NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1720401381|ref|XP_030108128|]
View 

protein O-mannosyl-transferase 1 isoform X4 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PMT_4TMC pfam16192
C-terminal four TMM region of protein-O-mannosyltransferase; PMT_4TMC is the C-terminal four ...
207-401 3.01e-63

C-terminal four TMM region of protein-O-mannosyltransferase; PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.


:

Pssm-ID: 406576  Cd Length: 198  Bit Score: 201.62  E-value: 3.01e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 207 ARFSELQWKMLTLKNEDL-EHQYSSTPLEWLTLDTNIAYWLHPRTSAQIHLLGNIVIWTSASLATVVYTLLFFWYLLRRR 285
Cdd:pfam16192   1 KKFIELQKAMLTSNNGLTpSHPYASRPWEWPLLLRGIRFWGWDDRNAQIYLLGNPVIWWSSTAAILVFVLLLLAYLLRWQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 286 RSICDLPED-AWSRWVLAGALCTGGWALNYLPFFLMERVLFLYHYLPALTFQILLLPIVLQHASDHLCR--SQLQRNVFS 362
Cdd:pfam16192  81 RGYYDLSDDdTRSRFYYSGGFLLLGWALHYLPFFLMGRQLFLHHYLPALYFAILALGALLDFLLSLFKRlpRSLRKRVGY 160
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1720401381 363 ALVVAWYSSACHVSNMLRPLTYGDTSLSpGELRALRWKD 401
Cdd:pfam16192 161 AIVVVLLALVIYVFIYFSPLTYGMPGTS-EECKKLKWLS 198
MIR smart00472
Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;
126-176 3.42e-05

Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;


:

Pssm-ID: 197746 [Multi-domain]  Cd Length: 57  Bit Score: 41.17  E-value: 3.42e-05
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1720401381  126 SEVRFVHVNTSAILKLSGAHLPDWGFRQLEVVGEKlSPGYHESMVWNVEEH 176
Cdd:smart00472   8 DVVRLRHVTTGRYLHSHDEKLPPWGDGQQEVTGYG-NPAIDANTLWLIEPV 57
MIR smart00472
Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;
55-112 2.47e-04

Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;


:

Pssm-ID: 197746 [Multi-domain]  Cd Length: 57  Bit Score: 38.86  E-value: 2.47e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 1720401381   55 PRPVRHGDIVQLVHGMTTRLLNTHDVA-APLSPHSQEVSCYIDYNISmpAQNLWKLDIV 112
Cdd:smart00472   1 GGFVRWGDVVRLRHVTTGRYLHSHDEKlPPWGDGQQEVTGYGNPAID--ANTLWLIEPV 57
 
Name Accession Description Interval E-value
PMT_4TMC pfam16192
C-terminal four TMM region of protein-O-mannosyltransferase; PMT_4TMC is the C-terminal four ...
207-401 3.01e-63

C-terminal four TMM region of protein-O-mannosyltransferase; PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.


Pssm-ID: 406576  Cd Length: 198  Bit Score: 201.62  E-value: 3.01e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 207 ARFSELQWKMLTLKNEDL-EHQYSSTPLEWLTLDTNIAYWLHPRTSAQIHLLGNIVIWTSASLATVVYTLLFFWYLLRRR 285
Cdd:pfam16192   1 KKFIELQKAMLTSNNGLTpSHPYASRPWEWPLLLRGIRFWGWDDRNAQIYLLGNPVIWWSSTAAILVFVLLLLAYLLRWQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 286 RSICDLPED-AWSRWVLAGALCTGGWALNYLPFFLMERVLFLYHYLPALTFQILLLPIVLQHASDHLCR--SQLQRNVFS 362
Cdd:pfam16192  81 RGYYDLSDDdTRSRFYYSGGFLLLGWALHYLPFFLMGRQLFLHHYLPALYFAILALGALLDFLLSLFKRlpRSLRKRVGY 160
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1720401381 363 ALVVAWYSSACHVSNMLRPLTYGDTSLSpGELRALRWKD 401
Cdd:pfam16192 161 AIVVVLLALVIYVFIYFSPLTYGMPGTS-EECKKLKWLS 198
PMT1 COG1928
Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, ...
21-405 9.63e-62

Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 224839 [Multi-domain]  Cd Length: 699  Bit Score: 211.19  E-value: 9.63e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381  21 SSHQQQVTCYPFKDINNWWIVKdpgrHQLVVNNPPRPVRHGDIVQLVHGMTTRLLNTHDVAAPLSPHSQEVSCYiDYNIS 100
Cdd:COG1928   330 GSEQQQVTGYGHKDANNEWLIE----LSDENATQIEPLKDGQSVRLRHKYTGKNLHFHDVKPPVSGNQYEVSGY-GDSFE 404
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 101 MPAQNLWKLDIVNRESNRD--TWKTILSEVRFVHVNTSAILKLSGAHLPDWGFRQLEVVGEKLSpgyHESMVWNVEEHry 178
Cdd:COG1928   405 GDEKDDWIIEIVKDEANEDqeRIHPLETKFRLYHVLTGCYLASHDLKLPEWGFSQREVLCAKDR---DPSTTWNIEEN-- 479
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 179 gksheqkerELELHSPTQLDISRNLSFMARFSELQWKMLTLKNE-DLEHQYSSTPLEWLTLDTNIAYWLHPRTSAQIHLL 257
Cdd:COG1928   480 ---------VNDRLPNPEKKVYKKLSFWKKFIELNKAMFSSNNAlVPDHDYSSEPYQWPTLLRGLRFWGWGECIKKVYLM 550
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 258 GNIVIWTSASLATVVYTLLFFWYLLRRRRSICDLPEDAWSRWVLAGALCTGGWALNYLPFFLMERVLFLYHYLPALTFQI 337
Cdd:COG1928   551 GNPALWWFSVPALAFFTGIVIWRLIRWRRGYRTLSDPAIRNFHWGYFYFLVGWAAHYLPWFIMSRQMYLHHYLPALYFAI 630
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720401381 338 LLLPIVLQHASDHLCRSQLQRNVfsaLVVAWYSSAC-HVSNMLRPLTYGdTSLSPGELRALRWKDSWDI 405
Cdd:COG1928   631 LALALVLDFILRRPSRERRTLGL---IVVAIFVALViYFFFWFSPVTYG-LPLSPQEFRRLMWLPSWDF 695
MIR smart00472
Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;
126-176 3.42e-05

Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;


Pssm-ID: 197746 [Multi-domain]  Cd Length: 57  Bit Score: 41.17  E-value: 3.42e-05
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1720401381  126 SEVRFVHVNTSAILKLSGAHLPDWGFRQLEVVGEKlSPGYHESMVWNVEEH 176
Cdd:smart00472   8 DVVRLRHVTTGRYLHSHDEKLPPWGDGQQEVTGYG-NPAIDANTLWLIEPV 57
MIR smart00472
Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;
55-112 2.47e-04

Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;


Pssm-ID: 197746 [Multi-domain]  Cd Length: 57  Bit Score: 38.86  E-value: 2.47e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 1720401381   55 PRPVRHGDIVQLVHGMTTRLLNTHDVA-APLSPHSQEVSCYIDYNISmpAQNLWKLDIV 112
Cdd:smart00472   1 GGFVRWGDVVRLRHVTTGRYLHSHDEKlPPWGDGQQEVTGYGNPAID--ANTLWLIEPV 57
 
Name Accession Description Interval E-value
PMT_4TMC pfam16192
C-terminal four TMM region of protein-O-mannosyltransferase; PMT_4TMC is the C-terminal four ...
207-401 3.01e-63

C-terminal four TMM region of protein-O-mannosyltransferase; PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.


Pssm-ID: 406576  Cd Length: 198  Bit Score: 201.62  E-value: 3.01e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 207 ARFSELQWKMLTLKNEDL-EHQYSSTPLEWLTLDTNIAYWLHPRTSAQIHLLGNIVIWTSASLATVVYTLLFFWYLLRRR 285
Cdd:pfam16192   1 KKFIELQKAMLTSNNGLTpSHPYASRPWEWPLLLRGIRFWGWDDRNAQIYLLGNPVIWWSSTAAILVFVLLLLAYLLRWQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 286 RSICDLPED-AWSRWVLAGALCTGGWALNYLPFFLMERVLFLYHYLPALTFQILLLPIVLQHASDHLCR--SQLQRNVFS 362
Cdd:pfam16192  81 RGYYDLSDDdTRSRFYYSGGFLLLGWALHYLPFFLMGRQLFLHHYLPALYFAILALGALLDFLLSLFKRlpRSLRKRVGY 160
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1720401381 363 ALVVAWYSSACHVSNMLRPLTYGDTSLSpGELRALRWKD 401
Cdd:pfam16192 161 AIVVVLLALVIYVFIYFSPLTYGMPGTS-EECKKLKWLS 198
PMT1 COG1928
Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, ...
21-405 9.63e-62

Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 224839 [Multi-domain]  Cd Length: 699  Bit Score: 211.19  E-value: 9.63e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381  21 SSHQQQVTCYPFKDINNWWIVKdpgrHQLVVNNPPRPVRHGDIVQLVHGMTTRLLNTHDVAAPLSPHSQEVSCYiDYNIS 100
Cdd:COG1928   330 GSEQQQVTGYGHKDANNEWLIE----LSDENATQIEPLKDGQSVRLRHKYTGKNLHFHDVKPPVSGNQYEVSGY-GDSFE 404
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 101 MPAQNLWKLDIVNRESNRD--TWKTILSEVRFVHVNTSAILKLSGAHLPDWGFRQLEVVGEKLSpgyHESMVWNVEEHry 178
Cdd:COG1928   405 GDEKDDWIIEIVKDEANEDqeRIHPLETKFRLYHVLTGCYLASHDLKLPEWGFSQREVLCAKDR---DPSTTWNIEEN-- 479
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 179 gksheqkerELELHSPTQLDISRNLSFMARFSELQWKMLTLKNE-DLEHQYSSTPLEWLTLDTNIAYWLHPRTSAQIHLL 257
Cdd:COG1928   480 ---------VNDRLPNPEKKVYKKLSFWKKFIELNKAMFSSNNAlVPDHDYSSEPYQWPTLLRGLRFWGWGECIKKVYLM 550
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720401381 258 GNIVIWTSASLATVVYTLLFFWYLLRRRRSICDLPEDAWSRWVLAGALCTGGWALNYLPFFLMERVLFLYHYLPALTFQI 337
Cdd:COG1928   551 GNPALWWFSVPALAFFTGIVIWRLIRWRRGYRTLSDPAIRNFHWGYFYFLVGWAAHYLPWFIMSRQMYLHHYLPALYFAI 630
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720401381 338 LLLPIVLQHASDHLCRSQLQRNVfsaLVVAWYSSAC-HVSNMLRPLTYGdTSLSPGELRALRWKDSWDI 405
Cdd:COG1928   631 LALALVLDFILRRPSRERRTLGL---IVVAIFVALViYFFFWFSPVTYG-LPLSPQEFRRLMWLPSWDF 695
MIR smart00472
Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;
126-176 3.42e-05

Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;


Pssm-ID: 197746 [Multi-domain]  Cd Length: 57  Bit Score: 41.17  E-value: 3.42e-05
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1720401381  126 SEVRFVHVNTSAILKLSGAHLPDWGFRQLEVVGEKlSPGYHESMVWNVEEH 176
Cdd:smart00472   8 DVVRLRHVTTGRYLHSHDEKLPPWGDGQQEVTGYG-NPAIDANTLWLIEPV 57
MIR smart00472
Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;
55-112 2.47e-04

Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases;


Pssm-ID: 197746 [Multi-domain]  Cd Length: 57  Bit Score: 38.86  E-value: 2.47e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 1720401381   55 PRPVRHGDIVQLVHGMTTRLLNTHDVA-APLSPHSQEVSCYIDYNISmpAQNLWKLDIV 112
Cdd:smart00472   1 GGFVRWGDVVRLRHVTTGRYLHSHDEKlPPWGDGQQEVTGYGNPAID--ANTLWLIEPV 57
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH