NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1720409153|ref|XP_030109487|]
View 

FK506-binding protein 15 isoform X4 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Smc super family cl34174
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
117-456 9.09e-16

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


The actual alignment was detected with superfamily member COG1196:

Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 81.68  E-value: 9.09e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  117 METSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENtQAKVTEELAA 196
Cdd:COG1196    705 EELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEA-LAKLKEEIEE 783
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  197 ATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEE 276
Cdd:COG1196    784 LEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKE 863
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  277 ELTDLRAEKTSLEKNLS----ERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTL---AQAE 349
Cdd:COG1196    864 ELEELEAEKEELEDELKeleeEKEELEEELR-ELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELeeeYEDT 942
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  350 LQSQWEAKCEQLLASARD------EHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEhmQRLEKTKSQApa 423
Cdd:COG1196    943 LETELEREIERLEEEIEAlgpvnlRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKR--ERFKETFDKI-- 1018
                          330       340       350
                   ....*....|....*....|....*....|...
gi 1720409153  424 graaadpSEKVKKIMNQVFQSLRGEFELEESYD 456
Cdd:COG1196   1019 -------NENFSEIFKELFGGGTAELELTEPDD 1044
PHA03247 super family cl33720
large tegument protein UL36; Provisional
495-680 1.04e-04

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.08  E-value: 1.04e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  495 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 574
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  575 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 652
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1720409153  653 PalDPESQGGEAQPPECKQAEDVSSS-GP 680
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
 
Name Accession Description Interval E-value
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
117-456 9.09e-16

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 81.68  E-value: 9.09e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  117 METSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENtQAKVTEELAA 196
Cdd:COG1196    705 EELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEA-LAKLKEEIEE 783
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  197 ATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEE 276
Cdd:COG1196    784 LEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKE 863
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  277 ELTDLRAEKTSLEKNLS----ERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTL---AQAE 349
Cdd:COG1196    864 ELEELEAEKEELEDELKeleeEKEELEEELR-ELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELeeeYEDT 942
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  350 LQSQWEAKCEQLLASARD------EHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEhmQRLEKTKSQApa 423
Cdd:COG1196    943 LETELEREIERLEEEIEAlgpvnlRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKR--ERFKETFDKI-- 1018
                          330       340       350
                   ....*....|....*....|....*....|...
gi 1720409153  424 graaadpSEKVKKIMNQVFQSLRGEFELEESYD 456
Cdd:COG1196   1019 -------NENFSEIFKELFGGGTAELELTEPDD 1044
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
125-404 4.11e-11

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 66.62  E-value: 4.11e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  125 NIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATEntqakVTEELAAATAQVSHL 204
Cdd:TIGR02168  699 ALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTE-----LEAEIEELEERLEEA 773
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  205 QLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEK--------------QSRRQLELK 270
Cdd:TIGR02168  774 EEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLErriaaterrledleEQIEELSED 853
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  271 VTSLEEELTDLRAEKTSLEKNL---SERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQ 347
Cdd:TIGR02168  854 IESLAAEIEELEELIEELESELealLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREKLAQLELRLEG 933
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 1720409153  348 AELQSQweakceQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAF 404
Cdd:TIGR02168  934 LEVRID------NLQERLSEEYSLTLEEAEALENKIEDDEEEARRRLKRLENKIKEL 984
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
159-578 1.02e-08

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 58.77  E-value: 1.02e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 159 ERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTR 238
Cdd:NF033930   75 DEDQKKTEEKAKKEKKASEEEQKANLAVQKAYVKYRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRAKVVP 154
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 239 LQADLSELREASEQTQTKfksEKQSRRQLELKVTSLEEELTDLRAEKTSLEKnlsERKKKSAQERCQAEAEmdeirkshq 318
Cdd:NF033930  155 EAEELAETKKKAEEAKAE---EPVAKKKVDEAKKKVEEAKKKVEAEEAEIEK---LQNEEVALEAKIAELE--------- 219
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 319 EELDRLRQLLKKARVSTDQAAAEQ---------LTLAQAELqSQWEAKCEQLLASARDEHLQQyrevcaQRDAHQQKLAL 389
Cdd:NF033930  220 NQVDNLEKELAEIDESDSEDYIKEglrapleseLDAKQAKL-AKKQTELEKLLDSLDPEGKTQ------DELDKEAAEEE 292
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 390 LQDECLALQAQIAAFTEQKEHMQRLEktKSQAPAGRAAADPSEKVKKImnqvfqslrgefELEEsydggtilrtimhTIK 469
Cdd:NF033930  293 LSKKIDELDNEVAKLEKEVSDLENSD--NNVADYYKEALEKDLATKKA------------ELEK-------------TQK 345
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 470 MVTlQLLNHQEEEEEEEEEEEEEKKPLRPSlEQPGPA----TPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTP 545
Cdd:NF033930  346 DLD-KALNELGPDGDEEETPAPAPQPEQPA-PAPAPApkpeQPAPAPKPEKPADQQAEEDYARRSEEEYNRLTQQQPPKA 423
                         410       420       430
                  ....*....|....*....|....*....|...
gi 1720409153 546 EngaqtrkgEPAEAEVPSeikdsslPPQPAGIP 578
Cdd:NF033930  424 E--------KPAPAPAPK-------PEQPAPAP 441
PRK11281 PRK11281
mechanosensitive channel MscK;
177-430 2.81e-08

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 57.61  E-value: 2.81e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  177 NSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETE-LQLQLTDNLKETdllrghvTRLQADLSELReASEQTQT 255
Cdd:PRK11281    43 AQLDALNKQKLLEAEDKLVQQDLEQTLALLDKIDRQKEETEqLKQQLAQAPAKL-------RQAQAELEALK-DDNDEET 114
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  256 KFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSerKKKSAQERCQaeAEMDEirksHQEELDRLRQLLKKARVST 335
Cdd:PRK11281   115 RETLSTLSLRQLESRLAQTLDQLQNAQNDLAEYNSQLV--SLQTQPERAQ--AALYA----NSQRLQQIRNLLKGGKVGG 186
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  336 DQAAAEQLTLAQAELQSqWEAKCE---QLLASArdEHLQQYREvcAQRDAHQQKLALLQDECLALQAQIAA--FTEQKEH 410
Cdd:PRK11281   187 KALRPSQRVLLQAEQAL-LNAQNDlqrKSLEGN--TQLQDLLQ--KQRDYLTARIQRLEHQLQLLQEAINSkrLTLSEKT 261
                          250       260
                   ....*....|....*....|
gi 1720409153  411 MQRLEktkSQAPAGRAAADP 430
Cdd:PRK11281   262 VQEAQ---SQDEAARIQANP 278
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
131-420 8.73e-06

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 48.53  E-value: 8.73e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 131 QENERLKQELLEKSSRIEEQNDKISDL----------IERNQRYVEQSNLMMEKRNNSLQTatentQAKVTEELAAATAQ 200
Cdd:pfam15742  48 QHNSLLQEENIKIKAELKQAQQKLLDStkmcssltaeWEHCQQKIRELELEVLKQAQSIKS-----QNSLQEKLAQEKSK 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 201 VShlqlkmtAHQKKETELQLQLTD--NLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEEL 278
Cdd:pfam15742 123 VA-------EAEKKILELQQKLEHahKVCLTETCILEKKQLEEEIKEAQENEAKLKQQYQEEQQKRKLLDQNVNELQQQV 195
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 279 TDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKShqEELDRLRQLLKkarvstdqaaaEQLTLAQAELQSQWEaKC 358
Cdd:pfam15742 196 RILQDKEAQLERTNSQQQLRIQQQEAQLKQLENEKRKS--DEHLKSNQELS-----------EKLSSLQQEKEALQE-EL 261
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1720409153 359 EQLLASArDEHLQQYREVCAQRDAHQQKL-ALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQ 420
Cdd:pfam15742 262 QQFLKQL-DVHVRKYNEKHHHHKAKLRRAkDRLLHEVEQRDERIKQLENEIRILQSQIEKEKA 323
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
108-303 3.74e-05

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 46.93  E-value: 3.74e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 108 MLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDliernqryvEQSNLMMEKRNNSLqtATENTQ 187
Cdd:NF038025   23 DLLENMAKEKDEKQIKKAADEVTAEKDDLLDELENEQEEEPETFTEQKE---------EEDKEDLEAILDEL--ATEANK 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 188 AKVteELAAATAQVSHLQLKMTAHQKKETELqlqltdNLKEtdllrghvtrlqaDLSELREaseqtqtkfksEKQSRRQ- 266
Cdd:NF038025   92 ASA--ELDEVNAEIQGVKEEIKEKQEQLMVL------DTKE-------------ELDELSE-----------EELAERQe 139
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 1720409153 267 LELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQER 303
Cdd:NF038025  140 LEAEIKQLEAQLDELEEEKEELEEELKTIRKDQWSQT 176
PHA03247 PHA03247
large tegument protein UL36; Provisional
495-680 1.04e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.08  E-value: 1.04e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  495 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 574
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  575 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 652
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1720409153  653 PalDPESQGGEAQPPECKQAEDVSSS-GP 680
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
BREX_BrxC NF033441
BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, ...
236-437 6.38e-03

BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, from BREX (bacteriophage exclusion) systems of type 1.


Pssm-ID: 380283  Cd Length: 1173  Bit Score: 39.87  E-value: 6.38e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  236 VTRLQADLSELREAS--EQTQTKFKSEKQSRRQLELKVTSLEEELT--------DLRAEKTSLEKNLSERKKKSAQErcq 305
Cdd:NF033441   928 LEPALALLEEILSIKdnEEFLKALNKKEDDLLDLIEDWEDVKSFFEgdqlpiwdRALRLLKEYEDNLDYELDEEAEE--- 1004
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  306 AEAEMDEIRKSH---------QEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSqwEAKCEQLLASARDEHLQQYREv 376
Cdd:NF033441  1005 AIEELRSILADPdpysripdlPPLLEALREALREALEELREAALEAIEEAKAELEA--DLEWQELSDEQQNRLLAPFDE- 1081
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1720409153  377 CAQRDAHQQKLALLQDecLALQAQIAAFTEQKEHMQRL--EKTKSQAPAGRAAADPSEKVKKI 437
Cdd:NF033441  1082 LKERIEPEVSIASLRA--LLDQLADALLDRLLDRIEALiqRFQEEKAEPEVKEAAAEPPEPKV 1142
 
Name Accession Description Interval E-value
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
117-456 9.09e-16

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 81.68  E-value: 9.09e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  117 METSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENtQAKVTEELAA 196
Cdd:COG1196    705 EELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEA-LAKLKEEIEE 783
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  197 ATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEE 276
Cdd:COG1196    784 LEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKE 863
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  277 ELTDLRAEKTSLEKNLS----ERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTL---AQAE 349
Cdd:COG1196    864 ELEELEAEKEELEDELKeleeEKEELEEELR-ELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELeeeYEDT 942
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  350 LQSQWEAKCEQLLASARD------EHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEhmQRLEKTKSQApa 423
Cdd:COG1196    943 LETELEREIERLEEEIEAlgpvnlRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKR--ERFKETFDKI-- 1018
                          330       340       350
                   ....*....|....*....|....*....|...
gi 1720409153  424 graaadpSEKVKKIMNQVFQSLRGEFELEESYD 456
Cdd:COG1196   1019 -------NENFSEIFKELFGGGTAELELTEPDD 1044
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
123-420 5.58e-12

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 69.36  E-value: 5.58e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  123 MSNIQRIiQENERLKQELLEkssRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQT---ATENTQAKVTEELAAATA 199
Cdd:COG1196    178 ERKLERT-EENLERLEDLLE---ELEKQLEKLERQAEKAERYQELKAELRELELALLLAklkELRKELEELEEELSRLEE 253
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  200 QVSHLQLKMtahQKKETELQlQLTDNLKEtdlLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELT 279
Cdd:COG1196    254 ELEELQEEL---EEAEKEIE-ELKSELEE---LREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEERLE 326
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  280 DLRAEKTSLEKNLSERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLLKKaRVSTDQAAAEQLTLAQAELQSQWEAKCE 359
Cdd:COG1196    327 ELKEKIEALKEELEERETLLEELE-QLLAELEEAKEELEEKLSALLEELEE-LFEALREELAELEAELAEIRNELEELKR 404
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1720409153  360 QL--LASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQ-RLEKTKSQ 420
Cdd:COG1196    405 EIesLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRdRLKELERE 468
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
125-404 4.11e-11

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 66.62  E-value: 4.11e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  125 NIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATEntqakVTEELAAATAQVSHL 204
Cdd:TIGR02168  699 ALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTE-----LEAEIEELEERLEEA 773
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  205 QLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEK--------------QSRRQLELK 270
Cdd:TIGR02168  774 EEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLErriaaterrledleEQIEELSED 853
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  271 VTSLEEELTDLRAEKTSLEKNL---SERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQ 347
Cdd:TIGR02168  854 IESLAAEIEELEELIEELESELealLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREKLAQLELRLEG 933
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 1720409153  348 AELQSQweakceQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAF 404
Cdd:TIGR02168  934 LEVRID------NLQERLSEEYSLTLEEAEALENKIEDDEEEARRRLKRLENKIKEL 984
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
92-408 7.37e-11

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 65.86  E-value: 7.37e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153   92 LMTKVEELQKHSSgnsMLLPSMSV-TMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNL 170
Cdd:TIGR02169  693 LQSELRRIENRLD---ELSQELSDaSRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQEIENVKSELKELEARIEE 769
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  171 MMEKRNNsLQTATENTQA--------KVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQAD 242
Cdd:TIGR02169  770 LEEDLHK-LEEALNDLEArlshsripEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEKEIQELQEQRIDLKEQ 848
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  243 LSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKsaqeRCQAEAEMDEIRKsHQEELD 322
Cdd:TIGR02169  849 IKSIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERK----IEELEAQIEKKRK-RLSELK 923
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  323 RLRQLLKKARVSTDQAAAEQLTLAQAELQ-SQWEAKCEQLLASARD------EHLQQYREVCAQRDAHQQKLALLQDECL 395
Cdd:TIGR02169  924 AKLEALEEELSEIEDPKGEDEEIPEEELSlEDVQAELQRVEEEIRAlepvnmLAIQEYEEVLKRLDELKEKRAKLEEERK 1003
                          330
                   ....*....|...
gi 1720409153  396 ALQAQIAAFTEQK 408
Cdd:TIGR02169 1004 AILERIEEYEKKK 1016
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
122-417 4.36e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 63.19  E-value: 4.36e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  122 IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQsnlmmekrnnslQTATENTQAKVTEELAAATAQV 201
Cdd:COG1196    244 LEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEE------------LLELKEEIEELEGEISLLRERL 311
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  202 SHLQLKMTAHQKKETELQLQLTD---NLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSrrqlelKVTSLEEEL 278
Cdd:COG1196    312 EELENELEELEERLEELKEKIEAlkeELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEE------LFEALREEL 385
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  279 TDLRAEKTSLEKNLSErkkksaqercqAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQsqwEAKC 358
Cdd:COG1196    386 AELEAELAEIRNELEE-----------LKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEE---LEEL 451
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1720409153  359 EQLLASARDEHLQQYREVCAQRDAHQQKLALLQD---ECLALQAQIAAFTEQKEHMQRLEKT 417
Cdd:COG1196    452 EEQLEELRDRLKELERELAELQEELQRLEKELSSleaRLDRLEAEQRASQGVRAVLEALESG 513
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
137-421 9.95e-10

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 62.38  E-value: 9.95e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  137 KQELLEKSSRIEEQNDKISDLIERnqryveqsnlmMEKRNNSLQTatentQAKVTEELAAATAQVSHLQL-----KMTAH 211
Cdd:TIGR02168  174 RKETERKLERTRENLDRLEDILNE-----------LERQLKSLER-----QAEKAERYKELKAELRELELallvlRLEEL 237
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  212 QKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-------EASEQTQTKFKS--------------EKQSRRQLELK 270
Cdd:TIGR02168  238 REELEELQEELKEAEEELEELTAELQELEEKLEELRlevseleEEIEELQKELYAlaneisrleqqkqiLRERLANLERQ 317
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  271 VTSLEEELTDLRAEKTSLEKNLSERKKK--SAQERCQAEAEMDEIRKSHQEELDRLRQLLKKA--RVSTDQAAAE-QLTL 345
Cdd:TIGR02168  318 LEELEAQLEELESKLDELAEELAELEEKleELKEELESLEAELEELEAELEELESRLEELEEQleTLRSKVAQLElQIAS 397
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  346 AQAELQSQwEAKCEQLlaSARDEHLQQYRE------VCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQRLEKTKS 419
Cdd:TIGR02168  398 LNNEIERL-EARLERL--EDRRERLQQEIEellkklEEAELKELQAELEELEEELEELQEELERLEEALEELREELEEAE 474

                   ..
gi 1720409153  420 QA 421
Cdd:TIGR02168  475 QA 476
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
135-415 1.40e-09

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 61.65  E-value: 1.40e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  135 RLKQELLEKSSRIEEQNDKISDL-IERNQRYVEQSNLmmekrnNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQK 213
Cdd:COG1196    657 RNKRSSLAQKRELKELEEELAELeAQLEKLEEELKSL------KNELRSLEDLLEELRRQLEELERQLEELKRELAALEE 730
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  214 KETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEK--- 290
Cdd:COG1196    731 ELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERrld 810
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  291 NLSERKKKSAQERCQAEAEMDEIR---KSHQEELDRLRQLLKKARVSTDQaAAEQLTLAQAELQSqweakceqllasaRD 367
Cdd:COG1196    811 ALERELESLEQRRERLEQEIEELEeeiEELEEKLDELEEELEELEKELEE-LKEELEELEAEKEE-------------LE 876
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*....
gi 1720409153  368 EHLQQYREVCAQRDAHQQKLALLQDEC-LALQAQIAAFTEQKEHMQRLE 415
Cdd:COG1196    877 DELKELEEEKEELEEELRELESELAELkEEIEKLRERLEELEAKLERLE 925
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
212-456 4.46e-09

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 60.07  E-value: 4.46e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  212 QKKETELQL--------QLTDNLKEtdlLRGHVTRLQA-------------------------DLSELREASEQTQTKFK 258
Cdd:TIGR02168  173 RRKETERKLertrenldRLEDILNE---LERQLKSLERqaekaerykelkaelrelelallvlRLEELREELEELQEELK 249
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  259 SEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKK-----SAQERCQAEAEMDEIRKSH----QEELDRLRQLLK 329
Cdd:TIGR02168  250 EAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKElyalaNEISRLEQQKQILRERLANlerqLEELEAQLEELE 329
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  330 KARVsTDQAAAEQLTLAQAELQSQWEAKCEQL--LASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQ 407
Cdd:TIGR02168  330 SKLD-ELAEELAELEEKLEELKEELESLEAELeeLEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEAR 408
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|
gi 1720409153  408 KEHMQ-RLEKTKSQAPAGRAAADPSEKvKKIMNQVFQSLRGEFELEESYD 456
Cdd:TIGR02168  409 LERLEdRRERLQQEIEELLKKLEEAEL-KELQAELEELEEELEELQEELE 457
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
159-578 1.02e-08

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 58.77  E-value: 1.02e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 159 ERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTR 238
Cdd:NF033930   75 DEDQKKTEEKAKKEKKASEEEQKANLAVQKAYVKYRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRAKVVP 154
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 239 LQADLSELREASEQTQTKfksEKQSRRQLELKVTSLEEELTDLRAEKTSLEKnlsERKKKSAQERCQAEAEmdeirkshq 318
Cdd:NF033930  155 EAEELAETKKKAEEAKAE---EPVAKKKVDEAKKKVEEAKKKVEAEEAEIEK---LQNEEVALEAKIAELE--------- 219
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 319 EELDRLRQLLKKARVSTDQAAAEQ---------LTLAQAELqSQWEAKCEQLLASARDEHLQQyrevcaQRDAHQQKLAL 389
Cdd:NF033930  220 NQVDNLEKELAEIDESDSEDYIKEglrapleseLDAKQAKL-AKKQTELEKLLDSLDPEGKTQ------DELDKEAAEEE 292
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 390 LQDECLALQAQIAAFTEQKEHMQRLEktKSQAPAGRAAADPSEKVKKImnqvfqslrgefELEEsydggtilrtimhTIK 469
Cdd:NF033930  293 LSKKIDELDNEVAKLEKEVSDLENSD--NNVADYYKEALEKDLATKKA------------ELEK-------------TQK 345
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 470 MVTlQLLNHQEEEEEEEEEEEEEKKPLRPSlEQPGPA----TPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTP 545
Cdd:NF033930  346 DLD-KALNELGPDGDEEETPAPAPQPEQPA-PAPAPApkpeQPAPAPKPEKPADQQAEEDYARRSEEEYNRLTQQQPPKA 423
                         410       420       430
                  ....*....|....*....|....*....|...
gi 1720409153 546 EngaqtrkgEPAEAEVPSeikdsslPPQPAGIP 578
Cdd:NF033930  424 E--------KPAPAPAPK-------PEQPAPAP 441
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
127-349 1.05e-08

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 58.93  E-value: 1.05e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  127 QRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKrnnslqtaTENTQAKVTEELAAATAQVSHLQL 206
Cdd:TIGR02169  272 QLLEELNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKERELED--------AEERLAKLEAEIDKLLAEIEELER 343
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  207 KMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTK---FKSEKQS-----------RRQLELKVT 272
Cdd:TIGR02169  344 EIEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKlekLKREINElkreldrlqeeLQRLSEELA 423
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  273 SLEEELTDLRAEKTSLE---KNLSERKKKSAQERCQAEAEMDEIRKSH---QEELDRLRQLLKKARVSTDQAAAEQLTLA 346
Cdd:TIGR02169  424 DLNAAIAGIEAKINELEeekEDKALEIKKQEWKLEQLAADLSKYEQELydlKEEYDRVEKELSKLQRELAEAEAQARASE 503

                   ...
gi 1720409153  347 QAE 349
Cdd:TIGR02169  504 ERV 506
PRK11281 PRK11281
mechanosensitive channel MscK;
177-430 2.81e-08

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 57.61  E-value: 2.81e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  177 NSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETE-LQLQLTDNLKETdllrghvTRLQADLSELReASEQTQT 255
Cdd:PRK11281    43 AQLDALNKQKLLEAEDKLVQQDLEQTLALLDKIDRQKEETEqLKQQLAQAPAKL-------RQAQAELEALK-DDNDEET 114
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  256 KFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSerKKKSAQERCQaeAEMDEirksHQEELDRLRQLLKKARVST 335
Cdd:PRK11281   115 RETLSTLSLRQLESRLAQTLDQLQNAQNDLAEYNSQLV--SLQTQPERAQ--AALYA----NSQRLQQIRNLLKGGKVGG 186
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  336 DQAAAEQLTLAQAELQSqWEAKCE---QLLASArdEHLQQYREvcAQRDAHQQKLALLQDECLALQAQIAA--FTEQKEH 410
Cdd:PRK11281   187 KALRPSQRVLLQAEQAL-LNAQNDlqrKSLEGN--TQLQDLLQ--KQRDYLTARIQRLEHQLQLLQEAINSkrLTLSEKT 261
                          250       260
                   ....*....|....*....|
gi 1720409153  411 MQRLEktkSQAPAGRAAADP 430
Cdd:PRK11281   262 VQEAQ---SQDEAARIQANP 278
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
122-315 7.22e-08

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 55.80  E-value: 7.22e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 122 IMSNIQRIIQENERLKQELLEkssrIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTaTENTQAKVTEELAAATAQV 201
Cdd:TIGR04523 202 LLSNLKKKIQKNKSLESQISE----LKKQNNQLKDNIEKKQQEINEKTTEISNTQTQLNQ-LKDEQNKIKKQLSEKQKEL 276
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 202 --SHLQLKMTAHQKKETELQLQLTDNLKETDLLRghvtRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELT 279
Cdd:TIGR04523 277 eqNNKKIKELEKQLNQLKSEISDLNNQKEQDWNK----ELKSELKNQEKKLEEIQNQISQNNKIISQLNEQISQLKKELT 352
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1720409153 280 DLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRK 315
Cdd:TIGR04523 353 NSESENSEKQRELEEKQNEIEKLKKENQSYKQEIKN 388
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
76-350 9.40e-08

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 55.83  E-value: 9.40e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153   76 TEIRMAVNKVADKMDHLMTKVEELQKhssgnsmllpsmsvtmETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKIS 155
Cdd:TIGR02168  270 EELRLEVSELEEEIEELQKELYALAN----------------EISRLEQQKQILRERLANLERQLEELEAQLEELESKLD 333
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  156 DLIERNQRyveqsnlmMEKRNNSLQTATENTQAKVTE---ELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLL 232
Cdd:TIGR02168  334 ELAEELAE--------LEEKLEELKEELESLEAELEEleaELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERL 405
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  233 RGHVTRLQADLSELREasEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEknlsERKKKSAQERCQAEAEMDE 312
Cdd:TIGR02168  406 EARLERLEDRRERLQQ--EIEELLKKLEEAELKELQAELEELEEELEELQEELERLE----EALEELREELEEAEQALDA 479
                          250       260       270
                   ....*....|....*....|....*....|....*....
gi 1720409153  313 IRKSHQEELDRLRQLLK-KARVSTDQAAAEQLTLAQAEL 350
Cdd:TIGR02168  480 AERELAQLQARLDSLERlQENLEGFSEGVKALLKNQSGL 518
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
120-430 4.16e-07

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 53.61  E-value: 4.16e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 120 SMIMSNIQRIIQENERLKQELLEKSSRIEEQndkISDLIERNQRYVEQSNLMMEKRNNSLQTATENtqakvteELAAATA 199
Cdd:COG0419   170 EKLSELLKEVIKEAKAKIEELEGQLSELLED---IEDLLEALEEELKELKKLEEIQEEQEEEELEQ-------EIEALEE 239
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 200 QVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLElKVTSLEEELT 279
Cdd:COG0419   240 RLAELEEEKERLEELKARLLEIESLELEALKIREEELRELERLLEELEEKIERLEELEREIEELEEELE-GLRALLEELE 318
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 280 DLRAEKtsleKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAELQSQWEAKCE 359
Cdd:COG0419   319 ELLEKL----KSLEERLEKLEEKLEKLESELEELAEEKNELAKLLEERLKELE--ERLEELEKELEKALERLKQLEEAIQ 392
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1720409153 360 QLLaSARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEhmqRLEKTKSQAPAGRAAADP 430
Cdd:COG0419   393 ELK-EELAELSAALEEIQEELEELEKELEELERELEELEEEIKKLEEQIN---QLESKELMIAELAGAGEK 459
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
132-421 5.61e-07

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 53.23  E-value: 5.61e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 132 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLmmEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTah 211
Cdd:COG0419   468 PEEHEKELLELYELELEELEEELSREKEEAELREEIEEL--EKELRELEEELIELLELEEALKEELEEKLEKLENLLE-- 543
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 212 QKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQ------TQTKFKSEKQSRRQLELKVTSLEEELTDLRAEK 285
Cdd:COG0419   544 ELEELKEKLQLQQLKEELRQLEDRLQELKELLEELRLLRTRkeeleeLRERLKELKKKLKELEERLSQLEELLQSLELSE 623
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 286 TSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARvstdqAAAEQLTLAQAELQsqweakceqllasa 365
Cdd:COG0419   624 AENELEEAEEELESELEKLNLQAELEELLQAALEELEEKVEELEAEI-----RRELQRIENEEQLE-------------- 684
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1720409153 366 rdEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQA 421
Cdd:COG0419   685 --EKLEELEQLEEELEQLREELEELLKKLGEIEQLIEELESRKAELEELKKELEKL 738
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
115-319 8.93e-07

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 52.33  E-value: 8.93e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 115 VTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIER-NQRYVEQSNLMMEKRnnslqtatENTQAKVTEE 193
Cdd:TIGR04523 244 KTTEISNTQTQLNQLKDEQNKIKKQLSEKQKELEQNNKKIKELEKQlNQLKSEISDLNNQKE--------QDWNKELKSE 315
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 194 LaaataqvshlqlkmTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTS 273
Cdd:TIGR04523 316 L--------------KNQEKKLEEIQNQISQNNKIISQLNEQISQLKKELTNSESENSEKQRELEEKQNEIEKLKKENQS 381
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*....
gi 1720409153 274 LEEELTDLRAEKTSLEKNLSERKKKSAQERCQ---AEAEMDEIRKSHQE 319
Cdd:TIGR04523 382 YKQEIKNLESQINDLESKIQNQEKLNQQKDEQikkLQQEKELLEKEIER 430
PRK11281 PRK11281
mechanosensitive channel MscK;
125-351 1.38e-06

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 51.84  E-value: 1.38e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  125 NIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERN-----QRYVEQSNLMMEKRNNSLQTATENTQakvtEELAAATA 199
Cdd:PRK11281    74 KIDRQKEETEQLKQQLAQAPAKLRQAQAELEALKDDNdeetrETLSTLSLRQLESRLAQTLDQLQNAQ----NDLAEYNS 149
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  200 QVSHLQLK-------MTAHQKKETELQLQLTDNLKETDLLRG-HVTRLQADLS------ELREASEQTQTKFKSEKQSRR 265
Cdd:PRK11281   150 QLVSLQTQperaqaaLYANSQRLQQIRNLLKGGKVGGKALRPsQRVLLQAEQAllnaqnDLQRKSLEGNTQLQDLLQKQR 229
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  266 QL-ELKVTSLEEELTDLRAEKTslEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAaeqlT 344
Cdd:PRK11281   230 DYlTARIQRLEHQLQLLQEAIN--SKRLTLSEKTVQEAQSQDEAARIQANPLVAQELEINLQLSQRLLKATEKLN----T 303

                   ....*..
gi 1720409153  345 LAQAELQ 351
Cdd:PRK11281   304 LTQQNLR 310
PTZ00121 PTZ00121
MAEBL; Provisional
134-349 3.76e-06

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 50.52  E-value: 3.76e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  134 ERLKQELLEKSSRIEEQNDKisdliernqRYVEQSNLMMEKRNNSLQTATENTQAKvtEELAAATAQVSHLQLKMTAHQK 213
Cdd:PTZ00121  1544 EKKKADELKKAEELKKAEEK---------KKAEEAKKAEEDKNMALRKAEEAKKAE--EARIEEVMKLYEEEKKMKAEEA 1612
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  214 KETELQLQLTDNLKETDLLRGHVTRLQADLSE-------LREASEQT-----QTKFKSEKQSRRQLELKVTSLEEELTDL 281
Cdd:PTZ00121  1613 KKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEekkkaeeLKKAEEENkikaaEEAKKAEEDKKKAEEAKKAEEDEKKAAE 1692
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720409153  282 RAEKTSLEKNLSER-KKKSAQERCQAEaemdEIRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAE 349
Cdd:PTZ00121  1693 ALKKEAEEAKKAEElKKKEAEEKKKAE----ELKKAEEENKIKAEEAKKEAE--EDKKKAEEAKKDEEE 1755
PTZ00121 PTZ00121
MAEBL; Provisional
132-435 4.38e-06

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 50.52  E-value: 4.38e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  132 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQA---KVTEELAAATAQVSHLQLKM 208
Cdd:PTZ00121  1312 EEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAaekKKEEAKKKADAAKKKAEEKK 1391
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  209 TAHQ-KKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEqtqTKFKSEkQSRRQLELKVTSlEEELTDLRAEKTS 287
Cdd:PTZ00121  1392 KADEaKKKAEEDKKKADELKKAAAAKKKADEAKKKAEEKKKADE---AKKKAE-EAKKADEAKKKA-EEAKKAEEAKKKA 1466
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  288 LEKNLSERKKKSAQERCQAE--AEMDEIRKSHQEELDRLRQLLKKA---RVSTDQAAAEQLTLAQAELQSQWEAKCEQLL 362
Cdd:PTZ00121  1467 EEAKKADEAKKKAEEAKKADeaKKKAEEAKKKADEAKKAAEAKKKAdeaKKAEEAKKADEAKKAEEAKKADEAKKAEEKK 1546
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1720409153  363 ASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK--EHMQRLEKTKSQAPAGRAAADPSEKVK 435
Cdd:PTZ00121  1547 KADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEAriEEVMKLYEEEKKMKAEEAKKAEEAKIK 1621
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
227-454 4.84e-06

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 49.64  E-value: 4.84e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 227 KETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKsaQERCQA 306
Cdd:COG4372   123 QELAAARQNLAKAQQELARLTKQAQDLQTRLKTLAEQRRQLEAQAQSLQASQKQLQASATQLKSQVLDLKLR--SAQIEQ 200
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 307 EAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSqweakceqllASARDEHLQQyREVCAQRdaHQQK 386
Cdd:COG4372   201 EAQNLATRANAAQARTEELARRAAAAQQTAQAIQQRDAQISQKAQQ----------IAARAEQIRE-RERQLQR--LETA 267
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 387 LALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADpSEKVKKIMNQVFQSLR--GEFELEES 454
Cdd:COG4372   268 QARLEQEVAQLEAYYQAYVRLRQQAAATQRGQVLAGAAQRVAQ-AQAQAQAQAQLLSSANrpAALRLRRS 336
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
240-456 5.87e-06

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 50.06  E-value: 5.87e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  240 QADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKK--KSAQERCQAEAEMDEIRKSH 317
Cdd:TIGR02168  676 RREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKdlARLEAEVEQLEERIAQLSKE 755
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  318 QEELDRLRQLLKKARVSTDQAAAE------QLTLAQAELQSQWEAKCEQlLASARDEHLQQYREVCAQR---DAHQQKLA 388
Cdd:TIGR02168  756 LTELEAEIEELEERLEEAEEELAEaeaeieELEAQIEQLKEELKALREA-LDELRAELTLLNEEAANLRerlESLERRIA 834
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720409153  389 LLQDECLALQAQIAaftEQKEHMQRLEktKSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFELEESYD 456
Cdd:TIGR02168  835 ATERRLEDLEEQIE---ELSEDIESLA--AEIEELEELIEELESELEALLNERASLEEALALLRSELE 897
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
131-420 8.73e-06

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 48.53  E-value: 8.73e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 131 QENERLKQELLEKSSRIEEQNDKISDL----------IERNQRYVEQSNLMMEKRNNSLQTatentQAKVTEELAAATAQ 200
Cdd:pfam15742  48 QHNSLLQEENIKIKAELKQAQQKLLDStkmcssltaeWEHCQQKIRELELEVLKQAQSIKS-----QNSLQEKLAQEKSK 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 201 VShlqlkmtAHQKKETELQLQLTD--NLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEEL 278
Cdd:pfam15742 123 VA-------EAEKKILELQQKLEHahKVCLTETCILEKKQLEEEIKEAQENEAKLKQQYQEEQQKRKLLDQNVNELQQQV 195
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 279 TDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKShqEELDRLRQLLKkarvstdqaaaEQLTLAQAELQSQWEaKC 358
Cdd:pfam15742 196 RILQDKEAQLERTNSQQQLRIQQQEAQLKQLENEKRKS--DEHLKSNQELS-----------EKLSSLQQEKEALQE-EL 261
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1720409153 359 EQLLASArDEHLQQYREVCAQRDAHQQKL-ALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQ 420
Cdd:pfam15742 262 QQFLKQL-DVHVRKYNEKHHHHKAKLRRAkDRLLHEVEQRDERIKQLENEIRILQSQIEKEKA 323
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
130-391 1.18e-05

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 48.48  E-value: 1.18e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 130 IQENERLKQELLEKSSRIEEQNDkisdlIERNQRYVEQSNLMMEKRNNSLQTATENTQ-AKVTEELAAATAQVSHLQ--L 206
Cdd:COG4372    79 IRPQLRALRTELGTAQGEKRAAE-----TEREAARSELQKARQEREAVRQELAAARQNlAKAQQELARLTKQAQDLQtrL 153
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 207 KMTAHQKKETELQLQLTDNlkETDLLRGHVTRLQADLSELREASEQTQTKFKsEKQSRRQlelKVTSLEEELTDLRAEKT 286
Cdd:COG4372   154 KTLAEQRRQLEAQAQSLQA--SQKQLQASATQLKSQVLDLKLRSAQIEQEAQ-NLATRAN---AAQARTEELARRAAAAQ 227
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 287 SLEKNLSERKKKsAQERCQAEAEMDEIRKSHQEELDRLRQllKKARVSTDQAAAEQLTLAQAELQSQWEAKCE-QLLASA 365
Cdd:COG4372   228 QTAQAIQQRDAQ-ISQKAQQIAARAEQIRERERQLQRLET--AQARLEQEVAQLEAYYQAYVRLRQQAAATQRgQVLAGA 304
                         250       260
                  ....*....|....*....|....*...
gi 1720409153 366 --RDEHLQQYREVCAQRDAHQQKLALLQ 391
Cdd:COG4372   305 aqRVAQAQAQAQAQAQLLSSANRPAALR 332
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
124-359 1.30e-05

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 48.91  E-value: 1.30e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 124 SNIQRIIQENErlkQELLEKSSRIEEQNDKISDLIERnqryVEqsnlMMEKRNNSLQtatentqaKVTEELAAATAQVSH 203
Cdd:PRK03918  189 ENIEELIKEKE---KELEEVLREINEISSELPELREE----LE----KLEKEVKELE--------ELKEEIEELEKELES 249
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 204 LQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQadlsELREASEQTQT--KFKSE-KQSRRQLELKVTSLEEELTD 280
Cdd:PRK03918  250 LEGSKRKLEEKIRELEERIEELKKEIEELEEKVKELK----ELKEKAEEYIKlsEFYEEyLDELREIEKRLSRLEEEING 325
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720409153 281 LRAEKTSLEKnLSERKKKSAQERCQAEAEMDEIRKSHqEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQWEAKCE 359
Cdd:PRK03918  326 IEERIKELEE-KEERLEELKKKLKELEKRLEELEERH-ELYEEAKAKKEELERLKKRLTGLTPEKLEKELEELEKAKEE 402
Macoilin pfam09726
Macoilin family; The Macoilin proteins has an N-terminal portion that is composed of 5 ...
185-408 1.71e-05

Macoilin family; The Macoilin proteins has an N-terminal portion that is composed of 5 trasnmembrane helices, followed by a C-terminal coiled-coil region. Macoilin is a highly conserved protein present in eukaryotes. Macoilin appears to be found in the ER and be involved in the function of neurons.


Pssm-ID: 401607  Cd Length: 664  Bit Score: 48.30  E-value: 1.71e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 185 NTQAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLtdnlketDLLRGHVTRLQADLSELREASEQTQTKFKS----- 259
Cdd:pfam09726 382 NNQLSKPDALVRLEQDIKKLKAELQASRQTEQELRSQI-------SSLTSLERSLKSELGQLRQENDLLQTKLHNavsak 454
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 260 --EKQSRRQLELKvtsLEEEltdlRAEKTSLEKNLSERKK-------KSAQERCQAEA---EMDEIRKSHQEELD-RLRQ 326
Cdd:pfam09726 455 qkDKQTVQQLEKR---LKAE----QEARASAEKQLAEEKKrkkeeeaTAARAVALAAAsrgECTESLKQRKRELEsEIKK 527
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 327 LLKKARVSTDQAAaeqltlaqaelqsQWEAKCEQllasardehLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTE 406
Cdd:pfam09726 528 LTHDIKLKEEQIR-------------ELEIKVQE---------LRKYKESEKDTEVLMSALSAMQDKNQHLENSLSAETR 585

                  ..
gi 1720409153 407 QK 408
Cdd:pfam09726 586 IK 587
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
127-421 1.78e-05

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 48.11  E-value: 1.78e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 127 QRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQsnlMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQL 206
Cdd:PRK02224  240 DEVLEEHEERREELETLEAEIEDLRETIAETEREREELAEE---VRDLRERLEELEEERDDLLAEAGLDDADAEAVEARR 316
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 207 KMTAHQKKET-----ELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDL 281
Cdd:PRK02224  317 EELEDRDEELrdrleECRVAAQAHNEEAESLREDADDLEERAEELREEAAELESELEEAREAVEDRREEIEELEEEIEEL 396
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 282 RaektsleknlsERKKKSAQERCQAEAEMDEIRkshqEELDRLRQLLKKARVSTdQAAAEQLTLAQAELQSQWEAKCEQL 361
Cdd:PRK02224  397 R-----------ERFGDAPVDLGNAEDFLEELR----EERDELREREAELEATL-RTARERVEEAEALLEAGKCPECGQP 460
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1720409153 362 LA-SARDEHLQQYREvcaQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQA 421
Cdd:PRK02224  461 VEgSPHVETIEEDRE---RVEELEAELEDLEEEVEEVEERLERAEDLVEAEDRIERLEERR 518
DUF812 pfam05667
Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of ...
132-413 1.89e-05

Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of unknown function.


Pssm-ID: 398992 [Multi-domain]  Cd Length: 590  Bit Score: 48.09  E-value: 1.89e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 132 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAH 211
Cdd:pfam05667 223 EEEWNSQGLASRLTPEEYRKRKRTKLLKRIAEQLRSAALASTEATSGASRSAQDLAELLSSFGGSSTTDTNLTKGSRFTH 302
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 212 QKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKN 291
Cdd:pfam05667 303 TEKLQFTNEAAASPPSKAETEEELQQQREEELEELQEQLEDLESSIEELEKEIKKLESSIKQVEEELEELKEQNEELEKQ 382
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 292 LsERKKKSAQERCQAEAEMDEirkshqeeldrlrqlLKKARvstdQAAAEQLtlaqAELQSQWEAKCEQLLasardEHLQ 371
Cdd:pfam05667 383 Y-KVKKKTLDLLPDAEENIAK---------------LQAVV----EASAQRL----VELAGQWEKHRVPLI-----EEYR 433
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 1720409153 372 QYREVCAQR-DAHQQKLA---LLQDECLalqaQIAAFTEQKEHMQR 413
Cdd:pfam05667 434 ALKEAKSNKeSESQRKLEeikELREKIK----EVAEEARSKEELYK 475
DUF5401 pfam17380
Family of unknown function (DUF5401); This is a family of unknown function found in ...
127-380 1.91e-05

Family of unknown function (DUF5401); This is a family of unknown function found in Chromadorea.


Pssm-ID: 375164 [Multi-domain]  Cd Length: 722  Bit Score: 48.20  E-value: 1.91e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 127 QRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAKV----TEELAAATAQVS 202
Cdd:pfam17380 299 ERLRQEKEEKAREVERRRKLEEAEKARQAEMDRQAAIYAEQERMAMERERELERIRQEERKRELerirQEEIAMEISRMR 378
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 203 HLQ-LKMTAHQKK----------------ETELQLQLTDNLKETDLLRGHVTRL-QADLSELREASEQTQTKFKSEKQSR 264
Cdd:pfam17380 379 ELErLQMERQQKNervrqeleaarkvkilEEERQRKIQQQKVEMEQIRAEQEEArQREVRRLEEERAREMERVRLEEQER 458
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 265 RQlelKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLKKARVSTDQAAAEQLT 344
Cdd:pfam17380 459 QQ---QVERLRQQEEERKRKKLELEKEKRDRKRAEEQRRKILEKELEERKQAMIEE-ERKRKLLEKEMEERQKAIYEEER 534
                         250       260       270
                  ....*....|....*....|....*....|....*.
gi 1720409153 345 LAQAELQSQWEAKCEQllasaRDEHLQQYREVCAQR 380
Cdd:pfam17380 535 RREAEEERRKQQEMEE-----RRRIQEQMRKATEER 565
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
77-420 3.28e-05

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 47.45  E-value: 3.28e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  77 EIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMETSMImsniQRIIQENERLKQELLEKSSRIEEQNDKISD 156
Cdd:COG0419   168 KYEKLSELLKEVIKEAKAKIEELEGQLSELLEDIEDLLEALEEELK----ELKKLEEIQEEQEEEELEQEIEALEERLAE 243
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 157 LIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQ-LTDNLKETDLLRGH 235
Cdd:COG0419   244 LEEEKERLEELKARLLEIESLELEALKIREEELRELERLLEELEEKIERLEELEREIEELEEELEgLRALLEELEELLEK 323
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 236 VTRLQADLSELREASEQTQTKFKSEKQSRRQ-----------LELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQ--- 301
Cdd:COG0419   324 LKSLEERLEKLEEKLEKLESELEELAEEKNElaklleerlkeLEERLEELEKELEKALERLKQLEEAIQELKEELAElsa 403
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 302 --------------ERCQAEAEMDEIRKSH---QEELDRLRQLLKKARVST-----------------DQAAAEQLTLAQ 347
Cdd:COG0419   404 aleeiqeeleelekELEELERELEELEEEIkklEEQINQLESKELMIAELAgagekcpvcgqelpeehEKELLELYELEL 483
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1720409153 348 AELQSQW-EAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDEclaLQAQIAAFTEQKEHMQRL-EKTKSQ 420
Cdd:COG0419   484 EELEEELsREKEEAELREEIEELEKELRELEEELIELLELEEALKEE---LEEKLEKLENLLEELEELkEKLQLQ 555
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
108-303 3.74e-05

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 46.93  E-value: 3.74e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 108 MLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDliernqryvEQSNLMMEKRNNSLqtATENTQ 187
Cdd:NF038025   23 DLLENMAKEKDEKQIKKAADEVTAEKDDLLDELENEQEEEPETFTEQKE---------EEDKEDLEAILDEL--ATEANK 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 188 AKVteELAAATAQVSHLQLKMTAHQKKETELqlqltdNLKEtdllrghvtrlqaDLSELREaseqtqtkfksEKQSRRQ- 266
Cdd:NF038025   92 ASA--ELDEVNAEIQGVKEEIKEKQEQLMVL------DTKE-------------ELDELSE-----------EELAERQe 139
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 1720409153 267 LELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQER 303
Cdd:NF038025  140 LEAEIKQLEAQLDELEEEKEELEEELKTIRKDQWSQT 176
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
79-420 4.84e-05

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 46.89  E-value: 4.84e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153   79 RMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMETSM--IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISD 156
Cdd:TIGR00618  179 TQLALMEFAKKKSLHGKAELLTLRSQLLTLCTPCMPDTYHERKqvLEKELKHLREALQQTQQSHAYLTQKREAQEEQLKK 258
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  157 LIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVtEELAAATAQVSHLQLKMtahQKKETELQLQLTDNLKEtdllRGHV 236
Cdd:TIGR00618  259 QQLLKQLRARIEELRAQEAVLEETQERINRARKA-APLAAHIKAVTQIEQQA---QRIHTELQSKMRSRAKL----LMKR 330
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  237 TRLQADLSELREASEQTQTKFKSEKQSRRQLELKVtsleeeltdLRAEKTSLEKNLSERKKKSAQERCQAEaemdEIRKS 316
Cdd:TIGR00618  331 AAHVKQQSSIEEQRRLLQTLHSQEIHIRDAHEVAT---------SIREISCQQHTLTQHIHTLQQQKTTLT----QKLQS 397
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  317 HQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRevcaQRDAHQQKLALLQDECLA 396
Cdd:TIGR00618  398 LCKELDILQREQATIDTRTSAFRDLQGQLAHAKKQQELQQRYAELCAAAITCTAQCEK----LEKIHLQESAQSLKEREQ 473
                          330       340
                   ....*....|....*....|....*....
gi 1720409153  397 LQAQIAAFTEQ-----KEHMQRLEKTKSQ 420
Cdd:TIGR00618  474 QLQTKEQIHLQetrkkAVVLARLLELQEE 502
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
124-502 7.56e-05

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 46.29  E-value: 7.56e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 124 SNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIER-NQRYVEQSNLMMEKRNN--SLQTATENTQAKVT--------- 191
Cdd:COG0419   315 EELEELLEKLKSLEERLEKLEEKLEKLESELEELAEEkNELAKLLEERLKELEERleELEKELEKALERLKqleeaiqel 394
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 192 -EELAAATAQVSHLQLKMTAHQKKETELQ---LQLTDNLKETDLLRGHVTRLQADLSELREASEQ-----TQTKFKSEKQ 262
Cdd:COG0419   395 kEELAELSAALEEIQEELEELEKELEELErelEELEEEIKKLEEQINQLESKELMIAELAGAGEKcpvcgQELPEEHEKE 474
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 263 SRRQLELKVTSLEEELTdLRAEKTSLEKNLSERKKK---SAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAA 339
Cdd:COG0419   475 LLELYELELEELEEELS-REKEEAELREEIEELEKElreLEEELIELLELEEALKEELEEKLEKLENLLEELEELKEKLQ 553
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 340 AEQLtlaQAELQSqweakCEQLLASARDEhLQQYREVCAQrdahQQKLALLQDECLALQAQIAAFTEQKEHMQRLEKTKS 419
Cdd:COG0419   554 LQQL---KEELRQ-----LEDRLQELKEL-LEELRLLRTR----KEELEELRERLKELKKKLKELEERLSQLEELLQSLE 620
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 420 QAPAGRAAADPSEKVKKIMNQvfqsLRGEFELEESYDGGTILRTIMHTIKMVTLQLLNHQEEEEEEEEEEEEEKKPLRPS 499
Cdd:COG0419   621 LSEAENELEEAEEELESELEK----LNLQAELEELLQAALEELEEKVEELEAEIRRELQRIENEEQLEEKLEELEQLEEE 696

                  ...
gi 1720409153 500 LEQ 502
Cdd:COG0419   697 LEQ 699
COG1579 COG1579
Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function ...
192-330 9.53e-05

Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function prediction only];


Pssm-ID: 224495 [Multi-domain]  Cd Length: 239  Bit Score: 44.66  E-value: 9.53e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 192 EELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTK--FKSEKQSRRQLEL 269
Cdd:COG1579    31 KALKKAKAELEALNKALEALEIELEDLENQVSQLESEIQEIRERIKRAEEKLSAVKDERELRALNieIQIAKERINSLED 110
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1720409153 270 KVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKK 330
Cdd:COG1579   111 ELAELMEEIEKLEKEIEDLKERLERLEKNLAEAEARLEEEVAEIREEGQELSSKREELKEK 171
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
118-323 1.03e-04

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 45.48  E-value: 1.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 118 ETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDliernqryveqsnlmMEKRNNSLQTATENTQAKVTEELAAA 197
Cdd:COG4942    60 QRAKLEKQLKSLETEIASLEAQLIETADDLKKLRKQIAD---------------LNARLNALEVQEREQRRRLAEQLAAL 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 198 TAQVSH--LQLKMTAHQKKETEL-----------QLQLTDNLKETdllRGHVTRLQADLSELREASEQTQTKFKSE---- 260
Cdd:COG4942   125 QRSGRNppPALLVSPEDAQRSVRlaiyygalnpaRAERIDALKAT---LKQLAAVRAEIAAEQAELTTLLSEQRAQqakl 201
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 261 -------KQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDR 323
Cdd:COG4942   202 aqlleerKKTLAQLNSELSADQKKLEELRANESRLKNEIASAEAAAAKAREAAAAAEAAAARARAAEAKR 271
PHA03247 PHA03247
large tegument protein UL36; Provisional
495-680 1.04e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.08  E-value: 1.04e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  495 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 574
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  575 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 652
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1720409153  653 PalDPESQGGEAQPPECKQAEDVSSS-GP 680
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
135-421 1.27e-04

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 45.49  E-value: 1.27e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  135 RLKQELLEKSSRIEEQNDKISDL---IERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEE--LAAATAQVSHLQLKMt 209
Cdd:pfam15921  479 KVVEELTAKKMTLESSERTVSDLtasLQEKERAIEATNAEITKLRSRVDLKLQELQHLKNEGdhLRNVQTECEALKLQM- 557
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  210 AHQKKETELQLQLTDNLkeTDLLRGH---VTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKT 286
Cdd:pfam15921  558 AEKDKVIEILRQQIENM--TQLVGQHgrtAGAMQVEKAQLEKEINDRRLELQEFKILKDKKDAKIRELEARVSDLELEKV 635
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  287 SLEKNLSERKKKSAQERCQAEAEMDEIRKSHQE--ELDRLRQLLKKarvsTDQAAAEQLTLAQAELQSQweakceqlLAS 364
Cdd:pfam15921  636 KLVNAGSERLRAVKDIKQERDQLLNEVKTSRNElnSLSEDYEVLKR----NFRNKSEEMETTTNKLKMQ--------LKS 703
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1720409153  365 ARDEhLQQYREVCAQ---RDAHQQKLAL-LQDECLALQAQIAAFTEQkehMQRLEKTKSQA 421
Cdd:pfam15921  704 AQSE-LEQTRNTLKSmegSDGHAMKVAMgMQKQITAKRGQIDALQSK---IQFLEEAMTNA 760
PRK10929 PRK10929
putative mechanosensitive channel protein; Provisional
127-354 1.29e-04

putative mechanosensitive channel protein; Provisional


Pssm-ID: 236798 [Multi-domain]  Cd Length: 1109  Bit Score: 45.43  E-value: 1.29e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  127 QRIIQENERLkqelLEKSSRIEEQNDK---ISDLIerNQRYVEQSnlmmEKRNnSLQTATENTQAKVTEELAAATAQVSH 203
Cdd:PRK10929   109 QEILQVSSQL----LEKSRQAQQEQDRareISDSL--SQLPQQQT----EARR-QLNEIERRLQTLGTPNTPLAQAQLTA 177
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  204 LQLKMTAHQKKETELQL-QLTDNLKE------TDLLRGHVTRLQADLSELReaseqTQTKFKSEKQSRRQLElKVTSLEE 276
Cdd:PRK10929   178 LQAESAALKALVDELELaQLSANNRQelarlrSELAKKRSQQLDAYLQALR-----NQLNSQRQREAERALE-STELLAE 251
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  277 ELTDLRAEKTS-LEKN--LSERKKKSAQercqaeaEMDEIrKSHQEeldrlrqllkkarvstdQAAAEQLTLAQA----E 349
Cdd:PRK10929   252 QSGDLPKSIVAqFKINreLSQALNQQAQ-------RMDLI-ASQQR-----------------QAASQTLQVRQAlntlR 306

                   ....*
gi 1720409153  350 LQSQW 354
Cdd:PRK10929   307 EQSQW 311
MscS_porin pfam12795
Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part ...
210-403 1.64e-04

Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part of the turgor-driven solute efflux system that protects bacteria from lysis in the event of osmotic shock. The MscS protein alone is sufficient to form a functional mechanosensitive channel gated directly by tension in the lipid bilayer. The MscS proteins are heptamers of three transmembrane subunits with seven converging M3 domains, and this MscS_porin is towards the N-terminal of the molecules. The high concentration of negative charges at the extracellular entrance of the pore helps select the cations for efflux.


Pssm-ID: 403869 [Multi-domain]  Cd Length: 235  Bit Score: 43.82  E-value: 1.64e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 210 AHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSElreaseqtQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLE 289
Cdd:pfam12795  34 KSKQRAAQYQKALDDAPAELRELRQELAALQAKAEA--------APKEILASLSLEELEQRLLQTSSQLQELQEQLAQLN 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 290 KNLSERKKKSAQercqAEAEMDEIRkshqEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQW----EAKCEQLLASA 365
Cdd:pfam12795 106 SQLIELQTRPER----AQQQLSEAR----QRLQQIRNQLNGLAAAGEPLSEAQRWLLQAELAALKaqidMLEQELLSNNN 177
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 1720409153 366 RDEHLQqyrevcAQRDAHQQKLALLQDECLALQAQIAA 403
Cdd:pfam12795 178 RQDLLQ------AQRDLLTLRIARLEQQLQALQELLNE 209
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
124-332 1.65e-04

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 45.05  E-value: 1.65e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 124 SNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSlQTATENTQAKVTEELAAAtaqvsh 203
Cdd:PRK03918  324 NGIEERIKELEEKEERLEELKKKLKELEKRLEELEERHELYEEAKAKKEELERLK-KRLTGLTPEKLEKELEEL------ 396
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 204 lqlkmtahQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTkfksekqSRRQLElkvtslEEELTDLRA 283
Cdd:PRK03918  397 --------EKAKEEIEEEISKITARIGELKKEIKELKKAIEELKKAKGKCPV-------CGRELT------EEHRKELLE 455
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1720409153 284 EKTSLEKNLSERKKKSAQERCQAEAEMDEIRK--SHQEELDRLRQLLKKAR 332
Cdd:PRK03918  456 EYTAELKRIEKELKEIEEKERKLRKELRELEKvlKKESELIKLKELAEQLK 506
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
212-502 2.10e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 45.06  E-value: 2.10e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  212 QKKETELQLQLTDNLKETDLLRGHVTRLQadlSELREASEQTqtkfkSEKQSRRQ-LELKVTSLEEELTDL--------- 281
Cdd:TIGR02169  680 RERLEGLKRELSSLQSELRRIENRLDELS---QELSDASRKI-----GEIEKEIEqLEQEEEKLKERLEELeedlssleq 751
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  282 -----RAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEqltlAQAELQSqwEA 356
Cdd:TIGR02169  752 eienvKSELKELEARIEELEEDLHKLEEALNDLEARLSHSRIPEIQAELSKLEEEVSRIEARLRE----IEQKLNR--LT 825
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  357 KCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAaftEQKEHMQRLEKTKSqapagraaaDPSEKVKK 436
Cdd:TIGR02169  826 LEKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELE---ELEAALRDLESRLG---------DLKKERDE 893
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720409153  437 IMNQVFQSLRGEFELEESYDggtILRTIMHTIKmVTLQLLNHQEEEEEEEEEEEEEKKPLRPSLEQ 502
Cdd:TIGR02169  894 LEAQLRELERKIEELEAQIE---KKRKRLSELK-AKLEALEEELSEIEDPKGEDEEIPEEELSLED 955
EmrA COG1566
Multidrug resistance efflux pump [Defense mechanisms];
305-424 2.27e-04

Multidrug resistance efflux pump [Defense mechanisms];


Pssm-ID: 224482 [Multi-domain]  Cd Length: 352  Bit Score: 44.24  E-value: 2.27e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 305 QAEAEMDEIRKshqeELDRLRQLLKKARVSTDQAAAEQLTLAQAELQ-----SQWEAKCEQLLASARDEHLQQYREVCAQ 379
Cdd:COG1566    95 QAEAALAAAEA----QLRNLRAQLASAQALIAQAEAQDLDQAQNELErraelAQRGVVSREELDRARAALQAAEAALAAA 170
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 1720409153 380 RDAHQQKLALLQDECLALQAQIAAFTEQKEHMQR-LEKTKSQAPAG 424
Cdd:COG1566   171 QAAQKQNLALLESEVSGAQAQVASAEAALDQAKLdLERTVIRAPVD 216
COG5022 COG5022
Myosin heavy chain [General function prediction only];
82-285 2.52e-04

Myosin heavy chain [General function prediction only];


Pssm-ID: 227355 [Multi-domain]  Cd Length: 1463  Bit Score: 44.68  E-value: 2.52e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153   82 VNKVADKMDHLMTKVEELQKHSSGNSML---LPSMSVTMETSM---IMSNIQRIIQ-ENERLKQELLEKSSRIEEQNDKI 154
Cdd:COG5022    894 ISSLKLVNLELESEIIELKKSLSSDLIEnleFKTELIARLKKLlnnIDLEEGPSIEyVKLPELNKLHEVESKLKETSEEY 973
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  155 SDLIERNQRYVEQSNLMMEKRNNSLQTATEntQAKVTEELAAATAQVSHLQLKMTAHQK--------KETELQLQLTDNL 226
Cdd:COG5022    974 EDLLKKSTILVREGNKANSELKNFKKELAE--LSKQYGALQESTKQLKELPVEVAELQSaskiisseSTELSILKPLQKL 1051
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 1720409153  227 KETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEK 285
Cdd:COG5022   1052 KGLLLLENNQLQARYKALKLRRENSLLDDKQLYQLESTENLLKTINVKDLEVTNRNLVK 1110
46 PHA02562
endonuclease subunit; Provisional
70-298 2.79e-04

endonuclease subunit; Provisional


Pssm-ID: 222878 [Multi-domain]  Cd Length: 562  Bit Score: 44.23  E-value: 2.79e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  70 EARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMetsmiMSNIQRIIQENERLKQELLEKSSRIEE 149
Cdd:PHA02562  178 ELNQQIQTLDMKIDHIQQQIKTYNKNIEEQRKKNGENIARKQNKYDEL-----VEEAKTIKAEIEELTDELLNLVMDIED 252
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 150 QNDKISDLierNQRYVEQSNLM--------MEKRNNSLQTATEN---TQAKVTEelaaATAQVSHLQLKMTA---HQKKE 215
Cdd:PHA02562  253 PSAALNKL---NTAAAKIKSKIeqfqkvikMYEKGGVCPTCTQQiseGPDRITK----IKDKLKELQHSLEKldtAIDEL 325
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 216 TELQLQLTDNLKEtdllrghVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSER 295
Cdd:PHA02562  326 EEIMDEFNEQSKK-------LLELKNKISTNKQSLITLVDKAKKVKAAIEELQAEFVDNAEELAKLQDELDKIVKTKSEL 398

                  ...
gi 1720409153 296 KKK 298
Cdd:PHA02562  399 VKE 401
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
188-420 3.16e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 44.29  E-value: 3.16e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  188 AKVTEELAAATAQVSHLQLKmtahqkkETELQLQLtDNLKETdllRGHVTRLQADLSELR--EASEQTQTKFKSEKQsRR 265
Cdd:TIGR02169  173 EKALEELEEVEENIERLDLI-------IDEKRQQL-ERLRRE---REKAERYQALLKEKReyEGYELLKEKEALERQ-KE 240
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  266 QLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTL 345
Cdd:TIGR02169  241 AIERQLASLEEELEKLTEEISELEKRLEEIEQLLEELNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKERELEDA 320
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  346 A--QAELQSQWEAKCEQLLASARDehLQQYRevcAQRDAHQQKLALLQDECLALQAQI--------AAFTEQKEHMQRLE 415
Cdd:TIGR02169  321 EerLAKLEAEIDKLLAEIEELERE--IEEER---KRRDKLTEEYAELKEELEDLRAELeevdkefaETRDELKDYREKLE 395

                   ....*
gi 1720409153  416 KTKSQ 420
Cdd:TIGR02169  396 KLKRE 400
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
216-409 3.25e-04

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 44.36  E-value: 3.25e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  216 TELQLQLTDNLKETDLLRG---HVTRLQADLS-----ELREASEQTQTKFKSEKQsrrqlelKVTSLEEELTDLRAEKTS 287
Cdd:pfam12128  562 TDLDPELVESSSQELNLYGvtlDLQRIDAPDYaaleeALRERLDQAEKALQAARD-------KQKAAEEQLVQLNKELEK 634
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  288 LEKNLSERKkksaQERCQAEAEMDEIRKSHQEELDRLRQLLKKARvstdQAAAEQLTLAQAEL------QSQWEAKCEQL 361
Cdd:pfam12128  635 LKREETEAA----RALKQARLTLGRLQDEKQSLKDKLQKALKARK----QQAETQLQTLDAQLkqllkkQQAALEEQKEQ 706
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*...
gi 1720409153  362 LASARDEHLQQYREVCAQRDAhqqKLALLQDECLALQAQIAAFTEQKE 409
Cdd:pfam12128  707 LRELRTEKQEKWQVVVGDLDA---QLALLSAAIAALRTQAKAQLKALE 751
mukB PRK04863
chromosome partition protein MukB;
192-432 4.27e-04

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 43.79  E-value: 4.27e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  192 EELAAATAQVSHLQLKMTAHQKKETELQLQLtDNLKET-DLLRGHVTR--------LQADLSELREASEQTQTKFKSEKQ 262
Cdd:PRK04863   837 AELRQLNRRRVELERALADHESQEQQQRSQL-EQAKEGlSALNRLLPRlnlladetLADRVEEIREQLDEAEEAKRFVQQ 915
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  263 SRRQLELkvtsLEEELTDLRAEktsleknlserkkksaqercqaEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAA--- 339
Cdd:PRK04863   916 HGNALAQ----LEPIVSVLQSD----------------------PEQFEQLKQDYQQAQQTQRDAKQQAFALTEVVQrra 969
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  340 ------AEQLTLAQAELQSQWEAKCEQlLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFteqkehMQR 413
Cdd:PRK04863   970 hfsyedAAEMLAKNSDLNEKLRQRLEQ-AEQERTRAREQLRQAQAQLAQYNQVLASLKSSYDAKRQMLQEL------KQE 1042
                          250       260
                   ....*....|....*....|..
gi 1720409153  414 LEKTKSQAPAG---RAAADPSE 432
Cdd:PRK04863  1043 LQDLGVPADSGaeeRARARRDE 1064
COG4913 COG4913
Uncharacterized protein, contains a C-terminal ATPase domain [Function unknown];
197-392 5.37e-04

Uncharacterized protein, contains a C-terminal ATPase domain [Function unknown];


Pssm-ID: 227250 [Multi-domain]  Cd Length: 1104  Bit Score: 43.47  E-value: 5.37e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  197 ATAQVSHLQLKMTAHQKKET-ELQLQLTDNLkeTDLLRGHVTRLQA--DLSELREASEQTQTKFKSEKQSRR-------- 265
Cdd:COG4913    234 AKTAVEQFQDLEGAYEQVEDiKRQIHTLDPL--VQLKNRREKAQQSkdHANALKKALPTVGNRIKKEEQETLvrqftveq 311
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  266 -QLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLT 344
Cdd:COG4913    312 tQAKSKVESAKIETDRAREMETLAHDNVKQIVGAQHGILSAKREGAVDKRRTISTARAGLDALVKGLGGAAPESAEELLE 391
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*...
gi 1720409153  345 LAQAELQSqweakCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQD 392
Cdd:COG4913    392 LNNAARLT-----VDEYPAAREALESAGQRNVEDRTRAVDEFKAADQE 434
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
194-432 5.43e-04

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 43.17  E-value: 5.43e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 194 LAAATAQVSHLQLKMTAHQKKETELQLQLTDnlKETDLLRGHVTRLQADLSELREASEQTQTKfksEKQSRRQLELKVTS 273
Cdd:COG4942    28 AAAFSAAADDKQLKQIQKEIAALEKKIREQQ--DQRAKLEKQLKSLETEIASLEAQLIETADD---LKKLRKQIADLNAR 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 274 LEEELTDLRAEKTSLEKNLSERKK-------------KSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAA 340
Cdd:COG4942   103 LNALEVQEREQRRRLAEQLAALQRsgrnpppallvspEDAQRSVRLAIYYGALNPARAERIDALKATLKQLAAVRAEIAA 182
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 341 EQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRevcAQRDAHQQKLALLQDECLALQAQIAafteqkehmqRLEKTKSQ 420
Cdd:COG4942   183 EQAELTTLLSEQRAQQAKLAQLLEERKKTLAQLN---SELSADQKKLEELRANESRLKNEIA----------SAEAAAAK 249
                         250
                  ....*....|..
gi 1720409153 421 APAGRAAADPSE 432
Cdd:COG4942   250 AREAAAAAEAAA 261
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
56-414 5.43e-04

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 43.57  E-value: 5.43e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153   56 HFQGSGDMMSFLMteaRQHNTEIRMAVNKVADKMDHLmtkvEELQKHSSGNSMLLPSMSvtmetsmiMSNIQRIIQENER 135
Cdd:pfam15921  214 HFRSLGSAISKIL---RELDTEISYLKGRIFPVEDQL----EALKSESQNKIELLLQQH--------QDRIEQLISEHEV 278
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  136 LKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKE 215
Cdd:pfam15921  279 EITGLTEKASSARSQANSIQSQLEIIQEQARNQNSMYMRQLSDLESTVSQLRSELREAKRMYEDKIEELEKQLVLANSEL 358
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  216 TELQLQLTDNLKETDLLRGHVTRLQADL----SELREASEQTQTKFKSEKQS-------RRQLE---LKVTSLEEELTDL 281
Cdd:pfam15921  359 TEARTERDQFSQESGNLDDQLQKLLADLhkreKELSLEKEQNKRLWDRDTGNsitidhlRRELDdrnMEVQRLEALLKAM 438
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  282 RAE-KTSLEKNLS--ERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQllKKARVSTDQAAAEQLTLAQAELQSQWEAKC 358
Cdd:pfam15921  439 KSEcQGQMERQMAaiQGKNESLEKVSSLTAQLESTKEMLRKVVEELTA--KKMTLESSERTVSDLTASLQEKERAIEATN 516
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1720409153  359 EQL--LASARDEHLQQYREVCAQRDAHQQklalLQDECLALQAQIAA-------FTEQKEHMQRL 414
Cdd:pfam15921  517 AEItkLRSRVDLKLQELQHLKNEGDHLRN----VQTECEALKLQMAEkdkvieiLRQQIENMTQL 577
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
191-429 6.00e-04

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 43.21  E-value: 6.00e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  191 TEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKE--------TDLLRGHVTRLQADLSELREASEQTQTKFKS-EK 261
Cdd:pfam12128  249 FEQLESLELKLSLLHVELKADELRIATEQEERQELKNElksqlrtlEDELAEKIDELNGRLSAADAALAAKRSELEAlDD 328
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  262 QSRRQLELKVTSLEEELTDLRAEKTSLEkNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAE 341
Cdd:pfam12128  329 QKGAFQDDDIETLAADQEQLPSIQSELE-EVEERLDALTGNHQDVTQKYERLKQKISEELNRDLSGNKERLAKIREAKDR 407
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  342 QLTLAQAELQ---SQWEAKCEQLLASARDEhlQQYREVCAQRDAHQQKLALLQDEclaLQAQIAAFTEQKEHMQR----L 414
Cdd:pfam12128  408 QLAAIEEVLQaleSQLRHQLEQQKLEFNEE--QYLLESRLGELKLQLNQATATPE---LLENIEQNDERLERAQEaqeqA 482
                          250
                   ....*....|....*
gi 1720409153  415 EKTKSQAPAGRAAAD 429
Cdd:pfam12128  483 NASVEAAQSELRQLR 497
Cast pfam10174
RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part ...
113-421 7.35e-04

RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion. The C-terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). The family also contains four coiled-coil domains.


Pssm-ID: 401982 [Multi-domain]  Cd Length: 765  Bit Score: 42.89  E-value: 7.35e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 113 MSVTMETSMIMSN-IQRIIQENERLKQELLEKSSRIEEQNDKISD-----------LIERNQRY------VEQSNLMMEK 174
Cdd:pfam10174 276 MEVYKSHSKFMKNkIDQLKQELSKKESELLALQTKLETLTNQNSDckqhievlkesLTAKEQRAailqteVDALRLRLEE 355
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 175 RNNSLQTATENTQaKVTEELAAATAQVSHLQ-------LKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQAD----- 242
Cdd:pfam10174 356 KESFLNKKTKQLQ-DLTEEKSTLAGEIRDLKdmldvkeRKINVLQKKIENLQEQLRDKDKQLAGLKERVKSLQTDssntd 434
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 243 ---------LSE-------LREASEQTQTKFKSEKQSRRQlELKVtsLEEELTDLRAEKTSLEKNLSERKKKsAQERCQA 306
Cdd:pfam10174 435 talttleeaLSEkeriierLKEQREREDRERLEELESLKK-ENKD--LKEKVSALQPELTEKESSLIDLKEH-ASSLASS 510
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 307 EAEMDEIRKS-------HQEELDRLRQLLKKARVSTDQAAA-----EQLTLAQAELQSQWE--AKCEqllaSARDEHLQQ 372
Cdd:pfam10174 511 GLKKDSKLKSleiaieqKKEECSKLENQLKKAHNAEEAVRTnpeinDRIRLLEQEVARYKEesGKAQ----AEVERLLGI 586
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*....
gi 1720409153 373 YREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQA 421
Cdd:pfam10174 587 LREVENEKNDKDKKIAELESLTLRQMKEQNKKVANIKHKQQEEKKKGAQ 635
PTZ00121 PTZ00121
MAEBL; Provisional
132-436 7.63e-04

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 43.21  E-value: 7.63e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  132 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATEntqAKVTEELAAATAQVSHLQLKMTAH 211
Cdd:PTZ00121  1480 EEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEAKKADEAKKAEE---AKKADEAKKAEEKKKADELKKAEE 1556
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  212 QKKETELQLQLTDNLKETDllRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKvtslEEELTDLRAEKtsLEKN 291
Cdd:PTZ00121  1557 LKKAEEKKKAEEAKKAEED--KNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAK----KAEEAKIKAEE--LKKA 1628
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  292 LSERKKKSAQERCQAEA--EMDEIRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEH 369
Cdd:PTZ00121  1629 EEEKKKVEQLKKKEAEEkkKAEELKKAEEENKIKAAEEAKKAE--EDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKAEE 1706
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720409153  370 LQQYREVcAQRDAHQQKLAllqDECLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADPSEKVKK 436
Cdd:PTZ00121  1707 LKKKEAE-EKKKAEELKKA---EEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKK 1769
COG5281 COG5281
Phage-related minor tail protein [Mobilome: prophages, transposons];
130-408 9.44e-04

Phage-related minor tail protein [Mobilome: prophages, transposons];


Pssm-ID: 227606 [Multi-domain]  Cd Length: 833  Bit Score: 42.70  E-value: 9.44e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 130 IQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVteELAAATAQVSHLQLKMT 209
Cdd:COG5281   285 QLEQIAALQRAGDTAAAAAAAAEAAAAMDDRTARVKENMGTLETAWDALADAAKKMWDAVL--GIGREDKQAALLAAKLA 362
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 210 AHQKKETELQLQLTDNLKetdLLRGHVTRLQADLSELREASEQTQTKFK--SEKQSRRQLELKVTSLEEELTDLRAEKTS 287
Cdd:COG5281   363 AEKLARVTAQGALNARLK---LAQDDLTQAELNYAAADQAANQEGALNAreDEAEVLSTQEERRDILKNLLADAEKRTAR 439
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 288 LEKnLSERKKKSAQERCQAEAEMDEIRKSHQEELDRlrQLLKKARVSTDQAAAEQLTLA--------------QAELQSQ 353
Cdd:COG5281   440 QEE-LNKALAKAKILQADKAAKAYQEDILQREAQSR--GKTAAAERSQEQMTAALKALLafqqqiadlsgakeKASDQKS 516
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 1720409153 354 WEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK 408
Cdd:COG5281   517 LLWKAEEQYALLKEEAKQRQLQEQKALLEHKKETLEYTSQLAELLDQQADRFELS 571
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
154-359 1.02e-03

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 42.47  E-value: 1.02e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  154 ISDLIERNQRYvEQSNLMMEKRNNSLQTATENTQakvtEELAAATAQVSHLQLKMtahQKKETELQLQLTDNLKET---D 230
Cdd:pfam01576  189 ISDLEDRLKKE-EKGRQELEKAKRKLDGESTDLQ----EQIAELQAQIEELRAQL---AKKEEELQAALARLEEEGaqkN 260
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  231 LLRGHVTRLQADLSELREASEQT-QTKFKSEKQSR---RQLELKVTSLEEELTDLRAE---KTSLEKNLSERKKKSAQER 303
Cdd:pfam01576  261 NALKKLRELQAQIAELQEDLESErAARAKAEKQRRdlgEELEALKTELEDTLDSTAAQqelRSKREQEVTELKKALEEET 340
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1720409153  304 CQAEAEMDEIRKSHQEELDRLRQLLKKARVS------TDQAAAEQLTLAQAELQSQWEAKCE 359
Cdd:pfam01576  341 RSHEAQLQEMRQKHTQALEELSEQLEQAKRNkanlekAKQALESENNELQAELKTLQQAKQD 402
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
126-314 1.09e-03

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 42.31  E-value: 1.09e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 126 IQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRN--NSLQTATENTQAKVTEELaaataqvsh 203
Cdd:TIGR04523 477 INKIKQNLEQKQKELKSKEKELKKLNEEKKELEEKVKDLTKKISSLKEKIEklESEKKEKESKISDLEDEL--------- 547
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 204 lqLKMTAHQKKEtELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRA 283
Cdd:TIGR04523 548 --NKDDFELKKE-NLEKEIDEKNKEIEELKQTQKSLKKKQEEKQELIDQKEKEKKDLIKEIEEKEKKISSLEKELEKAKK 624
                         170       180       190
                  ....*....|....*....|....*....|....
gi 1720409153 284 EKTSLE---KNLSERKKKSAQERCQAEAEMDEIR 314
Cdd:TIGR04523 625 ENEKLSsiiKNIKSKKNKLKQEVKQIKETIKEIR 658
PRK04778 PRK04778
septation ring formation regulator EzrA; Provisional
230-421 1.49e-03

septation ring formation regulator EzrA; Provisional


Pssm-ID: 179877 [Multi-domain]  Cd Length: 569  Bit Score: 41.75  E-value: 1.49e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 230 DLLRGHVTRLQADLSELREASEQTQTKFKSE----KQSRRQLE-----LKVTSLEEELTDLRAEKTSLEKNLSERKKKSA 300
Cdd:PRK04778  201 DQLEEELAALEQIMEEIPELLKELQTELPDQlqelKAGYRELVeegyhLDHLDIEKEIQDLKEQIDENLALLEELDLDEA 280
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 301 QERCQA-EAEMDEI----------RKSHQEELDRLRQLLKKARVSTDQAAAE--------QLTLAQAELQSQWEAKCEQL 361
Cdd:PRK04778  281 EEKNEEiQERIDQLydilerevkaRKYVEKNSDTLPDFLEHAKEQNKELKEEidrvkqsyTLNESELESVRQLEKQLESL 360
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1720409153 362 LAsardehlqQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQ----KEHMQRLEKTKSQA 421
Cdd:PRK04778  361 EK--------QYDEITERIAEQEIAYSELQEELEEILKQLEEIEKEqeklSEMLQGLRKDELEA 416
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
131-367 1.59e-03

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 42.08  E-value: 1.59e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  131 QENERLKQELLEKSSRIEEQNDKISDLIERnqryVEQSNLMMEKRNNSLQTATENTQAKVTEElaaaTAQVSHLQLKMTA 210
Cdd:pfam01576  422 SESERQRAELAEKLSKLQSELESVSGLLSE----AEGKSIKLSKDVSSLESQLQDTQELLQEE----TRQKLNLSSRLRQ 493
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  211 HQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR----------EASEQTQTKFKSEKQSRRQ-----------LEL 269
Cdd:pfam01576  494 LEDERNSLQEQLEEEEEAKRNVERQLSTLQAQLSEMKkkleedagavEALEEAKKRLQRELEALTQrleekaaaydkLEK 573
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  270 KVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLL--KKARVSTDQAAAEQLTLAQ 347
Cdd:pfam01576  574 TKNRLQQELDDLLVDLDHQRQLVSNLEKKQKKFD-QMLAEEKAISARYAEERDRAEAEAreKETRALSLSRALEEALEAK 652
                          250       260
                   ....*....|....*....|...
gi 1720409153  348 AELQ---SQWEAKCEQLLASARD 367
Cdd:pfam01576  653 EELErqnKQLRAEMEDLVSSKDD 675
EzrA COG4477
Septation ring formation regulator EzrA [Cell cycle control, cell division, chromosome ...
128-333 1.65e-03

Septation ring formation regulator EzrA [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 226883 [Multi-domain]  Cd Length: 570  Bit Score: 41.59  E-value: 1.65e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 128 RIIQENERLKQELLEKS-SRIEEQNDKISDLIERNQ--RYVEQSNLMMEKRNNSLQTATENTQAK--VTEELAAATAQVS 202
Cdd:COG4477   240 DMKEEGYHLEHVNIDSRlERLKEQLVENSELLTQLEldEAEEELGLIQEKIESLYDLLEREVEAKnvVEENLPILPDYLE 319
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 203 HLQlKMTAHQKKETELqLQLTDNLKETDLlrGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLR 282
Cdd:COG4477   320 KAK-ENNEHLKEEIER-VKESYRLAETEL--GSVRKFEKELKELESVLDEILENIEAQEVAYSELQDNLEEIEKALTDIE 395
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1720409153 283 AEKTSLEKNLSERKKKSAQERcqaeaemdEIRKSHQEELDRLRQLLKKARV 333
Cdd:COG4477   396 DEQEKVQEHLTSLRKDELEAR--------ENLERLKSKLHEIKRYMEKSNL 438
YhaN COG4717
Uncharacterized protein YhaN, contains AAA domain [Function unknown];
129-391 2.06e-03

Uncharacterized protein YhaN, contains AAA domain [Function unknown];


Pssm-ID: 227061 [Multi-domain]  Cd Length: 984  Bit Score: 41.75  E-value: 2.06e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 129 IIQENERLKQELLEkSSRIEEQNDKIS---DLIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQ 205
Cdd:COG4717   538 ITDELPELAVDLLV-QSRIRQHWQQLRkalDQLEAAYEALEGRFAAAEAAMAEWQSEWEEALDELGLSRELSPEQQLDIL 616
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 206 LKMTAH---QKKETELQLQLTDNLKETDLLRGHVTRL----QADLSELREASEQTQTKFKSEKQS---RRQLELKVTSLE 275
Cdd:COG4717   617 STMKDLkklMQKKAELTHQVARLREEQAAFEERVEGLlavlEAQFIDLSTLFCVQRLRVAAELQKeeaRLALEGNIERTK 696
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 276 EELTDLRAEktsLEKNlseRKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLKKARVSTDQ---AAAEQLTLAQAELQS 352
Cdd:COG4717   697 ELNDELRAE---LELH---RKEILDLFDCGTADTEDAFREAAREE-QQLTQRESRLESLEAQlegVAAEAYELSASLDQR 769
                         250       260       270
                  ....*....|....*....|....*....|....*....
gi 1720409153 353 QWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQ 391
Cdd:COG4717   770 ELKEEELALLEEAIDALDEEVEELHAQVAALSRQIAQLE 808
YqiK COG2268
Uncharacterized membrane protein YqiK, contains Band7/PHB/SPFH domain [Function unknown];
265-468 4.04e-03

Uncharacterized membrane protein YqiK, contains Band7/PHB/SPFH domain [Function unknown];


Pssm-ID: 225177 [Multi-domain]  Cd Length: 548  Bit Score: 40.59  E-value: 4.04e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 265 RQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLK-----KARVSTDQAA 339
Cdd:COG2268   248 VELEVEQQPAGKTAEQTREVKIILAETEAEVAAWKAETRREAEQAEILAEQAIQEEKAQAEQEVQhakalEAREMRVGLI 327
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 340 AEQ-------------LTLAQAELQSQWEAKCEQLLASA--RDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAF 404
Cdd:COG2268   328 ERQketelepqersyfINAAQRQAQEEAKAAANIAEAIGaqAEAAVETARETEEAERAEQAALVAAAEAAEQEQVEIAVR 407
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720409153 405 TEQKEHMQRLEKT--KSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFELEESYDGGTILRTIMHTI 468
Cdd:COG2268   408 AEAAKAEAEAQAAeiKAEAEAIREKGKAEAEAKRALAEAIQVLGDAAAAELFKALVQALPEVAEEA 473
tolA PRK09510
cell envelope integrity inner membrane protein TolA; Provisional
240-428 4.07e-03

cell envelope integrity inner membrane protein TolA; Provisional


Pssm-ID: 236545 [Multi-domain]  Cd Length: 387  Bit Score: 40.17  E-value: 4.07e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 240 QADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEmdEIRKSHQE 319
Cdd:PRK09510   74 AKRAEEQRKKKEQQQAEELQQKQAAEQERLKQLEKERLAAQEQKKQAEEAAKQAALKQKQAEEAAAKAAA--AAKAKAEA 151
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 320 ELDRLRQLLKKARVSTD-QAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLAllqdecLALQ 398
Cdd:PRK09510  152 EAKRAAAAAKKAAAEAKkKAEAEAAKKAAAEAKKKAEAEAAAKAAAEAKKKAEAEAKKKAAAEAKKKAAA------EAKA 225
                         170       180       190
                  ....*....|....*....|....*....|
gi 1720409153 399 AQIAAFTEQKEHMQRLEKTKSQAPAGRAAA 428
Cdd:PRK09510  226 AAAKAAAEAKAAAEKAAAAKAAEKAAAAKA 255
MscK COG3264
Small-conductance mechanosensitive channel [Cell wall/membrane/envelope biogenesis];
171-427 4.25e-03

Small-conductance mechanosensitive channel [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 225803 [Multi-domain]  Cd Length: 835  Bit Score: 40.44  E-value: 4.25e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 171 MMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETdllrghVTRLQADLSELREAS 250
Cdd:COG3264     1 LALAGNNVLQELLQSRRELLTAESAQLEAALQLLQEAVNSKRQEEAEPAAEEAELQAEL------IQQELAINDQLSQAL 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 251 EQTQTKFKSEKQSRRQL-ELKVtSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLlk 329
Cdd:COG3264    75 NQQTERLNALASDDRQLaNLLL-QLLQSSRTIREQIAVLRGSLLLSRILLQQLGPLPEAGQPQEQFEVTQERDALQAE-- 151
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 330 KARVSTDQAAAEQLTLAQAE-LQSQWEAKCEQLlasarDEHLQQYREVcaqrdahqqKLALLQDECLALQAQIAAFTEQK 408
Cdd:COG3264   152 KAYINALEGQAEQLTAEVRDiLDQILDTRRELL-----NSLLSQREAI---------SLQLNQQQLSAASDELRSLLHQQ 217
                         250
                  ....*....|....*....
gi 1720409153 409 EHMQRLEKTKSQAPAGRAA 427
Cdd:COG3264   218 SFWVSFAWPKAFPQALRAL 236
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
507-750 5.09e-03

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 40.54  E-value: 5.09e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  507 TPGMPPAPPSGETQEAP--EVLPEQVVGETTPLPLQALPT--PENGAQTRKGEPAEAEVPSEIKDSSLPPQPAGIPAHRV 582
Cdd:PHA03307    64 RFEPPTGPPPGPGTEAPanESRSTPTWSLSTLAPASPAREgsPTPPGPSSPDPPPPTPPPASPPPSPAPDLSEMLRPVGS 143
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  583 LGPPTSIPPKPPGpvtmdsESEEMLAADQRTVQPNGLL---GEEHVRevatdgllqgnsrrlsltPDPEKGEPPALDPES 659
Cdd:PHA03307   144 PGPPPAASPPAAG------ASPAAVASDAASSRQAALPlssPEETAR------------------APSSPPAEPPPSTPP 199
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  660 QGGEAQPPECKQAEDVSSSGPRETLLDTELASAAAGTSLRHNQDSQHCSLSGDEEdelfkgATLKVPRPTAQPEEEDEDE 739
Cdd:PHA03307   200 AAASPRPPRRSSPISASASSPAPAPGRSAADDAGASSSDSSSSESSGCGWGPENE------CPLPRPAPITLPTRIWEAS 273
                          250
                   ....*....|.
gi 1720409153  740 VSMKGRPPPTP 750
Cdd:PHA03307   274 GWNGPSSRPGP 284
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
130-399 5.25e-03

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 40.41  E-value: 5.25e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 130 IQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQsnlmmEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMT 209
Cdd:PRK02224  470 IEEDRERVEELEAELEDLEEEVEEVEERLERAEDLVEA-----EDRIERLEERREDLEELIAERRETIEEKRERAEELRE 544
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 210 AHQKKETELQLQltdnlketdllrghvtrlQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLeEELTDLRAEKTSLE 289
Cdd:PRK02224  545 RAAELEAEAEEK------------------REAAAEAEEEAEEAREEVAELNSKLAELKERIESL-ERIRTLLAAIADAE 605
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 290 KNLSERkkksaQERCQAEAEMDEIRKSHQEEL-DRLRQL---LKKARVSTDQAAAEQLTLAQAELQSQWEAKCEQ---LL 362
Cdd:PRK02224  606 DEIERL-----REKREALAELNDERRERLAEKrERKRELeaeFDEARIEEAREDKERAEEYLEQVEEKLDELREErddLQ 680
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|..
gi 1720409153 363 AS-----ARDEHLQQYREVCAQRDAHQQKLALLQDECLALQA 399
Cdd:PRK02224  681 AEigaveNELEELEELRERREALENRVEALEALYDEAEELES 722
PRK00106 PRK00106
ribonuclease Y;
245-349 5.41e-03

ribonuclease Y;


Pssm-ID: 178867 [Multi-domain]  Cd Length: 535  Bit Score: 39.85  E-value: 5.41e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 245 ELREASEQTQTKFKSEKQSRRQLELKVTSLEEELtDLRAEKTSLEKNLSERKKKSAQERC----QAEAEMDEIRKSHQEE 320
Cdd:PRK00106   80 EARKYREEIEQEFKSERQELKQIESRLTERATSL-DRKDENLSSKEKTLESKEQSLTDKSkhidEREEQVEKLEEQKKAE 158
                          90       100
                  ....*....|....*....|....*....
gi 1720409153 321 LDRLRQLlkkarvstDQAAAEQLTLAQAE 349
Cdd:PRK00106  159 LERVAAL--------SQAEAREIILAETE 179
GAS pfam13851
Growth-arrest specific micro-tubule binding; This family is the highly conserved central ...
207-352 5.70e-03

Growth-arrest specific micro-tubule binding; This family is the highly conserved central region of a number of metazoan proteins referred to as growth-arrest proteins. In mouse, Gas8 is predominantly a testicular protein, whose expression is developmentally regulated during puberty and spermatogenesis. In humans, it is absent in infertile males who lack the ability to generate gametes. The localization of Gas8 in the motility apparatus of post-meiotic gametocytes and mature spermatozoa, together with the detection of Gas8 also in cilia at the apical surfaces of epithelial cells lining the pulmonary bronchi and Fallopian tubes suggests that the Gas8 protein may have a role in the functioning of motile cellular appendages. Gas8 is a microtubule-binding protein localized to regions of dynein regulation in mammalian cells.


Pssm-ID: 404693 [Multi-domain]  Cd Length: 200  Bit Score: 38.74  E-value: 5.70e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 207 KMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQtqtkFKSEKQSRRQLELKVTSLEEELTDLRAEKt 286
Cdd:pfam13851  34 EIAELKKKEERNEKLMSEIQQENKRLTEPLQKAQEEVEELRKQLEN----YEKDKQSLKNLKARLKVLEKELKDLKWEH- 108
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720409153 287 sleKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKaRVstdQAAAEQLTLAQAELQS 352
Cdd:pfam13851 109 ---EVLEQRFEKVERERDELYDKFEAAIQDVQQKTGLKNLLLEK-KL---QALGETLEKKEAQLNE 167
COG5022 COG5022
Myosin heavy chain [General function prediction only];
213-448 5.72e-03

Myosin heavy chain [General function prediction only];


Pssm-ID: 227355 [Multi-domain]  Cd Length: 1463  Bit Score: 40.06  E-value: 5.72e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  213 KKETELQLQLTDNLKETDLLRGHVtrLQADLSElreaSEQTQTKFKSEKQS--RRQLELKVTSLEEELTDLRAEKTSLE- 289
Cdd:COG5022    823 QKTIKREKKLRETEEVEFSLKAEV--LIQKFGR----SLKAKKRFSLLKKEtiYLQSAQRVELAERQLQELKIDVKSISs 896
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  290 -KNLSERKKKSAQE-RCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQ---WEAKCEQL--L 362
Cdd:COG5022    897 lKLVNLELESEIIElKKSLSSDLIENLEFKTELIARLKKLLNNIDLEEGPSIEYVKLPELNKLHEVeskLKETSEEYedL 976
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  363 ASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQRLE---KTKSQAPAGRAAADPSEKVKKIMN 439
Cdd:COG5022    977 LKKSTILVREGNKANSELKNFKKELAELSKQYGALQESTKQLKELPVEVAELQsasKIISSESTELSILKPLQKLKGLLL 1056

                   ....*....
gi 1720409153  440 QVFQSLRGE 448
Cdd:COG5022   1057 LENNQLQAR 1065
BREX_BrxC NF033441
BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, ...
236-437 6.38e-03

BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, from BREX (bacteriophage exclusion) systems of type 1.


Pssm-ID: 380283  Cd Length: 1173  Bit Score: 39.87  E-value: 6.38e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  236 VTRLQADLSELREAS--EQTQTKFKSEKQSRRQLELKVTSLEEELT--------DLRAEKTSLEKNLSERKKKSAQErcq 305
Cdd:NF033441   928 LEPALALLEEILSIKdnEEFLKALNKKEDDLLDLIEDWEDVKSFFEgdqlpiwdRALRLLKEYEDNLDYELDEEAEE--- 1004
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  306 AEAEMDEIRKSH---------QEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSqwEAKCEQLLASARDEHLQQYREv 376
Cdd:NF033441  1005 AIEELRSILADPdpysripdlPPLLEALREALREALEELREAALEAIEEAKAELEA--DLEWQELSDEQQNRLLAPFDE- 1081
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1720409153  377 CAQRDAHQQKLALLQDecLALQAQIAAFTEQKEHMQRL--EKTKSQAPAGRAAADPSEKVKKI 437
Cdd:NF033441  1082 LKERIEPEVSIASLRA--LLDQLADALLDRLLDRIEALiqRFQEEKAEPEVKEAAAEPPEPKV 1142
CCDC154 pfam15450
Coiled-coil domain-containing protein 154; CCDC154 is an osteopetrosis-related protein that ...
137-356 6.92e-03

Coiled-coil domain-containing protein 154; CCDC154 is an osteopetrosis-related protein that suppresses cell proliferation by inducing G2/M arrest.


Pssm-ID: 406016 [Multi-domain]  Cd Length: 526  Bit Score: 39.81  E-value: 6.92e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 137 KQELLEKSSRiEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVSHLQLKMTahqKKET 216
Cdd:pfam15450 113 RKQALQDSER-KGASQEAALRLGKLTGMLKQEEQAREAACSSLQKSQEEASQKVDREVARMQAQGTKLGEEMS---LRFL 188
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 217 ELQLQLtdnlketdllRGHVTRLQADLSELREASEQTqtKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERK 296
Cdd:pfam15450 189 KREAKL----------CGFLQKSFLALEKRMKASESA--RLSLEGELREELERRWQLLQELAEERLRALEGQEEQEEEHL 256
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 297 KKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQWEA 356
Cdd:pfam15450 257 LEQCRGLDQAVVQLTKFVRQNQVSLNRVLLAEQKARDAKESLEEERAGELAEYLQENLEA 316
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
135-455 7.08e-03

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 39.95  E-value: 7.08e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  135 RLKQELLEKSsriEEQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQAKVTEELAAATAQVShlqlkmTAHQKK 214
Cdd:TIGR00618  153 EFAQFLKAKS---KEKKELLMNLFPLDQ--YTQLALMEFAKKKSLHGKAELLTLRSQLLTLCTPCMPD------TYHERK 221
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  215 ETelqlqLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLElKVTSLEEELtdlraEKTSLEKNLSE 294
Cdd:TIGR00618  222 QV-----LEKELKHLREALQQTQQSHAYLTQKREAQEEQLKKQQLLKQLRARIE-ELRAQEAVL-----EETQERINRAR 290
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  295 RKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTL-AQAELQSQWEAKCeqllasardEHLQQY 373
Cdd:TIGR00618  291 KAAPLAAHI-KAVTQIEQQAQRIHTELQSKMRSRAKLLMKRAAHVKQQSSIeEQRRLLQTLHSQE---------IHIRDA 360
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153  374 REVCAQRDAHQQKLALLQDECLALQAQIAAFTEQkehMQRLEKTKSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFELEE 453
Cdd:TIGR00618  361 HEVATSIREISCQQHTLTQHIHTLQQQKTTLTQK---LQSLCKELDILQREQATIDTRTSAFRDLQGQLAHAKKQQELQQ 437

                   ..
gi 1720409153  454 SY 455
Cdd:TIGR00618  438 RY 439
GumC COG3206
Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell wall/membrane ...
154-382 8.11e-03

Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 225747 [Multi-domain]  Cd Length: 458  Bit Score: 39.35  E-value: 8.11e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 154 ISDLIERNQRYVEQSNLMMEKRNNSLQtatentqakvtEELAAATAQVSH--LQLKMTAHQKKETELQLQLTDNLKETDL 231
Cdd:COG3206   182 LADQLEAQLEAFRRASDSLDERLEELR-----------ARLQEAEAQVEDfrAQHGLTDAARGQLLSEQQLSALNTQLQS 250
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720409153 232 lrghvTRLQADLSELREASEQTQTKFKSEKQSRRQlelkvTSLEEELTDLRAEKTSLEKNLSERKKKSA---QERCQAEA 308
Cdd:COG3206   251 -----ARARLAQAEARLASLLQLLPLGREAAALRE-----VLESPTIQDLRQQYAQVRQQIADLSTELGakhPQLVALEA 320
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1720409153 309 EMDEIRKSHQEELDRLRQLLKkarvsTDQAAAEQLtlaQAELQSQWEAKCEQLLASARDEhlQQYREvcAQRDA 382
Cdd:COG3206   321 QLAELRQQIAAELRQILASLP-----NELALLEQQ---EAALEKELAQLKGRLSKLPKLQ--VQLRE--LEREA 382
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH