NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1720417364|ref|XP_030111099|]
View 

RAD51-associated protein 1 isoform X1 [Mus musculus]

Protein Classification

RAD51_interact domain-containing protein (domain architecture ID 13315168)

RAD51_interact domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
RAD51_interact pfam15696
RAD51 interacting motif; This motif interacts with RAD51.
193-231 6.01e-12

RAD51 interacting motif; This motif interacts with RAD51.


:

Pssm-ID: 406187  Cd Length: 39  Bit Score: 58.48  E-value: 6.01e-12
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1720417364 193 GSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSA 231
Cdd:pfam15696   1 GSSGSSSGILRGVPVKSPSQPLRLGLSRLARVKPLHPYL 39
PTZ00449 super family cl33186
104 kDa microneme/rhoptry antigen; Provisional
34-210 6.47e-04

104 kDa microneme/rhoptry antigen; Provisional


The actual alignment was detected with superfamily member PTZ00449:

Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 40.44  E-value: 6.47e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364  34 SPEDLDKITEEgDASSVEGERKSPSQAKAP-----------RRRAPSEGSDGSSANDTESESATGE-GSESDPdfdeske 101
Cdd:PTZ00449  492 SKKKLAPIEEE-DSDKHDEPPEGPEASGLPpkapgdkegeeGEHEDSKESDEPKEGGKPGETKEGEvGKKPGP------- 563
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364 102 sdedfgVRRSKESKKKTVQKKPAGEKKERKSK-PKCEASVTSVDPAPAAIKSGSPSLPQAVGLPseatRKPAIMCSPSAE 180
Cdd:PTZ00449  564 ------AKEHKPSKIPTLSKKPEFPKDPKHPKdPEEPKKPKRPRSAQRPTRPKSPKLPELLDIP----KSPKRPESPKSP 633
                         170       180       190
                  ....*....|....*....|....*....|
gi 1720417364 181 SKRPKWVPPAASGSRNSSSNALAGTPAKSP 210
Cdd:PTZ00449  634 KRPPPPQRPSSPERPEGPKIIKSPKPPKSP 663
 
Name Accession Description Interval E-value
RAD51_interact pfam15696
RAD51 interacting motif; This motif interacts with RAD51.
193-231 6.01e-12

RAD51 interacting motif; This motif interacts with RAD51.


Pssm-ID: 406187  Cd Length: 39  Bit Score: 58.48  E-value: 6.01e-12
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1720417364 193 GSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSA 231
Cdd:pfam15696   1 GSSGSSSGILRGVPVKSPSQPLRLGLSRLARVKPLHPYL 39
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
34-210 6.47e-04

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 40.44  E-value: 6.47e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364  34 SPEDLDKITEEgDASSVEGERKSPSQAKAP-----------RRRAPSEGSDGSSANDTESESATGE-GSESDPdfdeske 101
Cdd:PTZ00449  492 SKKKLAPIEEE-DSDKHDEPPEGPEASGLPpkapgdkegeeGEHEDSKESDEPKEGGKPGETKEGEvGKKPGP------- 563
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364 102 sdedfgVRRSKESKKKTVQKKPAGEKKERKSK-PKCEASVTSVDPAPAAIKSGSPSLPQAVGLPseatRKPAIMCSPSAE 180
Cdd:PTZ00449  564 ------AKEHKPSKIPTLSKKPEFPKDPKHPKdPEEPKKPKRPRSAQRPTRPKSPKLPELLDIP----KSPKRPESPKSP 633
                         170       180       190
                  ....*....|....*....|....*....|
gi 1720417364 181 SKRPKWVPPAASGSRNSSSNALAGTPAKSP 210
Cdd:PTZ00449  634 KRPPPPQRPSSPERPEGPKIIKSPKPPKSP 663
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
34-135 5.97e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 380146 [Multi-domain]  Cd Length: 963  Bit Score: 37.50  E-value: 5.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364  34 SPEDLDKITEEGDASSVEGERKSPSQAKAPRRRAPSEGSDGSSANDTESESATGEGSESDPDFDESKESDEDFGvrrske 113
Cdd:NF000535  832 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDAG------ 905
                          90       100
                  ....*....|....*....|..
gi 1720417364 114 skkKTVQKKPAGEKKERKSKPK 135
Cdd:NF000535  906 ---KHTPAKPMSTVKDHHNKAK 924
MSCRAMM_ClfB NF033845
MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial ...
34-126 8.13e-03

MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.


Pssm-ID: 411414 [Multi-domain]  Cd Length: 871  Bit Score: 37.23  E-value: 8.13e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364  34 SPEDLDKITEEGDASSVEGERKSPSQAKAPRRRAPSEGSDGSSANDTESESATGEGSESDPDFDESKESDEDFGVRRSKE 113
Cdd:NF033845  724 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSRVTPP 803
                          90
                  ....*....|...
gi 1720417364 114 SKKKTVQKKPAGE 126
Cdd:NF033845  804 NNEQKAPSNPKGE 816
 
Name Accession Description Interval E-value
RAD51_interact pfam15696
RAD51 interacting motif; This motif interacts with RAD51.
193-231 6.01e-12

RAD51 interacting motif; This motif interacts with RAD51.


Pssm-ID: 406187  Cd Length: 39  Bit Score: 58.48  E-value: 6.01e-12
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1720417364 193 GSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSA 231
Cdd:pfam15696   1 GSSGSSSGILRGVPVKSPSQPLRLGLSRLARVKPLHPYL 39
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
34-210 6.47e-04

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 40.44  E-value: 6.47e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364  34 SPEDLDKITEEgDASSVEGERKSPSQAKAP-----------RRRAPSEGSDGSSANDTESESATGE-GSESDPdfdeske 101
Cdd:PTZ00449  492 SKKKLAPIEEE-DSDKHDEPPEGPEASGLPpkapgdkegeeGEHEDSKESDEPKEGGKPGETKEGEvGKKPGP------- 563
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364 102 sdedfgVRRSKESKKKTVQKKPAGEKKERKSK-PKCEASVTSVDPAPAAIKSGSPSLPQAVGLPseatRKPAIMCSPSAE 180
Cdd:PTZ00449  564 ------AKEHKPSKIPTLSKKPEFPKDPKHPKdPEEPKKPKRPRSAQRPTRPKSPKLPELLDIP----KSPKRPESPKSP 633
                         170       180       190
                  ....*....|....*....|....*....|
gi 1720417364 181 SKRPKWVPPAASGSRNSSSNALAGTPAKSP 210
Cdd:PTZ00449  634 KRPPPPQRPSSPERPEGPKIIKSPKPPKSP 663
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
34-135 5.97e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 380146 [Multi-domain]  Cd Length: 963  Bit Score: 37.50  E-value: 5.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364  34 SPEDLDKITEEGDASSVEGERKSPSQAKAPRRRAPSEGSDGSSANDTESESATGEGSESDPDFDESKESDEDFGvrrske 113
Cdd:NF000535  832 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDAG------ 905
                          90       100
                  ....*....|....*....|..
gi 1720417364 114 skkKTVQKKPAGEKKERKSKPK 135
Cdd:NF000535  906 ---KHTPAKPMSTVKDHHNKAK 924
MSCRAMM_ClfB NF033845
MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial ...
34-126 8.13e-03

MSCRAMM family adhesin clumping factor ClfB; Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.


Pssm-ID: 411414 [Multi-domain]  Cd Length: 871  Bit Score: 37.23  E-value: 8.13e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364  34 SPEDLDKITEEGDASSVEGERKSPSQAKAPRRRAPSEGSDGSSANDTESESATGEGSESDPDFDESKESDEDFGVRRSKE 113
Cdd:NF033845  724 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSRVTPP 803
                          90
                  ....*....|...
gi 1720417364 114 SKKKTVQKKPAGE 126
Cdd:NF033845  804 NNEQKAPSNPKGE 816
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
68-215 9.29e-03

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 36.98  E-value: 9.29e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364  68 PSEGSDGSSANDTESESATGEGSESDPdfdeSKESDEDFGVRRSKESKKKTVQKKPaGEKKERKskpkceasvtsvdPAP 147
Cdd:PTZ00449  510 PPEGPEASGLPPKAPGDKEGEEGEHED----SKESDEPKEGGKPGETKEGEVGKKP-GPAKEHK-------------PSK 571
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720417364 148 AAIKSGSPSLPQAVGLPS--EATRKPAIMCSPSAESKRPKWVPPAASGSRNSSSNALAGTPAKSPSQSLR 215
Cdd:PTZ00449  572 IPTLSKKPEFPKDPKHPKdpEEPKKPKRPRSAQRPTRPKSPKLPELLDIPKSPKRPESPKSPKRPPPPQR 641
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH