NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1720409479|ref|XP_030109555|]
View 

SOSS complex subunit C isoform X1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SOSSC super family cl24483
SOSS complex subunit C; SOSS complex subunit C is a component of the SOSS complex, a ...
4-71 3.21e-18

SOSS complex subunit C; SOSS complex subunit C is a component of the SOSS complex, a single-stranded DNA binding complex involved in genomic stability, double-stranded break repair and ataxia telangiectasia-mutated-dependent signaling pathways.


The actual alignment was detected with superfamily member pfam15925:

Pssm-ID: 374228  Cd Length: 95  Bit Score: 71.47  E-value: 3.21e-18
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720409479  4 QSSTSHPGASISLSRPSLTKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRL 71
Cdd:pfam15925 28 SLATPSPLPQLPRSLPATATGPPDLAGNTSVSSIHKAALQHAHSTSFGFFIPQDSAFGNLILPVLPRF 95
 
Name Accession Description Interval E-value
SOSSC pfam15925
SOSS complex subunit C; SOSS complex subunit C is a component of the SOSS complex, a ...
4-71 3.21e-18

SOSS complex subunit C; SOSS complex subunit C is a component of the SOSS complex, a single-stranded DNA binding complex involved in genomic stability, double-stranded break repair and ataxia telangiectasia-mutated-dependent signaling pathways.


Pssm-ID: 374228  Cd Length: 95  Bit Score: 71.47  E-value: 3.21e-18
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720409479  4 QSSTSHPGASISLSRPSLTKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRL 71
Cdd:pfam15925 28 SLATPSPLPQLPRSLPATATGPPDLAGNTSVSSIHKAALQHAHSTSFGFFIPQDSAFGNLILPVLPRF 95
 
Name Accession Description Interval E-value
SOSSC pfam15925
SOSS complex subunit C; SOSS complex subunit C is a component of the SOSS complex, a ...
4-71 3.21e-18

SOSS complex subunit C; SOSS complex subunit C is a component of the SOSS complex, a single-stranded DNA binding complex involved in genomic stability, double-stranded break repair and ataxia telangiectasia-mutated-dependent signaling pathways.


Pssm-ID: 374228  Cd Length: 95  Bit Score: 71.47  E-value: 3.21e-18
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720409479  4 QSSTSHPGASISLSRPSLTKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRL 71
Cdd:pfam15925 28 SLATPSPLPQLPRSLPATATGPPDLAGNTSVSSIHKAALQHAHSTSFGFFIPQDSAFGNLILPVLPRF 95
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH