSQCAPDCEDPAVIEPTH 578
Cdd:PRK12323  451 APAPAAAPAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIPDPA 530
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 1720429481 579 STCAADSRAPAHIEPTPSQLAPDRGAPADVEPTHSTCAADTRIPA 623
Cdd:PRK12323  531 TADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPD 575
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
252-678 3.15e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 40.74  E-value: 3.15e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 252 PTHSTCAADSRAPADAEPNsstcAAVNGAPADVEPTTSQLVPDSGAPADVEPTtshcAPDCEDPAVIEPTHSTCAADSRA 331
Cdd:PRK07764  396 AAAPSAAAAAPAAAPAPAA----AAPAAAAAPAPAAAPQPAPAPAPAPAPPSP----AGNAPAGGAPSPPPAAAPSAQPA 467
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 332 PADAEPNSSTCADVNGAPADDEPnsstcAAVNGAPAddEPTTSQCVPDCEDP---------AVIEPTHSTCAADSRAPAD 402
Cdd:PRK07764  468 PAPAAAPEPTAAPAPAPPAAPAP-----AAAPAAPA--APAAPAGADDAATLrerwpeilaAVPKRSRKTWAILLPEATV 540
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 403 AEPNSSTCAAVNGAAADAEpTTSSQCAPDCEDPAVIEPTHSTCAADSRApadaepnsSTCAAVNGAPADVEPTTSQLVPD 482
Cdd:PRK07764  541 LGVRGDTLVLGFSTGGLAR-RFASPGNAEVLVTALAEELGGDWQVEAVV--------GPAPGAAGGEGPPAPASSGPPEE 611
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 483 SGAPADVEPTTSQCAPDCDDPAviePTHSNCAADSRAPADAEPNSSTCAAVNGATADVEPT---TSQLVPVSGAPADVDP 559
Cdd:PRK07764  612 AARPAAPAAPAAPAAPAPAGAA---AAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWpakAGGAAPAAPPPAPAPA 688
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 560 TTSQCAPDCEDPAVIEPTHSTCAADSRAPAHIEPTPSQ-LAPDRGAPADVEPTHSTCAADTRIPADIEPSPsqcAPDSPA 638
Cdd:PRK07764  689 APAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQgASAPSPAADDPVPLPPEPDDPPDPAGAPAQPP---PPPAPA 765
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|
gi 1720429481 639 PSDIGEEPSPVADPDEDiAEDFYDALESSDHTGHSGSTVQ 678
Cdd:PRK07764  766 PAAAPAAAPPPSPPSEE-EEMAEDDAPSMDDEDRRDAEEV 804
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
396-605 3.86e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 40.63  E-value: 3.86e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 396 DSRAPADAEPNSSTCAAVNGAAADAEPTTSSQCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAPADVEPT 475
Cdd:PRK12323  371 GAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAP 450
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 476 TSQLVPdsgAPADVEPTTSQCAPDCDDPAVIEPTHSNCAADSRAPADAEPnssTCAAVNGATADVEPTTSQLVPvsgAPA 555
Cdd:PRK12323  451 APAPAA---APAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPP---PWEELPPEFASPAPAQPDAAP---AGW 521
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|
gi 1720429481 556 DVDPTTSQCAPDCEDPAVIEPTHSTCAADSRAPAHIEPTPSQLAPDRGAP 605
Cdd:PRK12323  522 VAESIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASAS 571
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
421-604 5.03e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 40.22  E-value: 5.03e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 421 EPTTSSQCAPDCEDPAViePTHSTCAADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPdsGAPADVEPTTSQCAPDC 500
Cdd:PRK07003  359 EPAVTGGGAPGGGVPAR--VAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAA--AAATRAEAPPAAPAPPA 434
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 501 DDPAVIEPTHSNCAADSRAPADAEPNSSTCAAVNGATADVEPttsQLVPVSGAPADV-----------DPTTSQCAPDCE 569
Cdd:PRK07003  435 TADRGDDAADGDAPVPAKANARASADSRCDERDAQPPADSGS---ASAPASDAPPDAafepapraaapSAATPAAVPDAR 511
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 1720429481 570 DPAVIEPTHSTCAADSRAPAHIEPTPSQLAPDRGA 604
Cdd:PRK07003  512 APAAASREDAPAAAAPPAPEARPPTPAAAAPAARA 546
MSCRAMM_ClfA NF033609
MSCRAMM family adhesin clumping factor ClfA; Clumping factor A is an MSCRAMM (Microbial ...
193-571 5.26e-03

MSCRAMM family adhesin clumping factor ClfA; Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.


Pssm-ID: 411231 [Multi-domain]  Cd Length: 934  Bit Score: 40.29  E-value: 5.26e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 193 EAPGDIEPThstcATDSRAPADAEPNSSTCAAVNGAPAGVEPTTSSQcapdcedpaviepthSTCAADSRAPADAEPNSS 272
Cdd:NF033609  549 DEPGEIEPI----PEDSDSDPGSDSGSDSSNSDSGSDSGSDSTSDSG---------------SDSASDSDSASDSDSASD 609
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 273 TCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTSHCAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCADVNGAPADD 352
Cdd:NF033609  610 SDSASDSDSASDSDSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 689
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 353 EPNSSTCAAVNGAPADDEPTTSQcvpdcedpaviePTHSTCAADSRAPADAEPNSSTCAAVNGAAADAEPTTSSQCAPDC 432
Cdd:NF033609  690 SDSDSDSDSDSDSDSDSDSDSDS------------DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 757
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 433 EDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAPADVEPTTSQLVPDSGAPADVEPTTSQCAPDCDDPAVIEPTHSN 512
Cdd:NF033609  758 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 837
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 1720429481 513 CAADSRAPADAEPNSSTCAAVNGATADVEPTTSQLVPVSGAPADVDPTTSQCAPDCEDP 571
Cdd:NF033609  838 SDSDSDSDSDSDSDSDSDSESDSNSDSESGSNNNVVPPNSPKNGTNASNKNEAKDSKEP 896
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
347-605 7.13e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 39.83  E-value: 7.13e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 347 GAPADDEPNSSTCAAVNGAPADDEPTTSQCVPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAAADAEPT-TS 425
Cdd:PRK07003  381 PAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPAPPATADRGDDAADGDAPVPAKANARAsAD 460
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 426 SQCAPDCEDPAVIEPTHSTCAADSRAPADAEPnsstcaavngAPADVEPttsqlvPDSGAPADVEPTTSQCAPDCDDPAV 505
Cdd:PRK07003  461 SRCDERDAQPPADSGSASAPASDAPPDAAFEP----------APRAAAP------SAATPAAVPDARAPAAASREDAPAA 524
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 506 IEPTHSNCAADSRApADAEPNSSTCAA-----VNGATADVEPTTSQLVPVSGAPADVDPTTSQCAPdcEDPAVIEPTHST 580
Cdd:PRK07003  525 AAPPAPEARPPTPA-AAAPAARAGGAAaaldvLRNAGMRVSSDRGARAAAAAKPAAAPAAAPKPAA--PRVAVQVPTPRA 601
                         250       260
                  ....*....|....*....|....*
gi 1720429481 581 CAADSRAPAHIEPTPSQLAPDRGAP 605
Cdd:PRK07003  602 RAATGDAPPNGAARAEQAAESRGAP 626
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
200-401 7.59e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 39.47  E-value: 7.59e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 200 PTHSTCATDSRAPADAEPNSSTCAAVNGAPAGVEPTTSSQC-APDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCAA-V 277
Cdd:PRK12323  380 APVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAaAPARRSPAPEALAAARQASARGPGGAPAPAPAPAAApA 459
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 278 NGAPADVEPTTSQLVPDSGAPADVEPTTSHcAPDCEDPAVIEPTHSTCAADSRAPADAEPNSSTCADVNgAPADDEPNSS 357
Cdd:PRK12323  460 AAARPAAAGPRPVAAAAAAAPARAAPAAAP-APADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIP-DPATADPDDA 537
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 1720429481 358 TCAAVNGAPADDEPttsqcVPDCEDPAVIEPTHSTCAADSRAPA 401
Cdd:PRK12323  538 FETLAPAPAAAPAP-----RAAAATEPVVAPRPPRASASGLPDM 576
PRK13108 PRK13108
prolipoprotein diacylglyceryl transferase; Reviewed
349-523 9.90e-03

prolipoprotein diacylglyceryl transferase; Reviewed


Pssm-ID: 237284 [Multi-domain]  Cd Length: 460  Bit Score: 39.19  E-value: 9.90e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 349 PADDEPNSSTCAAVNGAPADDEPTtsqcvpdceDPAVIEPTHSTCAADSRAPADAEPNSSTCAAVNGAAADAEPTTSSQc 428
Cdd:PRK13108  295 ALEREPAELAAAAVASAASAVGPV---------GPGEPNQPDDVAEAVKAEVAEVTDEVAAESVVQVADRDGESTPAVE- 364
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 429 apDCEDPAVIEPTHSTCAADsrAPADAEPNSSTCAAVNGAPADVEPTTsqlvPDSGAPAdvEPTTSQCAPDCDDPAviEP 508
Cdd:PRK13108  365 --ETSEADIEREQPGDLAGQ--APAAHQVDAEAASAAPEEPAALASEA----HDETEPE--VPEKAAPIPDPAKPD--EL 432
                         170
                  ....*....|....*
gi 1720429481 509 THSNCAADSRAPADA 523
Cdd:PRK13108  433 AVAGPGDDPAEPDGI 447
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
476-608 9.98e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 39.31  E-value: 9.98e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720429481 476 TSQLVPDSGAPADVEPTTSQCAPdcddpavIEPTHSNCAADSRAPADAEPNSSTCAAVNGATADVEPTTSQLVPVSGAPA 555
Cdd:PRK14951  371 EAAAPAEKKTPARPEAAAPAAAP-------VAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPA 443
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 1720429481 556 DVDPTTSQCAPDCEDPAVIEPTHSTCAADSRAPAHIEPTPSQLAPDRGAPADV 608
Cdd:PRK14951  444 AVALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPTEEGDV 496
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH