NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1907183268|ref|XP_036009217|]
View 

synaptic vesicle glycoprotein 2B isoform X1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
synapt_SV2 super family cl31090
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
8-683 0e+00

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


The actual alignment was detected with superfamily member TIGR01299:

Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 1033.39  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268   8 DNYEGYAPSDGYYR--SNEQNQEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDvKSKQTKMA--PSRADGLGGQAD---- 79
Cdd:TIGR01299  54 DDDDFPAPADGYSRgeAADDEEEGEASSDATEGHDEDDEIYEGEYQGIPRAEN-GGKDEIMAdgAPKAGVRDELKDgegp 132
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268  80 ----LMAERMEDEEELAHQYETIIDECGHGRFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVY 155
Cdd:TIGR01299 133 pggeGEAERRADEEELAQQYELIIQECGHGRFQWALFFVLGLALMADGVEVFVVGFVLPSAEKDLCIPDSGKGMLGLIVY 212
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEH 235
Cdd:TIGR01299 213 LGMMVGAFFWGGLADKLGRKQCLLICLSVNGFFAFFSSFVQGYGFFLFCRLLSGFGIGGAIPIVFSYFAEFLAQEKRGEH 292
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 236 LSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWM 315
Cdd:TIGR01299 293 LSWLCMFWMIGGIYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDEAWM 372
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 316 ILKQVHDTNMRAKGTPEKVFTVSHIKTPKQMDEFIEIQSSTGTWYQRWLVRFMTIFKQVWDNALYCVMGPYRMNTLILAV 395
Cdd:TIGR01299 373 ILKLIHDTNMRAKGHPEKVFSVNHIKTIHQEDELIEIESDTGTWYQRCFVRALSEGGGIWGNFLRCFNPEVREITIKLMG 452
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 396 VWFTMALSYYGLTVWFPDMIRYFQDEEYKSKMKVFFGEHVHGATINFTMENQIHQHGKLVNDKFIKMYFKHVLFEDTFFD 475
Cdd:TIGR01299 453 VWFTLSFGYYGLSVWFPDMIKHLQADDYAALTKNFPGDKVAHFSFNFTLENQIHRGGEYDNDKFIGLKFKSVSFEDSLFE 532
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 476 KCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFINCRFINSTFLEQKEGCHMDFEEDND--FLIYLVSFLGSLSVLPGN 553
Cdd:TIGR01299 533 ECTFDDVTSSNTFFKNCTFIDTLFENTDFEEYKFIDSEFQNCSFLHNKEGCPIDFDGDDEgaYMIYFVNFLGTLAVLPGN 612
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 554 IISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGL 633
Cdd:TIGR01299 613 IVSALLMDKIGRLRMLAGSMVLSCISCFFLSFGNSESAMIALLCLFGGLSIAAWNALDVLTVELYPSDKRATAFGFLNAL 692
                         650       660       670       680       690
                  ....*....|....*....|....*....|....*....|....*....|
gi 1907183268 634 CKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM 683
Cdd:TIGR01299 693 CKAAAVLGILIFGSFVGITKAAPILFASAALACGGLLALKLPDTRGQVLM 742
 
Name Accession Description Interval E-value
synapt_SV2 TIGR01299
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
8-683 0e+00

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 1033.39  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268   8 DNYEGYAPSDGYYR--SNEQNQEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDvKSKQTKMA--PSRADGLGGQAD---- 79
Cdd:TIGR01299  54 DDDDFPAPADGYSRgeAADDEEEGEASSDATEGHDEDDEIYEGEYQGIPRAEN-GGKDEIMAdgAPKAGVRDELKDgegp 132
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268  80 ----LMAERMEDEEELAHQYETIIDECGHGRFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVY 155
Cdd:TIGR01299 133 pggeGEAERRADEEELAQQYELIIQECGHGRFQWALFFVLGLALMADGVEVFVVGFVLPSAEKDLCIPDSGKGMLGLIVY 212
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEH 235
Cdd:TIGR01299 213 LGMMVGAFFWGGLADKLGRKQCLLICLSVNGFFAFFSSFVQGYGFFLFCRLLSGFGIGGAIPIVFSYFAEFLAQEKRGEH 292
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 236 LSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWM 315
Cdd:TIGR01299 293 LSWLCMFWMIGGIYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDEAWM 372
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 316 ILKQVHDTNMRAKGTPEKVFTVSHIKTPKQMDEFIEIQSSTGTWYQRWLVRFMTIFKQVWDNALYCVMGPYRMNTLILAV 395
Cdd:TIGR01299 373 ILKLIHDTNMRAKGHPEKVFSVNHIKTIHQEDELIEIESDTGTWYQRCFVRALSEGGGIWGNFLRCFNPEVREITIKLMG 452
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 396 VWFTMALSYYGLTVWFPDMIRYFQDEEYKSKMKVFFGEHVHGATINFTMENQIHQHGKLVNDKFIKMYFKHVLFEDTFFD 475
Cdd:TIGR01299 453 VWFTLSFGYYGLSVWFPDMIKHLQADDYAALTKNFPGDKVAHFSFNFTLENQIHRGGEYDNDKFIGLKFKSVSFEDSLFE 532
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 476 KCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFINCRFINSTFLEQKEGCHMDFEEDND--FLIYLVSFLGSLSVLPGN 553
Cdd:TIGR01299 533 ECTFDDVTSSNTFFKNCTFIDTLFENTDFEEYKFIDSEFQNCSFLHNKEGCPIDFDGDDEgaYMIYFVNFLGTLAVLPGN 612
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 554 IISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGL 633
Cdd:TIGR01299 613 IVSALLMDKIGRLRMLAGSMVLSCISCFFLSFGNSESAMIALLCLFGGLSIAAWNALDVLTVELYPSDKRATAFGFLNAL 692
                         650       660       670       680       690
                  ....*....|....*....|....*....|....*....|....*....|
gi 1907183268 634 CKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM 683
Cdd:TIGR01299 693 CKAAAVLGILIFGSFVGITKAAPILFASAALACGGLLALKLPDTRGQVLM 742
MFS_SV2B cd17438
Synaptic vesicle glycoprotein 2B of the Major Facilitator Superfamily of transporters; ...
112-678 0e+00

Synaptic vesicle glycoprotein 2B of the Major Facilitator Superfamily of transporters; Synaptic vesicle glycoprotein 2 (SV2) is a transporter-like integral membrane glycoprotein, with 12 transmembrane regions, expressed in vertebrates and is localized to synaptic and endocrine secretory vesicles. Three isoforms have been identified, SV2A, SV2B, and SV2C. SV2A and SV2B are widely expressed in the brain, while SV2C is more restricted to evolutionarily older brain. SV2 isoforms have been shown to be critical for the proper function of the central nervous system. SV2 serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. SV2B is a key modulator of amyloid toxicity at the synaptic site and also has an essential role in the formation and maintenance of the glomerular capillary wall. SV2B belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340996 [Multi-domain]  Cd Length: 477  Bit Score: 924.32  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17438     1 FFVLGLALMADGVEVFVVGFVLPSAEKDMCLSSSNKGMLGLIVYLGMMAGAFIWGGLADKLGRKRCLIISLAINASFAFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNY 271
Cdd:cd17438    81 SSFVQGYGAFLFCRLISGFGIGGSLPIVFAYFSEFLAREKRGEHLSWLCMFWMIGGLYASAMAWSIIPHYGWGFSMGTNY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKtpkqmdefie 351
Cdd:cd17438   161 HFHSWRVFVIICALPCIASIIALKFMPESPRFLLEMGKHDEAWMILKNIHDTNMRAKGTPEKVFTVSNIK---------- 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQdeeykskmkvff 431
Cdd:cd17438   231 -----------------------------------RKNTLFLAVVWFTMAFSYYGLTVWFPDMIRYLQ------------ 263
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 432 gehvhgatinftmenqihqhgklvndkfikmyfKHVLFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFIN 511
Cdd:cd17438   264 ---------------------------------KHVTFEDSLFDECYFEDVTSTDTYFKNCTIESTIFYNTDLYEHKFID 310
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 512 CRFINSTFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESA 591
Cdd:cd17438   311 CRFINSTFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDKIGRIKMIGGSMLISAVCCFFLFFGNSESA 390
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 592 MIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIA 671
Cdd:cd17438   391 MIGWQCLFCGTSIAAWNALDVITVELYPTNKRATAFGILNGLCKFAAILGNSIFASFVGITKVIPILLASTALVGGGLIS 470

                  ....*..
gi 1907183268 672 LRLPETR 678
Cdd:cd17438   471 LRLPETR 477
Sugar_tr pfam00083
Sugar (and other) transporter;
127-319 1.68e-21

Sugar (and other) transporter;


Pssm-ID: 395036 [Multi-domain]  Cd Length: 452  Bit Score: 97.73  E-value: 1.68e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 127 FVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAF---LF 203
Cdd:pfam00083  28 FFKNFGLSKSVSSLAALSVLSGLIVSIFSVGCFIGSLFAGKLGDRFGRKKSLLIANVLFVIGAVLQGAAKGKWSVyqlIV 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 204 CRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYAsamAWSiiphyGWGFSMGTNYHfhSWRVFVIVC 283
Cdd:pfam00083 108 GRVLVGIGVGGASVLAPMYISEIAPKKLRGALGSLYQLAITFGILLA---YIF-----GLGLNKTSNSD--GWRIPLGLQ 177
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1907183268 284 ALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQ 319
Cdd:pfam00083 178 LVPALLLIIGLLFLPESPRWLVEKGRLEEAREVLAK 213
PRK11551 PRK11551
putative 3-hydroxyphenylpropionic transporter MhpT; Provisional
116-304 2.15e-14

putative 3-hydroxyphenylpropionic transporter MhpT; Provisional


Pssm-ID: 236927 [Multi-domain]  Cd Length: 406  Bit Score: 75.38  E-value: 2.15e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 116 GLALMADGVeifvvsfALPSAEKDMCLSsskKGMLGLIV---YLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLS 192
Cdd:PRK11551   28 GLDLQSAGV-------AAPRMAQEFGLD---VAQMGWAFsagILGLLPGALLGGRLADRIGRKRILIVSVALFGLFSLAT 97
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 193 SFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWL--GI-FwmtGGIYASAMAWsiiphygwgFSMGT 269
Cdd:PRK11551   98 AQAWDFPSLLVARLLTGVGLGGALPNLIALTSEAVGPRLRGTAVSLMycGVpF---GGALASVIGV---------LAAGD 165
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1907183268 270 NyhfhSWR-VFVIVCALPATVSMVALKFMPESPRFL 304
Cdd:PRK11551  166 A----AWRhIFYVGGVGPLLLVPLLMRWLPESRAFA 197
AraJ COG2814
Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];
106-258 1.40e-10

Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];


Pssm-ID: 225371 [Multi-domain]  Cd Length: 394  Bit Score: 63.79  E-value: 1.40e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN 185
Cdd:COG2814     9 KPMWLALLALALAAFAIGTTEFVPVGLLPPIAADLGVSEGAAGQLITAYALGVALGAPLLALLTGRLERRRLLLGLLALF 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 186 ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKR-------------------------GEHLSWLG 240
Cdd:COG2814    89 IVSNLLSALAPSFAVLLLARALAGLAHGVFWSIAAALAARLVPPGKRgralalvftgltlatvlgvplgtflGQLFGWRA 168
                         170
                  ....*....|....*...
gi 1907183268 241 IFWMTGGIYASAMAWSII 258
Cdd:COG2814   169 TFLAIAVLALLALLLLWK 186
MFS_LfrA NF033896
efflux MFS transporter LfrA; This efflux transporter, as characterized in Mycolicibacterium ...
106-300 9.45e-03

efflux MFS transporter LfrA; This efflux transporter, as characterized in Mycolicibacterium (Mycobacterium) smegmatis, provides low-level fluoroquinolone resistance (lfr) when overexpressed.


Pssm-ID: 411458 [Multi-domain]  Cd Length: 504  Bit Score: 39.12  E-value: 9.45e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN 185
Cdd:NF033896   16 RRAWLALAVLMLPVLLIAIDNTVLAFALPAIAEDFRPSAATQLWIVDVYSLVLAALLVAMGSLGDRIGRRRLLLIGAAGF 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 186 ASFASLSSFVQGYGAFLFCRliSGIGIGG------SLPIVFAYFSEFLSRekRGEHLSWLGIFwMTGGIYASAMAWSIIP 259
Cdd:NF033896   96 AVVSAAAAFAPSAEYLVAAR--AALGVFGamlmpsTLSLIRNIFTEASAR--RLAIAIWASCF-TAGSTLGPIVGGALLQ 170
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 1907183268 260 HYGWGfsmgtnyhfhswRVFVIVCALPATVSMVALKFMPES 300
Cdd:NF033896  171 HFHWG------------AVFLVAVPILLPLLVLGPRLVPES 199
 
Name Accession Description Interval E-value
synapt_SV2 TIGR01299
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
8-683 0e+00

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 1033.39  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268   8 DNYEGYAPSDGYYR--SNEQNQEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDvKSKQTKMA--PSRADGLGGQAD---- 79
Cdd:TIGR01299  54 DDDDFPAPADGYSRgeAADDEEEGEASSDATEGHDEDDEIYEGEYQGIPRAEN-GGKDEIMAdgAPKAGVRDELKDgegp 132
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268  80 ----LMAERMEDEEELAHQYETIIDECGHGRFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVY 155
Cdd:TIGR01299 133 pggeGEAERRADEEELAQQYELIIQECGHGRFQWALFFVLGLALMADGVEVFVVGFVLPSAEKDLCIPDSGKGMLGLIVY 212
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEH 235
Cdd:TIGR01299 213 LGMMVGAFFWGGLADKLGRKQCLLICLSVNGFFAFFSSFVQGYGFFLFCRLLSGFGIGGAIPIVFSYFAEFLAQEKRGEH 292
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 236 LSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWM 315
Cdd:TIGR01299 293 LSWLCMFWMIGGIYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDEAWM 372
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 316 ILKQVHDTNMRAKGTPEKVFTVSHIKTPKQMDEFIEIQSSTGTWYQRWLVRFMTIFKQVWDNALYCVMGPYRMNTLILAV 395
Cdd:TIGR01299 373 ILKLIHDTNMRAKGHPEKVFSVNHIKTIHQEDELIEIESDTGTWYQRCFVRALSEGGGIWGNFLRCFNPEVREITIKLMG 452
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 396 VWFTMALSYYGLTVWFPDMIRYFQDEEYKSKMKVFFGEHVHGATINFTMENQIHQHGKLVNDKFIKMYFKHVLFEDTFFD 475
Cdd:TIGR01299 453 VWFTLSFGYYGLSVWFPDMIKHLQADDYAALTKNFPGDKVAHFSFNFTLENQIHRGGEYDNDKFIGLKFKSVSFEDSLFE 532
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 476 KCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFINCRFINSTFLEQKEGCHMDFEEDND--FLIYLVSFLGSLSVLPGN 553
Cdd:TIGR01299 533 ECTFDDVTSSNTFFKNCTFIDTLFENTDFEEYKFIDSEFQNCSFLHNKEGCPIDFDGDDEgaYMIYFVNFLGTLAVLPGN 612
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 554 IISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGL 633
Cdd:TIGR01299 613 IVSALLMDKIGRLRMLAGSMVLSCISCFFLSFGNSESAMIALLCLFGGLSIAAWNALDVLTVELYPSDKRATAFGFLNAL 692
                         650       660       670       680       690
                  ....*....|....*....|....*....|....*....|....*....|
gi 1907183268 634 CKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM 683
Cdd:TIGR01299 693 CKAAAVLGILIFGSFVGITKAAPILFASAALACGGLLALKLPDTRGQVLM 742
MFS_SV2B cd17438
Synaptic vesicle glycoprotein 2B of the Major Facilitator Superfamily of transporters; ...
112-678 0e+00

Synaptic vesicle glycoprotein 2B of the Major Facilitator Superfamily of transporters; Synaptic vesicle glycoprotein 2 (SV2) is a transporter-like integral membrane glycoprotein, with 12 transmembrane regions, expressed in vertebrates and is localized to synaptic and endocrine secretory vesicles. Three isoforms have been identified, SV2A, SV2B, and SV2C. SV2A and SV2B are widely expressed in the brain, while SV2C is more restricted to evolutionarily older brain. SV2 isoforms have been shown to be critical for the proper function of the central nervous system. SV2 serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. SV2B is a key modulator of amyloid toxicity at the synaptic site and also has an essential role in the formation and maintenance of the glomerular capillary wall. SV2B belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340996 [Multi-domain]  Cd Length: 477  Bit Score: 924.32  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17438     1 FFVLGLALMADGVEVFVVGFVLPSAEKDMCLSSSNKGMLGLIVYLGMMAGAFIWGGLADKLGRKRCLIISLAINASFAFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNY 271
Cdd:cd17438    81 SSFVQGYGAFLFCRLISGFGIGGSLPIVFAYFSEFLAREKRGEHLSWLCMFWMIGGLYASAMAWSIIPHYGWGFSMGTNY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKtpkqmdefie 351
Cdd:cd17438   161 HFHSWRVFVIICALPCIASIIALKFMPESPRFLLEMGKHDEAWMILKNIHDTNMRAKGTPEKVFTVSNIK---------- 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQdeeykskmkvff 431
Cdd:cd17438   231 -----------------------------------RKNTLFLAVVWFTMAFSYYGLTVWFPDMIRYLQ------------ 263
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 432 gehvhgatinftmenqihqhgklvndkfikmyfKHVLFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFIN 511
Cdd:cd17438   264 ---------------------------------KHVTFEDSLFDECYFEDVTSTDTYFKNCTIESTIFYNTDLYEHKFID 310
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 512 CRFINSTFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESA 591
Cdd:cd17438   311 CRFINSTFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDKIGRIKMIGGSMLISAVCCFFLFFGNSESA 390
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 592 MIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIA 671
Cdd:cd17438   391 MIGWQCLFCGTSIAAWNALDVITVELYPTNKRATAFGILNGLCKFAAILGNSIFASFVGITKVIPILLASTALVGGGLIS 470

                  ....*..
gi 1907183268 672 LRLPETR 678
Cdd:cd17438   471 LRLPETR 477
MFS_SV2 cd17363
Synaptic vesicle glycoprotein 2 of the Major Facilitator Superfamily of transporters; Synaptic ...
112-678 0e+00

Synaptic vesicle glycoprotein 2 of the Major Facilitator Superfamily of transporters; Synaptic vesicle glycoprotein 2 (SV2) is a transporter-like integral membrane glycoprotein, with 12 transmembrane regions, expressed in vertebrates and is localized to synaptic and endocrine secretory vesicles. Three isoforms have been identified, SV2A, SV2B, and SV2C. SV2A and SV2B are widely expressed in the brain, while SV2C is more restricted to evolutionarily older brain. SV2 isoforms have been shown to be critical for the proper function of the central nervous system. SV2 serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. The SV2 family belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340921 [Multi-domain]  Cd Length: 474  Bit Score: 888.37  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17363     1 FFVLGLALMADGVEVFVVGFVLPSAEKDMCLSNSNKGMLGLIVYLGMMVGAFVWGGLADKLGRKQCLLIALSVNGVFAFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNY 271
Cdd:cd17363    81 SSFVQGYGFFLFCRLLSGIGIGGSIPIVFSYFAEFLAREKRGEHLSWLCMFWMIGGLYASAMAWAIIPHYGWGFSMGTAY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKtpkqmdefie 351
Cdd:cd17363   161 QFHSWRVFVIVCALPSVASVVALTFMPESPRFLLEVGKHDEAWMILKQVHDTNMRAKGHPERVFTVSHIK---------- 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQdeeykskmkvff 431
Cdd:cd17363   231 -----------------------------------RMNTLFLAIVWFTMSFSYYGLTVWFPDMIKYLQ------------ 263
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 432 gehvhgatinftmenqihqhgklvndkfikmyfkhvlFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFIN 511
Cdd:cd17363   264 -------------------------------------FEDSLFEECYFEDVTSTNTFFENCTFINTVFYNTDLFEYKFID 306
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 512 CRFINSTFL-EQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSES 590
Cdd:cd17363   307 SRFLNSTFFlKEKCGCHLNDDEENAYLIYLVSFLGSLSVLPGNIVSALLMDKIGRLKMIGGSMLLSAVCCFFLFFGNSES 386
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 591 AMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLI 670
Cdd:cd17363   387 AMIGLQCLFCGVSIAAWNALDVVTVELYPTDKRATAFGFLNGLCKLAAILGNSIFGSFVGITKVIPILLASAALVCGGLL 466

                  ....*...
gi 1907183268 671 ALRLPETR 678
Cdd:cd17363   467 ALKLPETR 474
MFS_SV2A cd17439
Synaptic vesicle glycoprotein 2A of the Major Facilitator Superfamily of transporters; ...
112-678 0e+00

Synaptic vesicle glycoprotein 2A of the Major Facilitator Superfamily of transporters; Synaptic vesicle glycoprotein 2 (SV2) is a transporter-like integral membrane glycoprotein, with 12 transmembrane regions, expressed in vertebrates and is localized to synaptic and endocrine secretory vesicles. Three isoforms have been identified, SV2A, SV2B, and SV2C. SV2A and SV2B are widely expressed in the brain, while SV2C is more restricted to evolutionarily older brain. SV2 isoforms have been shown to be critical for the proper function of the central nervous system. SV2 serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. It is unclear how SV2A is involved in correct SV function, but it has been suggested to either act as a transporter or a regulator of exocytosis by mediating Ca2+ dynamics. SV2A has been identified as the molecular target of the antiepileptic drug levetiracetam (LEV). Its expression is decreased in patients with epilepsy and in epileptic animal models. SV2A belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340997 [Multi-domain]  Cd Length: 478  Bit Score: 705.25  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17439     1 YFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRIGRRQCLLISLSVNSVFAFF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNY 271
Cdd:cd17439    81 SSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGWSFQMGSAY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKtpkqmdefie 351
Cdd:cd17439   161 QFHSWRVFVLVCAFPSVFAIGALTTMPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIK---------- 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQdeeykskmkvff 431
Cdd:cd17439   231 -----------------------------------RRITLMMMAVWFTMSFSYYGLTVWFPDMIKHLQ------------ 263
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 432 gehvhgatinftmenqihqhgklvndkfikmyfKHVLFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFIN 511
Cdd:cd17439   264 ---------------------------------KSVVFEDSLFEECYFEDITSSNTFFKNCTFISTLFYNTDLFEYKFIN 310
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 512 CRFINSTFLEQKEGCHMDF-EEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSES 590
Cdd:cd17439   311 SKLINSTFLHNKEGCLLDFsDENNAYMIYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSES 390
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 591 AMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLI 670
Cdd:cd17439   391 AMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAVPILLASAALAAGSSL 470

                  ....*...
gi 1907183268 671 ALRLPETR 678
Cdd:cd17439   471 ALKLPETR 478
MFS_SV2C cd17440
Synaptic vesicle glycoprotein 2C of the Major Facilitator Superfamily of transporters; ...
112-678 0e+00

Synaptic vesicle glycoprotein 2C of the Major Facilitator Superfamily of transporters; Synaptic vesicle glycoprotein 2 (SV2) is a transporter-like integral membrane glycoprotein, with 12 transmembrane regions, expressed in vertebrates and is localized to synaptic and endocrine secretory vesicles. Three isoforms have been identified, SV2A, SV2B, and SV2C. SV2A and SV2B are widely expressed in the brain, while SV2C is more restricted to evolutionarily older brain. SV2 isoforms have been shown to be critical for the proper function of the central nervous system. SV2 serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. SV2C exhibits enriched expression in several basal ganglia nuclei, and has been found to be involved in normal operation of the basal ganglia network and could be also be involved in system adaptation in basal ganglia pathological conditions. SV2C belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340998 [Multi-domain]  Cd Length: 479  Bit Score: 688.96  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17440     1 FFVLGMALMADGVEVFVVGFVLPSAETDMCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRRQSLLICMSVNGFFAFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNY 271
Cdd:cd17440    81 SSFVQGYGLFLFCRLLSGFGIGGAVPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGWSFSMGSAY 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKtpkqmdefie 351
Cdd:cd17440   161 QFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHDEAWMILKQIHDTNMRARGQPEKVFTVNRIK---------- 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQdeeykskmkvff 431
Cdd:cd17440   231 -----------------------------------KDNTIKLTIVWLTLSFGYYGLSVWFPDVIKHLQ------------ 263
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 432 gehvhgatinftmenqihqhgklvndkfikmyFKHVLFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFIN 511
Cdd:cd17440   264 --------------------------------FKSVTFEDSLFKSCFFEDVTSVNTYFRNCTFIETVFYNTDLEDYKFID 311
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 512 CRFINSTFLEQKEGCHMDFEED-NDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSES 590
Cdd:cd17440   312 SDFINCTFFHNKTGCQITFDDDySAYWIYFVNFLGTLAVLPGNIVSALLMDRIGRLTMLGGSMVLSGISCFFLWFGTSES 391
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 591 AMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLI 670
Cdd:cd17440   392 MMIGMLCLYNGLTISAWNSLDVVTVELYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVGITKAIPILLASTVLVCGGLV 471

                  ....*...
gi 1907183268 671 ALRLPETR 678
Cdd:cd17440   472 GLRLPDTR 479
MFS_SV2_like cd17316
Metazoan Synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters of the ...
112-672 2.68e-49

Metazoan Synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters of the Major Facilitator Superfamily; This family is composed of metazoan synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters including those that transport inorganic phosphate (Pht), aromatic compounds (PcaK and related proteins), proline/betaine (ProP), alpha-ketoglutarate (KgtP), citrate (CitA), shikimate (ShiA), and cis,cis-muconate (MucK), among others. SV2 is a transporter-like protein that serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. Also included in this family is synaptic vesicle 2 (SV2)-related protein (SVOP) and similar proteins. SVOP is a transporter-like nucleotide binding protein that localizes to neurotransmitter-containing vesicles. The SV2-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340874 [Multi-domain]  Cd Length: 353  Bit Score: 176.25  E-value: 2.68e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 112 FFVLGLALMADGVEIFVVSFALP--SAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFA 189
Cdd:cd17316     1 LLLAGLGWFFDAYDFFLIGFVAPvlAAEFSLGLSLLQTGLLFAAGFLGRPIGALLFGYLGDRIGRKKALILTLLLFGLAT 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 190 SLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFsmgt 269
Cdd:cd17316    81 LLIGLLPTPILLLVLRFLQGIGIGGEYPGASTYVAEFAPSKRRGFALGLLQSGWALGALLAALVASLLIPLLSGDW---- 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 270 nyhfhSWRVFVIVCALPATVSMVAlkfmpesprfllemgkhdeawmilkqvhdtnmrakgtpekvftvshiktpkqmdef 349
Cdd:cd17316   157 -----GWRILFLIGALPALLALLL-------------------------------------------------------- 175
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 350 ieiqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPdmiryfqdeeykskmkv 429
Cdd:cd17316   176 -------------------------------------RRRTLLLILLWFFISFGYYGLTTFLP----------------- 201
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 430 ffgehvhgatinftmenqihqhgklvndkfikmyfkhvlfedtffdkcyfedvtstdtyfknctiesttfyntdlykhkf 509
Cdd:cd17316       --------------------------------------------------------------------------------
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 510 incrfinsTFLEQkeGCHMDFEEdndflIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFF--GN 587
Cdd:cd17316   202 --------TYLQT--VLGLSPAT-----SSLYLLLISLGALVGALIAGLLSDRIGRKKTLVIGLILSGILALPLFYllSG 266
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 588 SESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFV--GITKVVPILLAAASLV 665
Cdd:cd17316   267 SPTLLLLLLFILSFFVGGVWGALYAYLAELFPTEVRATGVGLSYNLGRLGGGGAPPLIALLLasTGGTGVPALILALLAI 346

                  ....*..
gi 1907183268 666 GGGLIAL 672
Cdd:cd17316   347 VALIVAL 353
2A0115 TIGR00895
benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and ...
106-432 2.51e-36

benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273327 [Multi-domain]  Cd Length: 398  Bit Score: 140.95  E-value: 2.51e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN 185
Cdd:TIGR00895  13 RYQWRAIILSFLIMLMDGYDLAAMGFAAPAISAEWGLDPVQLGFLFSAGLIGMAFGALFFGPLADRIGRRRVLLWSILLF 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 186 ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWgf 265
Cdd:TIGR00895  93 SVFTLLCALATNVTQLLILRFLAGLGLGGLMPNLNALVSEYAPKRFRGTAVGLMFCGYPIGAAVGGFLAGWLIPVFGW-- 170
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 266 smgtnyhfHSwrVFVIVCALPATVSMVALKFMPESPRFLLEmgkhdeawmilkqvhdtnmraKGTPEKVFTVSHIKTPKQ 345
Cdd:TIGR00895 171 --------RS--LFYVGGIAPLLLLLLLMRFLPESIDFLVS---------------------KRPETVRRIVNAIAPQMQ 219
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 346 MD---EFIEIQSSTGTWYqrwlVRFMTIFKqvwdnalycvmGPYRMNTLILAVVWFTMALSYYGLTVWFPDMIRyfqDEE 422
Cdd:TIGR00895 220 AEaqsALPEQKSTQGTKR----SVFKALFQ-----------GKTARITVLLWLLYFMLLVGVYFLTNWLPKLMV---ELG 281
                         330
                  ....*....|
gi 1907183268 423 YKSKMKVFFG 432
Cdd:TIGR00895 282 FSLSLAATGG 291
2A0119 TIGR00898
cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]
105-682 3.69e-35

cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273328 [Multi-domain]  Cd Length: 505  Bit Score: 139.77  E-value: 3.69e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 105 GRFQWTLFfVLGLALMADGVEIFVVSFALPSA----EKDM-CLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLS 179
Cdd:TIGR00898  83 GCEPLKLS-DLGLAATEPCLDGWEYSYDTFSStivtEWDLvCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRKKVLL 161
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 180 MSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsIIP 259
Cdd:TIGR00898 162 LSTLVTAVSGVLTAFSPNYTVFLVFRLLVGMGIGGIWVQAVVLNTEFLPKKQRAIVGTLIQVFFSLGLVLLPLVAY-FIP 240
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 260 HygwgfsmgtnyhfhsWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVS- 338
Cdd:TIGR00898 241 D---------------WRWLQLAVSLPTFLFFLLSWFVPESPRWLISQGRIEEALKILQRIAKINGKKLPAEVLSLSLEk 305
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 339 HIKTPKQMDEFIEiqsstgtwyqrwLVRFMTIfkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVwfpdmiryf 418
Cdd:TIGR00898 306 DLSSSKKQYSFLD------------LFRTPNL----------------RKTTLCLMMLWFTTAFSYYGLVL--------- 348
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 419 qdeeyksKMKVFFGEhvhgatinftmenqihqhgklvndkfikmyfkhvlfedtffdkcyfedvtstdtyfknctiestt 498
Cdd:TIGR00898 349 -------DLGNLGGN----------------------------------------------------------------- 356
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 499 fyntdlykhkfincrfinstfleqkegchmdfeedndflIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAV 578
Cdd:TIGR00898 357 ---------------------------------------IYLDLFISGLVELPAKLITLLLIDRLGRRYTMAASLLLAGV 397
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 579 CCFFLFFGNSES-------AMIGWQCLfcgtsIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILgnTIFASFVG- 650
Cdd:TIGR00898 398 ALLLLLFVPVDLyflrtalAVLGKFGI-----TSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVGSII--SPFLVYLGe 470
                         570       580       590
                  ....*....|....*....|....*....|..
gi 1907183268 651 ITKVVPILLAAASLVGGGLIALRLPETREQVL 682
Cdd:TIGR00898 471 KWLFLPLVLFGGLALLAGILTLFLPETKGVPL 502
MFS_PcaK_like cd17365
4-hydroxybenzoate transporter PcaK and similar transporters of the Major Facilitator ...
113-294 5.32e-25

4-hydroxybenzoate transporter PcaK and similar transporters of the Major Facilitator Superfamily; This aromatic acid:H(+) symporter subfamily includes Acinetobacter sp. 4-hydroxybenzoate transporter PcaK, Pseudomonas putida gallate transporter (GalT), Corynebacterium glutamicum gentisate transporter (GenK), Nocardioides sp. 1-hydroxy-2-naphthoate transporter (PhdT), Escherichia coli 3-(3-hydroxy-phenyl)propionate (3HPP) transporter (MhpT), and similar proteins. These transporters are involved in the uptake across the cytoplasmic membrane of specific aromatic compounds such as 4-hydroxybenzoate, gallate, gentisate (2,5-dihydroxybenzoate), 1-hydroxy-2-naphthoate, and 3HPP, respectively. The PcaK-like aromatic acid:H(+) symporter subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340923 [Multi-domain]  Cd Length: 351  Bit Score: 106.90  E-value: 5.32e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 113 FVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLS 192
Cdd:cd17365     2 ALCFLIIVLDGFDLAVMGFVAPALAQDWGLSPAQLGPVGSAALFGMAIGALLAGPLADRFGRKRVLLVSVALFGLFTLLT 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 193 SFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtnyh 272
Cdd:cd17365    82 AFAQSVLQLALLRFLTGLGLGAAMPNAITLVSEYAPARRRSLAVTLMFCGYPLGAALGGFLAAALIPAFG---------- 151
                         170       180
                  ....*....|....*....|..
gi 1907183268 273 fhsWRVFVIVCALPATVSMVAL 294
Cdd:cd17365   152 ---WRSVFLLGGVPPLILLPLL 170
MFS_SVOP_like cd17372
Synaptic vesicle 2-related protein (SVOP) and related proteins of the Major Facilitator ...
112-640 7.99e-25

Synaptic vesicle 2-related protein (SVOP) and related proteins of the Major Facilitator Superfamily; This subfamily is composed of synaptic vesicle 2 (SV2)-related protein (SVOP), SVOP-like protein (SVOPL), and similar proteins. SVOP is a transporter-like nucleotide binding protein that localizes to neurotransmitter-containing vesicles. Like SV2, SVOP is expressed in all brain regions, with highest levels in cerebellum, hindbrain and pineal gland. Studies with knockout mice suggets that SVOP may perform a subtle function that is not necessary for survival under normal conditions, since mice lacking SVOP are viable, fertile, and phenotypically normal. SVOP and SVOPL share structural similarity to the solute carrier family 22 (SLC22), a large family of organic cation and anion transporters. The SVOP-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340930 [Multi-domain]  Cd Length: 367  Bit Score: 106.85  E-value: 7.99e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17372     1 LAYAGMGWVAEAMEMMLLSFVGPAVQCEWNLSAWQVALITSVVFAGMMIGSYLWGIVSDKYGRRKGLIISALWTFYAGFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 192 SSFVQGYGAFLFCRLISGIGIGGSlPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtny 271
Cdd:cd17372    81 SAFAPNYMWLIILRCLVGLGLGGG-PQLASWYLEFLPAKSRGTWMVLFSVFWTVGTIFEASLAWLVMPRLG--------- 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 272 hfhsWRVFVIVCALPATVSMVALKFMPESprfllemgkhdeawmilkqvhdtnmrakgtpekvftvshiktpkqmdefie 351
Cdd:cd17372   151 ----WRWLLAFSSVPSSLLLVFYRWTPKT--------------------------------------------------- 175
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyrmnTLILAVVWFTMALSYYGLtvwfpdmiryfqdeeykskmkvff 431
Cdd:cd17372   176 --------------------------------------TLLLWVIWFGNAFAYYGV------------------------ 193
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 432 gehvhgatINFTMEnqihqhgklvndkfikmyfkhvLFEDTffDKCYFEDVTSTDTYFKNCTiesttfyntdlykhkfin 511
Cdd:cd17372   194 --------VLLTTE----------------------LNNSH--NVCGSKSDSDSGESPTEKQ------------------ 223
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 512 crfinstfleqkegCHMDFEEDndfliYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESA 591
Cdd:cd17372   224 --------------CRNSNDVD-----YRDVFIATFAEFPGLLISAAMIDRLGRKASMASMLFTCCIFLLLLLICQSPFI 284
                         490       500       510       520       530
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1907183268 592 MIGWqcLFCGTSI--AAWNALDVITVELYPTNQRATAFGILNGLCKFGAIL 640
Cdd:cd17372   285 LTVL--LFGGRACisAAFTVVYIYTPEVYPTAVRALGVGTGSSVGRIGAIL 333
MFS_MucK cd17371
Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily; ...
112-310 4.01e-23

Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily; This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340929 [Multi-domain]  Cd Length: 389  Bit Score: 102.00  E-value: 4.01e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17371     1 FWAAFLGWALDGFDLLLLGLVLPALIAEFGLDEAEAGLLGTVTLAGGAIGGILGGILADRFGRVRVLVITILLFAVFTLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtny 271
Cdd:cd17371    81 CGFAQNYWQLLILRALAGLGFGGEWAAGAALMAEYVPARHRGKALGYVQSGWAVGWLLATLLAALLFPLLP--------- 151
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1907183268 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKH 310
Cdd:cd17371   152 PEIAWRVLFLLGALPALLVLFIRRFVKEPPQWQAARAAR 190
Sugar_tr pfam00083
Sugar (and other) transporter;
127-319 1.68e-21

Sugar (and other) transporter;


Pssm-ID: 395036 [Multi-domain]  Cd Length: 452  Bit Score: 97.73  E-value: 1.68e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 127 FVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAF---LF 203
Cdd:pfam00083  28 FFKNFGLSKSVSSLAALSVLSGLIVSIFSVGCFIGSLFAGKLGDRFGRKKSLLIANVLFVIGAVLQGAAKGKWSVyqlIV 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 204 CRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYAsamAWSiiphyGWGFSMGTNYHfhSWRVFVIVC 283
Cdd:pfam00083 108 GRVLVGIGVGGASVLAPMYISEIAPKKLRGALGSLYQLAITFGILLA---YIF-----GLGLNKTSNSD--GWRIPLGLQ 177
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1907183268 284 ALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQ 319
Cdd:pfam00083 178 LVPALLLIIGLLFLPESPRWLVEKGRLEEAREVLAK 213
MFS_SVOP cd17441
Synaptic vesicle 2-related protein (SVOP) of the Major Facilitator Superfamily; Synaptic ...
116-304 1.19e-20

Synaptic vesicle 2-related protein (SVOP) of the Major Facilitator Superfamily; Synaptic vesicle 2 (SV2)-related protein (SVOP) is a transporter-like nucleotide binding protein that localizes to neurotransmitter-containing vesicles. Like SV2, SVOP is expressed in all brain regions, with highest levels in cerebellum, hindbrain and pineal gland. Studies with knockout mice suggets that SVOP may perform a subtle function that is not necessary for survival under normal conditions, since mice lacking SVOP are viable, fertile, and phenotypically normal. SVOP shares structural similarity to the solute carrier family 22 (SLC22), a large family of organic cation and anion transporters. This SVOP subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340999 [Multi-domain]  Cd Length: 372  Bit Score: 94.11  E-value: 1.19e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 116 GLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFV 195
Cdd:cd17441     5 GLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMLSSSLWGNISDQYGRKTGLKISVLWTLYYGILSAFA 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 196 QGYGAFLFCRLISGIGIGGsLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtnyhfhs 275
Cdd:cd17441    85 PIYSWILVLRGLVGFGIGG-VPQSVTLYAEFLPMKSRAKCILLIEVFWALGTVFEVLLAVFVMPTLG------------- 150
                         170       180
                  ....*....|....*....|....*....
gi 1907183268 276 WRVFVIVCALPATVSMVALKFMPESPRFL 304
Cdd:cd17441   151 WRWLLILSALPLLIFAVLCFWLPESARYW 179
MFS cd06174
Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse ...
115-672 4.02e-20

Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 349949 [Multi-domain]  Cd Length: 378  Bit Score: 92.87  E-value: 4.02e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 115 LGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSF 194
Cdd:cd06174     1 LLLGFFLTGLARGLISPLLPALLQSFGLSASQLGLLFALFSLGYALLQPLAGLLADRFGRRPVLLLGLLLFALGALLFAF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 195 VQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGfsmgtnyhfh 274
Cdd:cd06174    81 APSFWLLLLGRFLLGLGSGLIDPAVLALIADLFPERERGRALGLLQAFGSVGGILGPLLGGILASSLGFG---------- 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 275 sWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWmilkqvhdtnmrakgtpekvftvshiktpkqmdefieiqs 354
Cdd:cd06174   151 -WRAVFLIAAALALLAAILLLLVVPDPPESARAKNEEASS---------------------------------------- 189
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 355 stgtwyQRWLVRFMTIFKqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIryfqdeeykskmkvffgeh 434
Cdd:cd06174   190 ------KSVLKLLKRVLK--------------NPGLWLLLLAIFLVNLAYYSFSTLLPLFL------------------- 230
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 435 vhgatinftmenqihqhgklvndkfikmyfkhvlfedtffdkcyfedvtstdtyfknctiesttfyntdlykhkfincrf 514
Cdd:cd06174       --------------------------------------------------------------------------------
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 515 instfleqkegchMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDR-IGRLKMIGGSMLISAVCCFFLFFGNSESAMI 593
Cdd:cd06174   231 -------------LDLGGLSVAVAGLLLSLFGLAGALGSLLLGLLSDRlIGRKPLLLIGLLLMALGLALLLLAPSLLLLL 297
                         490       500       510       520       530       540       550
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907183268 594 GWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNglckFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIAL 672
Cdd:cd06174   298 LLLLLLGFGLGGLLPLSFALIAELFPPEIRGTAFGLLN----TFGFLGGAIGPLLAGFLLAATFGLTGAFLVLAVLLLL 372
MFS_XylE_like cd17359
D-xylose-proton symporter and similar transporters of the Major Facilitator Superfamily; This ...
123-309 1.73e-19

D-xylose-proton symporter and similar transporters of the Major Facilitator Superfamily; This subfamily includes bacterial transporters such as D-xylose-proton symporter (XylE or XylT), arabinose-proton symporter (AraE), galactose-proton symporter (GalP), major myo-inositol transporter IolT, glucose transport protein, putative metabolite transport proteins YfiG, YncC, and YwtG, and similar proteins. The symporters XylE, AraE, and GalP facilitate the uptake of D-xylose, arabinose, and galactose, respectively, across the boundary membrane with the concomitant transport of protons into the cell. IolT is involved in polyol metabolism and myo-inositol degradation into acetyl-CoA. The XylE-like subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340917 [Multi-domain]  Cd Length: 383  Bit Score: 91.09  E-value: 1.73e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 123 GVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFL 202
Cdd:cd17359    14 GYDTGVINGALPFLQTDFNLTPFLEGLVVSSALLGAAIGALFAGRLADRFGRRKTLLISAVLFFISALGSAFSPNFTIFI 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 203 FCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSI--IPHYGWGFSMGtnyhfhsWRVFV 280
Cdd:cd17359    94 IARIIGGLAVGGASALVPMYIAEVAPAEIRGRLVSLNQLMIVFGQLLAYIVNYLIanAGGADWLGAEG-------WRWML 166
                         170       180
                  ....*....|....*....|....*....
gi 1907183268 281 IVCALPATVSMVALKFMPESPRFLLEMGK 309
Cdd:cd17359   167 GLEAIPAILFLLGMLFIPESPRWLVSKGK 195
MFS_GLUT6_8_Class3_like cd17358
Glucose transporter (GLUT) types 6 and 8, Class 3 GLUTs, and similar transporters of the Major ...
142-313 5.48e-18

Glucose transporter (GLUT) types 6 and 8, Class 3 GLUTs, and similar transporters of the Major Facilitator Superfamily; This subfamily is composed of glucose transporter type 6 (GLUT6), GLUT8, plant early dehydration-induced gene ERD6-like proteins, and similar insect proteins including facilitated trehalose transporter Tret1-1. GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). Insect Tret1-1 is a low-capacity facilitative transporter for trehalose that mediates the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340916 [Multi-domain]  Cd Length: 436  Bit Score: 86.86  E-value: 5.48e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 142 LSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGG---SLPI 218
Cdd:cd17358    38 LTVAQFSWFGSLLTLGALIGALLSGKLADRIGRKRTLLISAIPCILGWLLIAFAKDVWMLYLGRFLAGFGGGAasvVVPV 117
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 219 vfaYFSEFLSREKRGEhLSWLGIFWMTGGIYAsamawsiiphygwGFSMGTnyhFHSWRVFVIVCALPATVSMVALKFMP 298
Cdd:cd17358   118 ---YIAEIAPKNVRGA-LGSLNQLLVNIGILL-------------GYVLGS---FLPWRTLALIGAIPPVVFLILLFFIP 177
                         170
                  ....*....|....*
gi 1907183268 299 ESPRFLLEMGKHDEA 313
Cdd:cd17358   178 ESPRWLAKKGREEEA 192
MFS_1 pfam07690
Major Facilitator Superfamily;
115-302 2.78e-17

Major Facilitator Superfamily;


Pssm-ID: 369468 [Multi-domain]  Cd Length: 346  Bit Score: 83.63  E-value: 2.78e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 115 LGLALMADGVEIFVVSFALPSA-EKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSS 193
Cdd:pfam07690   1 LFLAAFLAALGRSLLGPALPLLlAEDLGISPTEIGLLLTLFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 194 FVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFsmgtnyhf 273
Cdd:pfam07690  81 FASSLWLLLVLRVLQGLGAGALFPAAAALIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLFGWRA-------- 152
                         170       180
                  ....*....|....*....|....*....
gi 1907183268 274 hswrVFVIVCALPATVSMVALKFMPESPR 302
Cdd:pfam07690 153 ----AFLILAILSLLAAVLAALLLPRPPP 177
MFS_SVOPL cd17442
Synaptic vesicle 2 (SV2)-related protein-like (SVOPL) of the Major Facilitator Superfamily; ...
111-300 5.32e-17

Synaptic vesicle 2 (SV2)-related protein-like (SVOPL) of the Major Facilitator Superfamily; Synaptic vesicle 2 (SV2)-related protein-like (SVOPL) or SVOP-like protein is a transporter-like protein that shares structural similarity to the solute carrier family 22 (SLC22), a large family of organic cation and anion transporters. It belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341000 [Multi-domain]  Cd Length: 375  Bit Score: 83.32  E-value: 5.32e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 111 LFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFAS 190
Cdd:cd17442     2 LFLIMGSTGVAEAMEIMLLAVVSPEIRCEWHLEDWQVALVTTMVFFGYMVFSILLGLLADRYGRWKILLLSFVWGAYFSL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 191 LSSFVQGYGAFLFCRLISGIGIGGSLPiVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtn 270
Cdd:cd17442    82 LTSFAPSYIWFVFLRCMVGCGVSGHSQ-GLIIKTEFLPTKYRGYMLPLSQIFWLAGSLLIIGLASVVIPTLG-------- 152
                         170       180       190
                  ....*....|....*....|....*....|
gi 1907183268 271 yhfhsWRVFVIVCALPATVSMVALKFMPES 300
Cdd:cd17442   153 -----WRWLIRFASIPGIILIVVFKFIPRT 177
MFS_GLUT_like cd17315
Glucose transporters (GLUTs) and other similar sugar transporters of the Major Facilitator ...
123-308 9.62e-17

Glucose transporters (GLUTs) and other similar sugar transporters of the Major Facilitator Superfamily; This family is composed of glucose transporters (GLUTs) and other sugar transporters including fungal hexose transporters (HXT), bacterial xylose transporter (XylE), plant sugar transport proteins (STP) and polyol transporters (PLT), H(+)-myo-inositol cotransporter (HMIT), and similar proteins. GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. The GLUT-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340873 [Multi-domain]  Cd Length: 365  Bit Score: 82.24  E-value: 9.62e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 123 GVEIFVVSFALPSAEKDMC--LSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGA 200
Cdd:cd17315    10 GYDLGVINGALLYIAKDLGfgLSTSLQGLVVSSLLLGAAIGSLFGGPLADRFGRRKSLLIAAVLYVIGALLSALAPNVWV 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 201 FLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEhlswLGIFW---MTGGIYASAMAwsiiphygwGFSMGtNYHFHSWR 277
Cdd:cd17315    90 LIVGRFLLGLGVGLASVLVPLYISEIAPAKIRGA----LGTLNqlmITFGILLAYLL---------GLALS-LSPPGWWR 155
                         170       180       190
                  ....*....|....*....|....*....|.
gi 1907183268 278 VFVIVCALPATVSMVALKFMPESPRFLLEMG 308
Cdd:cd17315   156 LMFALAAVPALLQLLLMFFLPESRALLVGVG 186
SP TIGR00879
MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of ...
142-329 1.04e-16

MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273317 [Multi-domain]  Cd Length: 481  Bit Score: 83.16  E-value: 1.04e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 142 LSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLA---INASFASLSSFVQGYGAFLFCRLISGIGIGGSLPI 218
Cdd:TIGR00879  68 YSSSLWGLVVSIFLVGGFIGALFAGWLSDRFGRKKSLLIIALlfvIGAILMGLAAFALSVEMLIVGRVLLGIGVGIASAL 147
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 219 VFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASamawsiiphygwGFSMGTNYHFHS--WRVFVIVCALPATVSMVALKF 296
Cdd:TIGR00879 148 VPMYLSEIAPKALRGALTSLYQLAITFGILVAY------------GFGSGKVSLNNTlgWRIPLGLQLIPAGLLFLGLFF 215
                         170       180       190
                  ....*....|....*....|....*....|...
gi 1907183268 297 MPESPRFLLEMGKHDEAWMILKQVHDTNMRAKG 329
Cdd:TIGR00879 216 LPESPRWLVGKGRVEEARKSLARLRGTSGEDKE 248
MFS_SLC22 cd17317
Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major ...
137-675 2.52e-15

Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily; The Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters includes organic cation transporters (OCTs), organic zwitterion/cation transporters (OCTNs), and organic anion transporters (OATs). SLC22 transporters interact with a variety of compounds that include drugs of abuse, environmental toxins, opioid analgesics, antidepressant and anxiolytic agents, and neurotransmitters and their metabolites. The SLC22 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340875 [Multi-domain]  Cd Length: 331  Bit Score: 77.62  E-value: 2.52e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 137 EKDMCLSSSKKGMLGLIVY-LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGS 215
Cdd:cd17317    16 EWDLVCDRDWLVALVQTIFfLGVLIGSLLFGYLADRFGRRPVLLLGLVLQIVCGVLSAFSPSYELFLVLRFLVGVTSAGI 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 216 LPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAwsiiphygwgfsmgtnYHFHSWRVFVIVCALPATVSMVALK 295
Cdd:cd17317    96 FTVGFVLGMEIVGPKYRSFVGILFGLFWALGYMLLALLA----------------YLIRDWRWLQLAISLPGLLFLLLLW 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 296 FMPesprfllemgkhdeawmilkqvhdtnmrakgtpekvftvshiktpkqmdefieiqsstgtwyqrwlvrfmtifkqvw 375
Cdd:cd17317   160 WLP----------------------------------------------------------------------------- 162
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 376 dnalycvmgpyrMNTLILAVVWFTMALSYYGLTvwfpdmiryfqdeeykskmkvffgehvhgatinftmenqihqhgklv 455
Cdd:cd17317   163 ------------RRTIIVGLIWFVTSLVYYGLS----------------------------------------------- 183
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 456 ndkfikmyfkhvlfedtffdkcyfedvtstdtyfknctiesttFYNTDLYKHKFINcrfinstfleqkegchmdfeednd 535
Cdd:cd17317   184 -------------------------------------------LNSSNLGGNLYLN------------------------ 196
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 536 fliylvSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFF-LFFGNSES------AMIGwqcLFCGTsiAAWN 608
Cdd:cd17317   197 ------FFLSGLVEIPAYFLALLLLDRLGRRWTLSGSLLLAGLACLVtALLPDDENtlaltlALVG---KFAIS--AAFS 265
                         490       500       510       520       530       540
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1907183268 609 ALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIfASFVGITKVVP-ILLAAASLVgGGLIALRLP 675
Cdd:cd17317   266 VIYLYTAELYPTVVRNTGVGLCSTVARVGAILAPFI-VLLGKIGPLLPlIIFGVLALL-GGLLTLLLP 331
MFS_SLC46_TetA_like cd17330
Eukaryotic Solute carrier 46 (SLC46) family, Bacterial Tetracycline resistance proteins, and ...
111-305 4.98e-15

Eukaryotic Solute carrier 46 (SLC46) family, Bacterial Tetracycline resistance proteins, and similar proteins of the Major Facilitator Superfamily of transporters; This family is composed of the eukaryotic proteins MFSD9, MFSD10, MFSD14, and SLC46 family proteins, as well as bacterial multidrug resistance (MDR) transporters such as tetracycline resistance protein TetA and multidrug resistance protein MdtG. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. TetA proteins confer resistance to tetracycline while MdtG confers resistance to fosfomycin and deoxycholate. The Solute carrier 46 (SLC46) family is composed of three vertebrate members (SLC46A1, SLC46A2, and SLC46A3), the best-studied of which is SLC46A1, which functions both as an intestinal proton-coupled high-affinity folate transporter involved in the absorption of folates and as an intestinal heme transporter which mediates heme uptake. MFSD10 facilitates the uptake of organic anions such as some non-steroidal anti-inflammatory drugs (NSAIDs) and confers resistance to such NSAIDs. The SLC46/TetA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340888 [Multi-domain]  Cd Length: 349  Bit Score: 76.85  E-value: 4.98e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 111 LFFVLGLALMADGVEIFVVSFALPSAeKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFAS 190
Cdd:cd17330     1 LFLVVFLDALGFGIVFPVLPFYVREF-NKLGASGYYVGLLQSSYSLGQFLASPLWGRLSDRYGRKPVLLLSLAGSAVSYV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 191 LSSFVQGYGAFLFCRLISGIGiGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYgwGFSMgtn 270
Cdd:cd17330    80 LLGLSRNLWLLFLARFLDGLT-GGNVSVAQAYIADITDEEERAKAFGIISAAFGLGFILGPALGGFLSTPY--GYAL--- 153
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 1907183268 271 yhfhswrVFVIVCALPATVSMVALKFMPESPRFLL 305
Cdd:cd17330   154 -------PFLVAAALALLNLVLVLFFLPPLRRLLL 181
MFS_HXT cd17356
Fungal Hexose transporter subfamily of the Major Facilitator Superfamily of transporters and ...
142-305 8.82e-15

Fungal Hexose transporter subfamily of the Major Facilitator Superfamily of transporters and similar proteins; The fungal hexose transporter (HXT) subfamily is comprised of functionally redundant proteins that function mainly in the transport of glucose, as well as other sugars such as galactose and fructose. Saccharomyces cerevisiae has 20 genes that encode proteins in this family (HXT1 to HXT17, GAL2, SNF3, and RGT2). Seven of these (HXT1-7) encode functional glucose transporters. Gal2p is a galactose transporter, while Rgt2p and Snf3p act as cell surface glucose receptors that initiate signal transduction in response to glucose, functioning in an induction pathway responsible for glucose uptake. Rgt2p is activated by high levels of glucose and stimulates expression of low affinity glucose transporters such as Hxt1p and Hxt3p, while Snf3p generates a glucose signal in response to low levels of glucose, stimulating the expression of high affinity glucose transporters such as Hxt2p and Hxt4p. Schizosaccharomyces pombe contains eight GHT genes (GHT1-8) belonging to this family. Ght1, Ght2, and Ght5 are high-affinity glucose transporters; Ght3 is a high-affinity gluconate transporter; and Ght6 high-affinity fructose transporter. The substrate specificities for Ght4, Ght7, and Ght8 remain undetermined. The HXT subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340914 [Multi-domain]  Cd Length: 403  Bit Score: 76.91  E-value: 8.82e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 142 LSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLF-CRLISGIGIGGSLPIVF 220
Cdd:cd17356    42 PSSSRQGLIVSIVNLGSFFGALISSFLSDRIGRKKSIQIGCVIYIIGAIIQVAAIGKWYQLIvGRIIAGLGVGFASVLVP 121
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 221 AYFSEFLSREKRGehlswlgifwMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPES 300
Cdd:cd17356   122 VYQSEVAPKHIRG----------TLVSLYQLAITIGILVAYCINYGTHKLDGSAQWRIPLGLQIVWGLLLLIGMFFLPES 191

                  ....*
gi 1907183268 301 PRFLL 305
Cdd:cd17356   192 PRWLY 196
PRK11551 PRK11551
putative 3-hydroxyphenylpropionic transporter MhpT; Provisional
116-304 2.15e-14

putative 3-hydroxyphenylpropionic transporter MhpT; Provisional


Pssm-ID: 236927 [Multi-domain]  Cd Length: 406  Bit Score: 75.38  E-value: 2.15e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 116 GLALMADGVeifvvsfALPSAEKDMCLSsskKGMLGLIV---YLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLS 192
Cdd:PRK11551   28 GLDLQSAGV-------AAPRMAQEFGLD---VAQMGWAFsagILGLLPGALLGGRLADRIGRKRILIVSVALFGLFSLAT 97
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 193 SFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWL--GI-FwmtGGIYASAMAWsiiphygwgFSMGT 269
Cdd:PRK11551   98 AQAWDFPSLLVARLLTGVGLGGALPNLIALTSEAVGPRLRGTAVSLMycGVpF---GGALASVIGV---------LAAGD 165
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1907183268 270 NyhfhSWR-VFVIVCALPATVSMVALKFMPESPRFL 304
Cdd:PRK11551  166 A----AWRhIFYVGGVGPLLLVPLLMRWLPESRAFA 197
2A0109 TIGR00887
phosphate:H+ symporter; This model represents the phosphate uptake symporter subfamily of the ...
99-407 2.62e-14

phosphate:H+ symporter; This model represents the phosphate uptake symporter subfamily of the major facilitator superfamily (pfam00083). [Transport and binding proteins, Anions]


Pssm-ID: 129965 [Multi-domain]  Cd Length: 502  Bit Score: 75.92  E-value: 2.62e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268  99 IDECGHGRFQWTLFFVLGLALMADGVEIFVVSFALPSAEK-----DMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLG 173
Cdd:TIGR00887   5 ADTAPFGWQHFRAIVIAGVGFFTDSYDLFCISLVTKMLGYvyyhgKGPLPSSVSAAVNGSASIGTLAGQLFFGWLADKLG 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 174 RKKVLSM--------SLAINASFASLSSFVQGYgaFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSwlGIFWMT 245
Cdd:TIGR00887  85 RKRVYGMeliimiiaTVASGLSPGSSPKSVMAT--LCFWRFWLGVGIGGDYPLSAIITSEFATKKWRGAMMA--AVFAMQ 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 246 G-GIYASAMAWSIIPHygwGFSMGTNY--HFHS------------WRVFVIVCALPATVSMVALKFMPESPRFLLEMGkH 310
Cdd:TIGR00887 161 GfGILAGAIVALIVLA---GFKHSLEAaaDEASctgscvpavdymWRILIGFGAVPALLALYFRLTIPETPRYTADVA-K 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 311 DEAWMILKQVHDTNMRAKGTPEKV-FTVSHIKTPKqmdefieiQSSTGtwyqrwlvrFMTIFKQvWDNALYcvmgpyrmn 389
Cdd:TIGR00887 237 DVEQAASDMSAVLQVKIEAEPDEVeKASTAVEVPK--------ASWSD---------FFTHFFK-WRHGKH--------- 289
                         330
                  ....*....|....*...
gi 1907183268 390 TLILAVVWFTMALSYYGL 407
Cdd:TIGR00887 290 LLGTAGSWFLLDIAFYGV 307
MFS_NepI_like cd17324
Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator ...
113-303 3.33e-14

Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily; This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340882 [Multi-domain]  Cd Length: 370  Bit Score: 74.51  E-value: 3.33e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 113 FVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLS 192
Cdd:cd17324     2 LALALAAFAIGTTEYVIQGLLPDIARDFGVSVAQAGLLVSAYALGYALGALLLGPLSDRIERRRLLLVLLLLFILGNLLA 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 193 SFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtnyh 272
Cdd:cd17324    82 ALAPSFALLLLARALAGLAHGGFWAIAAAYAADLVPPEKRGRAIGLVFSGLTLGLVLGRPLGGLLGQLLG---------- 151
                         170       180       190
                  ....*....|....*....|....*....|..
gi 1907183268 273 fhsWR-VFVIVCALPATVSMVALKFMPESPRF 303
Cdd:cd17324   152 ---WRaAFLAIAVLALLAALLLWRLLPSLPPK 180
MFS_HMIT_like cd17360
H(+)-myo-inositol cotransporter and similar transporters of the Major Facilitator Superfamily; ...
128-302 3.54e-14

H(+)-myo-inositol cotransporter and similar transporters of the Major Facilitator Superfamily; This subfamily is composed of myo-inositol/inositol transporters and similar transporters from vertebrates, plant, and fungi. The human protein is called H(+)-myo-inositol cotransporter/Proton myo-inositol cotransporter (HMIT), or H(+)-myo-inositol symporter, or Solute carrier family 2 member 13 (SLC2A13). HMIT is classified as a Class 3 GLUT (glucose transporter) based on sequence similarity with GLUTs, but it does not transport glucose. It specifically transports myo-inositol and is expressed predominantly in the brain, with high expression in the hippocampus, hypothalamus, cerebellum and brainstem. HMIT may be involved in regulating processes that require high levels of myo-inositol or its phosphorylated derivatives, such as membrane recycling, growth cone dynamics, and synaptic vesicle exocytosis. Arabidopsis Inositol transporter 4 (AtINT4) mediates high-affinity H+ symport of myo-inositol across the plasma membrane. The HMIT-like subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340918 [Multi-domain]  Cd Length: 362  Bit Score: 74.61  E-value: 3.54e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 128 VVSFALPSAEKDMCLSSSKKGMLGLIV---YLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFC 204
Cdd:cd17360    15 VISGALLYIKDDLGEVVLSTGWQELIVsstVAGAAVGAAIGGWLNDRFGRRPCILLADALFTIGAIVMAAAPNKEVLIVG 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 205 RLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSwLGIFWMTGGIYASAMawsiiphYGWGFSmgtnyHFH-SWRVFVIVC 283
Cdd:cd17360    95 RVLVGLGVGIASMTVPLYIAEAAPPRIRGRLVT-INVLFITGGQFVAYV-------INGAFS-----YLPgGWRWMLGLA 161
                         170
                  ....*....|....*....
gi 1907183268 284 ALPATVSMVALKFMPESPR 302
Cdd:cd17360   162 AVPAVLQFIGLLFLPESPR 180
MFS_ExuT_GudP_like cd17319
Hexuronate transporter, Glucarate transporter, and similar transporters of the Major ...
110-263 3.82e-13

Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily; This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340877 [Multi-domain]  Cd Length: 358  Bit Score: 71.45  E-value: 3.82e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 110 TLFFVLGLALMADGVeifVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFA 189
Cdd:cd17319     6 PLLFLAYVINYLDRV---NISVAAPTIMKDLGLSPTQYGLIASAFFLGYALFQVPGGWLLDRFGARKVLAVSMLLWSLFT 82
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1907183268 190 SLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGW 263
Cdd:cd17319    83 ALTGFATSLTSLYVLRFLLGVAEAGFFPGAIKALAEWFPARERGRATGLFNSGAPLGAAIGPPLSGWLLLLFGW 156
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
106-267 1.70e-12

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 69.53  E-value: 1.70e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 106 RFQWTLFFVLGLALMADGVEIFVVSFALPS-AEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAI 184
Cdd:cd17325   195 LLRDRRLLALFLAIFVLAFAFGALEPFLPLyAAELGGLSPAQIGLLFGAQGLASALSQPPAGKLSDRIGRKPLILIGLLL 274
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 185 NASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWG 264
Cdd:cd17325   275 SAVALLLLPLATSFWLLLLLLALLGLGLGLVFPATLALLADIVPPEGRGTAMGLFNTAFSLGMVLGPLLGGFLYDAFGFA 354

                  ...
gi 1907183268 265 FSM 267
Cdd:cd17325   355 TPF 357
MFS_GLUT_Class1_2_like cd17357
Class 1 and Class 2 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; This ...
153-328 1.76e-12

Class 1 and Class 2 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; This subfamily includes Class 1 and Class 2 glucose transporters (GLUTs) including Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1, also called glucose transporter type 1 or GLUT1), SLC2A2-5 (GLUT2-5), SLC2A7 (GLUT7), SLC2A9 (GLUT9), SLC2A11 (GLUT11), SLC2A14 (GLUT14), and similar proteins. GLUTs are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUTs 1-5 are the most thoroughly studied and are well-established as glucose and/or fructose transporters in various tissues and cell types. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340915 [Multi-domain]  Cd Length: 447  Bit Score: 69.98  E-value: 1.76e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 153 IVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN---ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSR 229
Cdd:cd17357    57 IFFIGGAIGSFISAFLANRFGRKNGLLISNALLvvsSLLMFLSKSAKSPELLIFGRFLVGIACGLSTGFVPMYLQEISPS 136
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 230 EKRGEHLSWLGIFWMTGGIYASAMAWSIIphygwgfsMGTNYHfhsWRVFVIVCALPATVSMVALKFMPESPRFLL-EMG 308
Cdd:cd17357   137 ELRGALGSLTQIGVTLGILLGQVFGLPSV--------LGTETL---WPYLLFFPGIPALLQLAALPFFPESPKFLLiSKG 205
                         170       180
                  ....*....|....*....|
gi 1907183268 309 KHDEAWMILKQVHDTNMRAK 328
Cdd:cd17357   206 DEEEAEKSLKFLRGIEDDVD 225
MFS_spinster_like cd17328
Protein spinster and spinster homologs of the Major Facilitator Superfamily of transporters; ...
127-311 7.65e-12

Protein spinster and spinster homologs of the Major Facilitator Superfamily of transporters; The protein spinster family includes Drosophila protein spinster, its vertebrate homologs, and similar proteins. Humans contain three homologs called protein spinster homologs 1 (SPNS1), 2 (SPNS2), and 3 (SPNS3). Protein spinster and its homologs may be sphingolipid transporters that play central roles in endosomes and/or lysosomes storage. SPNS2 is also called sphingosine 1-phosphate (S1P) transporter and is required for migration of myocardial precursors. S1P is a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. The spinster-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340886 [Multi-domain]  Cd Length: 405  Bit Score: 67.65  E-value: 7.65e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 127 FVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRL 206
Cdd:cd17328    16 FTIAGVLPDIQSDFLIDDSLAGLLQTVFIISYMVLSPIFGYLGDRYNRKWILAVGILIWSAATLLSSFAPNFWQLLLFRA 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 207 ISGIGIGGSLPIVFAYFSEFLSREKRGehlSWLGIFWMtgGIY-ASAMAwsiiphYGWGFSMGTnyHFHSWRV-FVIVCA 284
Cdd:cd17328    96 LVGIGEASYSPIAPTIIADLFPKEKRT---RALGVFYF--AIPlGSGLG------YVVGGLVAQ--ATGGWRWaFRVTGV 162
                         170       180
                  ....*....|....*....|....*..
gi 1907183268 285 LPATVSMVALKFMPESPRFLLEMGKHD 311
Cdd:cd17328   163 LGVLLAILLLLFVREPPRGAAEGGVMA 189
MFS_PhT cd17364
Inorganic Phosphate Transporter of the Major Facilitator Superfamily of transporters; This ...
114-287 1.37e-11

Inorganic Phosphate Transporter of the Major Facilitator Superfamily of transporters; This subfamily is composed of predominantly fungal and plant high-affinity inorganic phosphate transporters (PhT or PiPT), which are involved in the uptake, translocation, and internal transport of inorganic phosphate. They also function in sensing external phosphate levels as transceptors. Phosphate is crucial for structural and metabolic needs, including nucleotide and lipid synthesis, signalling and chemical energy storage. The Pht subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340922 [Multi-domain]  Cd Length: 389  Bit Score: 66.92  E-value: 1.37e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 114 VLGLALMADGVEIFVVSFALPSAE-----KDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASF 188
Cdd:cd17364     3 IAGMGFFTDAYDLFSISLVTKILGrlyygGKGSLPSGVSGLVNAAALVGTIIGQLFFGFLGDRFGRKRVYGVELIIMIIG 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 189 ASLSSFVQG------YGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYG 262
Cdd:cd17364    83 TILSALSPGstplgvMGWLIFFRFLLGIGIGGDYPLSATIMSEYANKKRRGALIAAVFAMQGFGILAGAIVTLILSAIFE 162
                         170       180
                  ....*....|....*....|....*.
gi 1907183268 263 WGFSMGTNYHFH-SWRVFVIVCALPA 287
Cdd:cd17364   163 HPLPAGTYHHADlVWRIVLGLGAIPA 188
MFS_GLUT10_12_Class3_like cd17362
Glucose transporter (GLUT) types 10 and 12, Class 3 GLUTs, and similar transporters of the ...
123-303 1.80e-11

Glucose transporter (GLUT) types 10 and 12, Class 3 GLUTs, and similar transporters of the Major Facilitator Superfamily; This subfamily is composed of glucose transporter type 10, GLUT12, plant polyol transporters (PLTs), and similar proteins. GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340920 [Multi-domain]  Cd Length: 389  Bit Score: 66.22  E-value: 1.80e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 123 GVEIFVVSFALPSAEKDMC-------LSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFV 195
Cdd:cd17362    10 GYDIGATSGALLSITSPALsgtdwynLSSLQSGLVVSGSLLGALLGSLVAGALIDRLGRRKELILAALLYLVGSLVTGLA 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 196 QGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSwLGIFWMTGGIYASamawsiiphYGWGFSMGTNyhFHS 275
Cdd:cd17362    90 PSYPVLLVGRLIYGVGIGLAMHAAPVYIAETSPSHIRGLLVS-LKELFIVLGILLG---------YVSGYAFADV--VGG 157
                         170       180
                  ....*....|....*....|....*...
gi 1907183268 276 WRVFVIVCALPATVSMVALKFMPESPRF 303
Cdd:cd17362   158 WRYMYGLAAPPALLLGIGMWFLPPSPRW 185
MFS_OCT_plant cd17378
Plant organic cation/carnitine transporters of the Major Facilitator Superfamily of ...
535-675 3.58e-11

Plant organic cation/carnitine transporters of the Major Facilitator Superfamily of transporters; Plant organic cation/carnitine transporters (OCTs) are sequence-similar to their animal counterparts, which are broad-specificity transporters that play a critical role in the excretion and distribution of endogeneous organic cations and for the uptake, elimination and distribution of cationic drugs, toxins, and environmental waste products. Little is know about plant OCTs. In Arabidopsis, there are six genes belonging to this family that show distinct, organ-specific expression pattern of the individual genes. AtOCT1 has been found to affect root development and carnitine-related responses in Arabidopsis. AtOCT4, 5 and 6 are up-regulated during drought stress, AtOCT3 and 5 during cold stress and AtOCT5 and 6 during salt stress treatments. Plant OCTs belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340936 [Multi-domain]  Cd Length: 342  Bit Score: 65.07  E-value: 3.58e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 535 DFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFgnSESAMIGWQCLFCGT-----SIAAWNA 609
Cdd:cd17378   200 KFNIYLSVALNALSELPAFVITAFLLDRFGRRPSLLGFTLLSGASCLLCFV--LSIGGTTSLQIALELvgffgAAGAFNL 277
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907183268 610 LDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLiALRLP 675
Cdd:cd17378   278 LYIYTVELFPTCVRNAALGMLRQALVVGGIFAPFIVSLGRKNAALSFGVFGVAILLLGLF-ALGLP 342
MFS_YfmO_like cd17474
Bacillus subtilis multidrug efflux protein YfmO and similar transporters of the Major ...
109-302 5.43e-11

Bacillus subtilis multidrug efflux protein YfmO and similar transporters of the Major Facilitator Superfamily; This family is composed of Bacillus subtilis multidrug efflux protein YfmO, bacillibactin exporter YmfD/YmfE, uncharacterized MFS-type transporter YvmA, and similar proteins. YfmO acts to efflux copper or a copper complex, and could contribute to copper resistance. YmfD/YmfE is involved in secretion of bacillibactin. The YfmO-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341027 [Multi-domain]  Cd Length: 374  Bit Score: 64.90  E-value: 5.43e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 109 WTLFFVLGLALMAdgveIFVVSFALPSAEKDMCLSSSkkgMLGLIVYLGMMAGAF---ILGGLADKLGRKKVLSMSLAIN 185
Cdd:cd17474     2 YAVFFATLLAVLG----VSIVDPILPAIAEALGASPA---QVGLLITAFTLPAAVlmpVAGVLADRFGRKKVLLPGLLLF 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 186 ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLswlgifwmtgGIYASAM--AWSIIPHYGw 263
Cdd:cd17474    75 GIGGLLCGLSDSFALLLAGRALQGIGAAGLGPLALTLIGDLFEGGERAKAM----------GLYEAALglGIAVGPLLG- 143
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1907183268 264 GFsMGTnyhfHSWRVFVIVCALPATVSMVALKFMPESPR 302
Cdd:cd17474   144 GL-LAA----ISWRYPFFLLAALIPVAFLAILFLLPEPK 177
MFS_PLT cd17437
Plant Polyol transporter family of the Major Facilitator Superfamily of transporters; The ...
123-303 7.26e-11

Plant Polyol transporter family of the Major Facilitator Superfamily of transporters; The plant Polyol transporter (PLT) subfamily includes PLT1-6 from Arabidopsis thaliana and similar transporters. The best characterized member of the group is Polyol transporter 5, also called Sugar-proton symporter PLT5, which mediates the H+-symport of numerous substrates including linear polyols (such as sorbitol, xylitol, erythritol or glycerol), cyclic polyol myo-inositol, and different hexoses, pentoses (including ribose), tetroses, and sugar alcohols. It functions to transport a wide range of substrates into specific sink tissues in the plant. The PLT subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340995 [Multi-domain]  Cd Length: 387  Bit Score: 64.34  E-value: 7.26e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 123 GVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFL 202
Cdd:cd17437    10 GYDIGVMSGAVIFIKEDLKISDVQEEVLIGSLNIISLVGSLAAGRTSDWIGRRYTIALAALIFFVGALLMGVAPNYPVLM 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 203 FCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFwMTGGI---YASAMAWSiiphygwGFSMGTNyhfhsWRVF 279
Cdd:cd17437    90 VGRFVAGIGVGFALMIAPVYTAEVAPASSRGFLTSFPEIF-INIGIllgYVSNYAFS-------GLPLHVG-----WRLM 156
                         170       180
                  ....*....|....*....|....
gi 1907183268 280 VIVCALPATVSMVALKFMPESPRF 303
Cdd:cd17437   157 LGVGAVPSLFLAIGVLAMPESPRW 180
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
115-302 8.12e-11

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 64.13  E-value: 8.12e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 115 LGLALMADGVEIFVVSFALPSAEKDMCLSSSkkgMLGLIV---YLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17325     1 LSLALFLDMLGYGIIIPILPLYAESLGASVA---QIGLIVaayALAQLLFSPPAGRLSDRFGRKRLLLLGLLLLAVSTLL 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFsmgtny 271
Cdd:cd17325    78 FAFATSYWQLLLARFLQGLASAAVWPAAMALIADIAPPEERGRAMGIFSSAIGLGFLIGPLLGGLLADALGYRA------ 151
                         170       180       190
                  ....*....|....*....|....*....|..
gi 1907183268 272 hfhswrVFvIVCALPATVSMV-ALKFMPESPR 302
Cdd:cd17325   152 ------PF-LVCAALALLALVlALLLLPEPRP 176
AraJ COG2814
Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];
106-258 1.40e-10

Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];


Pssm-ID: 225371 [Multi-domain]  Cd Length: 394  Bit Score: 63.79  E-value: 1.40e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN 185
Cdd:COG2814     9 KPMWLALLALALAAFAIGTTEFVPVGLLPPIAADLGVSEGAAGQLITAYALGVALGAPLLALLTGRLERRRLLLGLLALF 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 186 ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKR-------------------------GEHLSWLG 240
Cdd:COG2814    89 IVSNLLSALAPSFAVLLLARALAGLAHGVFWSIAAALAARLVPPGKRgralalvftgltlatvlgvplgtflGQLFGWRA 168
                         170
                  ....*....|....*...
gi 1907183268 241 IFWMTGGIYASAMAWSII 258
Cdd:COG2814   169 TFLAIAVLALLALLLLWK 186
MFS_GLUT8_Class3 cd17433
Glucose transporter type 8, a Class 3 GLUT, of the Major Facilitator Superfamily of ...
130-318 2.18e-10

Glucose transporter type 8, a Class 3 GLUT, of the Major Facilitator Superfamily of transporters; Glucose transporter type 8 (GLUT8) is also called Solute carrier family 2, facilitated glucose transporter member 8 (SLC2A8) or glucose transporter type X1 (GLUTX1). It is classified as a Class 3 GLUT protein and is an insulin-regulated facilitative glucose transporter predominantly expressed in testis and brain. It can also transport fructose and galactose. SLC2A8 knockout mice were viable, developed normally, and display only a very mild phenotype, including mild alterations in the brain (increased proliferation of hippocampal neurons), heart (impaired transmission of electrical wave through the atrium), and sperm cells (reduced number of motile sperm cells). GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340991 [Multi-domain]  Cd Length: 416  Bit Score: 62.97  E-value: 2.18e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 130 SFALPSAEK----DMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSM-SLAINASFASLSSfVQGYGAFLFC 204
Cdd:cd17433    22 SPAIPSLQRiadpALRLDDAAASWFGSVVTLGAAAGGVLGGWIVDRAGRKLSLMLcSVPFIAGFTVITA-AQNVWMLYVG 100
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 205 RLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsiiphygwgfsmgtnyhFHSWRVFVIVCA 284
Cdd:cd17433   101 RLLTGLASGVTSLVVPVYISEIAHPRVRGTLGSCVQLMVVIGIMGAYLAGL-----------------VLDWRWLAVLGS 163
                         170       180       190
                  ....*....|....*....|....*....|....
gi 1907183268 285 LPATVSMVALKFMPESPRFLLEMGKHDEAWMILK 318
Cdd:cd17433   164 IPPTLMLLLMCFMPETPRFLLTQHRRQEAMAALR 197
MFS_1 pfam07690
Major Facilitator Superfamily;
537-680 2.93e-10

Major Facilitator Superfamily;


Pssm-ID: 369468 [Multi-domain]  Cd Length: 346  Bit Score: 62.44  E-value: 2.93e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 537 LIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCL---FCGTSIAAWNAldvI 613
Cdd:pfam07690  33 EIGLLLTLFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLLFASSLWLLLVLRVLqglGAGALFPAAAA---L 109
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907183268 614 TVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGIT--KVVPILLAAASLVGGGLIALRLPETREQ 680
Cdd:pfam07690 110 IADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLFgwRAAFLILAILSLLAAVLAALLLPRPPPE 178
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
534-680 6.80e-10

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 61.44  E-value: 6.80e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 534 NDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVI 613
Cdd:cd17325    29 SVAQIGLIVAAYALAQLLFSPPAGRLSDRFGRKRLLLLGLLLLAVSTLLFAFATSYWQLLLARFLQGLASAAVWPAAMAL 108
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 614 TVELYPTNQRATAFGILNGLCKFGAILGNTI---FASFVGItKVVPILLAAASLVGGGLIALRLPETREQ 680
Cdd:cd17325   109 IADIAPPEERGRAMGIFSSAIGLGFLIGPLLgglLADALGY-RAPFLVCAALALLALVLALLLLPEPRPP 177
MFS_OCT_plant cd17378
Plant organic cation/carnitine transporters of the Major Facilitator Superfamily of ...
135-307 1.00e-09

Plant organic cation/carnitine transporters of the Major Facilitator Superfamily of transporters; Plant organic cation/carnitine transporters (OCTs) are sequence-similar to their animal counterparts, which are broad-specificity transporters that play a critical role in the excretion and distribution of endogeneous organic cations and for the uptake, elimination and distribution of cationic drugs, toxins, and environmental waste products. Little is know about plant OCTs. In Arabidopsis, there are six genes belonging to this family that show distinct, organ-specific expression pattern of the individual genes. AtOCT1 has been found to affect root development and carnitine-related responses in Arabidopsis. AtOCT4, 5 and 6 are up-regulated during drought stress, AtOCT3 and 5 during cold stress and AtOCT5 and 6 during salt stress treatments. Plant OCTs belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340936 [Multi-domain]  Cd Length: 342  Bit Score: 60.45  E-value: 1.00e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 135 SAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLAD-KLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIG 213
Cdd:cd17378    23 SEWGLICAGSFLVGLPQSSFFVGCLIGSGVLGHLADsSLGRKNLLFLSCLLMALSGIATAFSPNYWVYAFLRFLTGFGRS 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 214 GSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsiiphygwgfsmgtnYHFHSWRVFVIVCALPATVSMVA 293
Cdd:cd17378   103 GIGTCALVLATEPVGPKWRGQVGMSTFFFFVLGFMSLPGIAY---------------LNGSSWRVLYFWTSIPALIYCIL 167
                         170
                  ....*....|....
gi 1907183268 294 LKFMPEspRFLLEM 307
Cdd:cd17378   168 VYLFAR--RLLAVM 179
ProP COG0477
MFS family permease [Carbohydrate transport and metabolism, Amino acid transport and ...
109-317 1.74e-09

MFS family permease [Carbohydrate transport and metabolism, Amino acid transport and metabolism, Inorganic ion transport and metabolism, General function prediction only];


Pssm-ID: 223553 [Multi-domain]  Cd Length: 338  Bit Score: 59.70  E-value: 1.74e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 109 WTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKK--GMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINA 186
Cdd:COG0477     1 KRSLLALALAALLLGLDLGLLSPALPLLLSTLSLSSGRLlyGLLLSAFFLGYAIGSLLAGPLGDRYGRRKVLIIGLLLFL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 187 SFASLSSFV--QGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLS-REKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGW 263
Cdd:COG0477    81 LGTLLLALApnVGLALLLILRLLQGLGGGGLLPVASALLSEWFPeATERGLAVGLVTLGAGALGLALGPLLAGLLLGALL 160
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....
gi 1907183268 264 GFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMIL 317
Cdd:COG0477   161 WGWRAAFLLAALLGLLLLILVLLLDLLLAAPRLPLAVGLALIELGKLLLLLLIL 214
MFS cd06174
Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse ...
106-294 2.21e-09

Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 349949 [Multi-domain]  Cd Length: 378  Bit Score: 59.75  E-value: 2.21e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKL-GRKKVLSMSLAI 184
Cdd:cd06174   200 LKNPGLWLLLLAIFLVNLAYYSFSTLLPLFLLDLGGLSVAVAGLLLSLFGLAGALGSLLLGLLSDRLiGRKPLLLIGLLL 279
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 185 NASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAwsiiphyGWG 264
Cdd:cd06174   280 MALGLALLLLAPSLLLLLLLLLLLGFGLGGLLPLSFALIAELFPPEIRGTAFGLLNTFGFLGGAIGPLLA-------GFL 352
                         170       180       190
                  ....*....|....*....|....*....|
gi 1907183268 265 FSMGTNYHFhswrVFVIVCALPATVSMVAL 294
Cdd:cd06174   353 LAATFGLTG----AFLVLAVLLLLAAILLL 378
MFS_SLC22A7_OAT2 cd17447
Solute carrier family 22 member 7 (also called Organic anion transporter 2) of the Major ...
153-298 2.74e-09

Solute carrier family 22 member 7 (also called Organic anion transporter 2) of the Major Facilitator Superfamily of transporters; Solute carrier family 22 member 7 (SLC22A7), also called organic anion transporter 2 (OAT2) mediates sodium-independent transport of a variety of organic anions including prostaglandin E2, prostaglandin F2, tetracycline, bumetanide, estrone sulfate, glutarate, dehydroepiandrosterone sulfate, allopurinol, 5-fluorouracil, paclitaxel, L-ascorbic acid, salicylate, ethotrexate, and alpha-ketoglutarate. It also plays a role in renal uric acid uptake from blood as a first step of tubular secretion. OAT2 belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS)of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341005 [Multi-domain]  Cd Length: 341  Bit Score: 59.36  E-value: 2.74e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 153 IVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSRekr 232
Cdd:cd17447    43 FFFAGVTMGAVAFGYLSDRFGRKRMLLVAYVLSLVFGLASAFSVSYVMFAITRTLTGFALTGFSIISMVLCVEWVDI--- 119
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907183268 233 gEHLSWLGIFwmtggiyaSAMAWSIiphyGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMP 298
Cdd:cd17447   120 -EHRTVAGVL--------ISLFWTV----GNMLLALVAYLIRDWRWLILAVTLPCAPGIITWWWVP 172
MFS_MdfA_MDR_like cd17320
Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major ...
156-301 2.83e-09

Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340878 [Multi-domain]  Cd Length: 379  Bit Score: 59.51  E-value: 2.83e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEH 235
Cdd:cd17320    45 LGFALGQLLYGPLSDRFGRRPVLLAGLLLFILASLLCALASSIEQLLIARFLQGLGAAAGSVVARAIVRDLYSGAELAKI 124
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907183268 236 LSWLGIFWMTGGIYASAMAWSIIPHYGWgfsmgtnyhfHSwrVFVIVCALPATVSMVALKFMPESP 301
Cdd:cd17320   125 FSLLMMILAIAPALAPLLGGLLLLFFGW----------RA--IFVFLALLGLLLLLLVLLFLPETL 178
MFS_MMR_MDR_like cd17321
Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance ...
115-264 4.04e-09

Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This family is composed of bacterial, fungal, and archaeal multidrug resistance (MDR) transporters including several proteins from Bacilli such as methylenomycin A resistance protein (also called MMR peptide), tetracycline resistance protein (TetB), and lincomycin resistance protein LmrB, as well as fungal proteins such as vacuolar basic amino acid transporters, which are involved in the transport into vacuoles of the basic amino acids histidine, lysine, and arginine in Saccharomyces cerevisiae, and aminotriazole/azole resistance proteins. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin while TetB resistance to tetracycline by an active tetracycline efflux. MMR-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340879 [Multi-domain]  Cd Length: 370  Bit Score: 58.72  E-value: 4.04e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 115 LGLALMADGVEIFVVSFALPSAEKDMCLSSSkkgMLGLIV--YLgMMAGAFIL--GGLADKLGRKKVLSMSLAINAsFAS 190
Cdd:cd17321     1 LLLAVFLAALDVTIVNVALPTIARDLGASPS---QLQWVVnaYL-LAFAALLLlaGRLGDRFGRKRVFLIGLALFG-LAS 75
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1907183268 191 -LSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWG 264
Cdd:cd17321    76 lLCALAPSLAFLIAARALQGIGAAAIMPASLALIAATFPGERRGRALGLWGAVVGIGAALGPLLGGLLLELFGWR 150
MFS_GLUT_Class1 cd17431
Class 1 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; GLUTs, also called ...
153-323 1.89e-08

Class 1 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUTs 1-4 are well-established as glucose and/or fructose transporters in various tissues and cell types. GLUT1, also called solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), displays broad substrate specificity and can transport a wide range of pentoses and hexoses including glucose, galactose, mannose, and glucosamine. It is found in the brain, erythrocytes, and in many fetal tissues. GLUT2 (or SLC2A2) is found in the liver, islet of Langerhans, intestine, and kidney, and is the isoform that likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by beta cells. GLUT3 (or SLC2A3) is found in the brain and can mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and dehydroascorbate. GLUT4 (or SLC2A4) is an insulin-regulated facilitative glucose transporter found in adipose tissues, and in skeletal and cardiac muscle. GLUT14 (or SLC2A14) is an orphan transporter expressed mainly in the testis. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340989 [Multi-domain]  Cd Length: 445  Bit Score: 56.96  E-value: 1.89e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 153 IVYLGMMAGAFILGGLADKLGRKKVLSMS--LAI-NASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSR 229
Cdd:cd17431    58 IFSVGGMIGSFSVGLFVNRFGRRNSMLYNnlLAFaGAALMGLSKLAKSYEMLILGRFIIGLYCGLTTGLVPMYIGEISPT 137
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 230 EKRGE--HLSWLGIfwmTGGIYASAMawsiiphYGWGFSMGTNYHFHSWRVFVIVcalPATVSMVALKFMPESPRFLL-E 306
Cdd:cd17431   138 ALRGAlgTLHQLGI---VVGILISQI-------FGLEFILGTEELWPLLLGFTIV---PAILQLALLPFCPESPRYLLiN 204
                         170
                  ....*....|....*..
gi 1907183268 307 MGKHDEAWMILKQVHDT 323
Cdd:cd17431   205 RNEEEEAKSVLKKLRGT 221
2A0115 TIGR00895
benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and ...
110-246 2.41e-08

benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273327 [Multi-domain]  Cd Length: 398  Bit Score: 56.60  E-value: 2.41e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 110 TLFFVLGLALMadgveIFVVSFA---LPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINA 186
Cdd:TIGR00895 252 TVLLWLLYFML-----LVGVYFLtnwLPKLMVELGFSLSLAATGGALFNFGGVIGSIIFGWLADRLGPRVTALLLLLGAV 326
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 187 SFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEhlswlGIFWMTG 246
Cdd:TIGR00895 327 FAVLVGSTLFSPTLLLLLGAIAGFFVNGGQSGLYALMALFYPTAIRAT-----GVGWAIG 381
MFS_SLC22A1_2_3 cd17379
Solute carrier family 22 members 1, 2, and 3 (also called Organic cation transporters 1, 2, ...
141-263 2.94e-08

Solute carrier family 22 members 1, 2, and 3 (also called Organic cation transporters 1, 2, and 3) of the Major Facilitator Superfamily of transporters; This sufamily includes solute carrier family 22 member 1 (SLC22A1, also called organic cation transporter 1 or OCT1), SLC22A2 (or OCT2), SLC22A3 (or OCT3), and similar proteins. OCT1-3 have similar basic functional properties: they are able to translocate a variety of structurally different organic cations in both directions across the plasma membrane; to translocate organic cations independently from sodium, chloride or proton gradients; and to function as electrogenic uniporters for cations or as electroneutral cation exchangers. They show overlapping but distinct substrate and inhibitor specificities, and different tissue expression pattern. In humans, OCT1 is strongly expressed in the liver, OCT2 is highly expressed in the kidney where it is localized at the basolateral membrane of renal proximal tubules, and OCT3 is most strongly expressed in skeletal muscle. OCTs are broad-specificity transporters that play a critical role in the excretion and distribution of endogeneous organic cations and for the uptake, elimination and distribution of cationic drugs, toxins, and environmental waste products. The SLC22A1-3 subfamily belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340937 [Multi-domain]  Cd Length: 340  Bit Score: 56.21  E-value: 2.94e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 141 CLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVF 220
Cdd:cd17379    29 CEDAWKLDLFQSSLNLGFLIGSIVIGYLADRFGRKVCFLISILGNGVSGVLMAFSPNYPWFLIFRFLQGLFGKGGWMTGY 108
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 1907183268 221 AYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsIIPHYGW 263
Cdd:cd17379   109 VLVTEFVGSKYRRTVGIVYQMFFTLGLLILPGIAY-FIPHWRW 150
MFS cd06174
Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse ...
528-678 3.94e-08

Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 349949 [Multi-domain]  Cd Length: 378  Bit Score: 55.90  E-value: 3.94e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 528 MDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAW 607
Cdd:cd06174    23 LQSFGLSASQLGLLFALFSLGYALLQPLAGLLADRFGRRPVLLLGLLLFALGALLFAFAPSFWLLLLGRFLLGLGSGLID 102
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1907183268 608 NALDVITVELYPTNQRATAFGILNGLCKFGAILGNTI---FASFVGITKVVPILLAAASLVGGGLIALRLPETR 678
Cdd:cd06174   103 PAVLALIADLFPERERGRALGLLQAFGSVGGILGPLLggiLASSLGFGWRAVFLIAAALALLAAILLLLVVPDP 176
MFS_MMR_MDR_like cd17504
Methylenomycin A resistance protein (also called MMR peptide)-like multidrug resistance (MDR) ...
115-297 5.58e-08

Methylenomycin A resistance protein (also called MMR peptide)-like multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This subfamily is composed of putative multidrug resistance (MDR) transporters including Chlamydia trachomatis antiseptic resistance protein QacA_2, and Serratia sp. DD3 Bmr3. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341047 [Multi-domain]  Cd Length: 371  Bit Score: 55.28  E-value: 5.58e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 115 LGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLgLIVYLgmMAGAF---ILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17504     1 LALAALAVMLVETMLSPALPTIQREFGTSAAAVSWV-LTAYL--LVGAVstpILGRLGDLYGRKKVLLIVLAIYTAGSLL 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 192 SSFVQGYGAFLFCRLISGIGiGGSLPIVFAYFSEFLSREKRGEHLSWL-GIFWMTGGIYASAMAWsIIPHYGWgfsmgtn 270
Cdd:cd17504    78 AAFAPNLPVLIAGRALQGIG-GAVFPLAFALVREEFPPERVPVAQGILsATFGIGAGIGLPLGGW-IVQHLGW------- 148
                         170       180
                  ....*....|....*....|....*..
gi 1907183268 271 yHFHSWRVFVIVCALPATVSMVALKFM 297
Cdd:cd17504   149 -RWIFWTAAPVAVLLAALVPLIDLRLL 174
MFS_GLUT_Class2 cd17432
Class 2 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; GLUTs, also called ...
156-313 5.67e-08

Class 2 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUT5, also called Solute carrier family 2, facilitated glucose transporter member 5 (SLC2A5), is a well-established fructose transporter found in the small intestine. GLUT7 (or SLC2A7) is a high-affinity glucose and fructose transporter expressed in the small intestine and colon. GLUT9 (or SLC2A9) transports urate and fructose, and is most strongly expressed in the basolateral membranes of proximal renal tubular cells, liver and placenta. It may play a role in urate reabsorption by proximal tubules. GLUT11 (or SLC2A11) is a facilitative glucose transporter expressed in heart and skeletal muscle. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340990 [Multi-domain]  Cd Length: 452  Bit Score: 55.70  E-value: 5.67e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAF---LFCRLISGIGIGGSLPIVFAYFSEFLSREKR 232
Cdd:cd17432    61 LGGLFGSLLVGPLVIRLGRKGTLLLNNIFAIVAAILMGLSKIAKSFemiIVGRFLVGINAGISLNVVPMYLGESAPKNLR 140
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 233 GEHLSWLGIFWMTGGIYASAMAWSIIphygwgfsMGTNYHfhsWRVFVIVCALPATVSMVALKFMPESPRFLLeMGKHDE 312
Cdd:cd17432   141 GAVGLVPAIFITLGILLGQVLGLREL--------LGNEEG---WPLLLALTGVPALLQLLTLPFFPESPRYLL-IEKGDE 208

                  .
gi 1907183268 313 A 313
Cdd:cd17432   209 E 209
MFS_1 pfam07690
Major Facilitator Superfamily;
109-251 6.63e-08

Major Facilitator Superfamily;


Pssm-ID: 369468 [Multi-domain]  Cd Length: 346  Bit Score: 55.12  E-value: 6.63e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 109 WTLFFVLGLALMAdgveifvVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASF 188
Cdd:pfam07690 208 LLALLLFGFAFFG-------LLTYLPLYQEVLGLSALLAGLLLGLAGLLGAIGRLLLGRLSDRLGRRRRLLLALLLLILA 280
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907183268 189 A---SLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYAS 251
Cdd:pfam07690 281 AlglLLLSLTLSSLWLLLALLLLGFGFGLVFPALNALVSDLAPKEERGTASGLYNTAGSLGGALGP 346
MFS_KgtP cd17367
Alpha-ketoglutarate permease of the Major Facilitator Superfamily of transporters; This ...
161-303 7.15e-08

Alpha-ketoglutarate permease of the Major Facilitator Superfamily of transporters; This subfamily includes Escherichia coli alpha-ketoglutarate permease (KgtP) and similar proteins. KgtP is a constitutively expressed proton symporter that functions in the uptake of alpha-ketoglutarate across the boundary membrane. Also included is a putative transporter from Pseudomonas aeruginosa named dicarboxylic acid transporter PcaT. The KgtP subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340925 [Multi-domain]  Cd Length: 407  Bit Score: 54.99  E-value: 7.15e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 161 GAFILGGLADKLGRKKVLSMSLainaSFASLSSFV---------QGYGAF---LFCRLISGIGIGGSLPIVFAYFSEFLS 228
Cdd:cd17367    56 GGWLFGRLADRIGRRAALTLSV----SLMAAGSLViavtptyatIGIWAPiilLLARLLQGLSVGGEYGTSATYLSEVAP 131
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 229 REKRGEHLSWLGIFWMTGGIYASAMAwSIIPH-------YGWGfsmgtnyhfhsWRVFVIVCALPATVSMVALKFMPESP 301
Cdd:cd17367   132 PGRRGFYSSFQYVTLIGGQLLALGVL-LVLQHtlgedqmAAWG-----------WRIPFLLGGVLAVVVLWLRRGLEETE 199

                  ..
gi 1907183268 302 RF 303
Cdd:cd17367   200 SF 201
MFS_arabinose_efflux_permease_like cd17473
Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily; ...
156-248 7.25e-08

Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily; This family includes a group of putative arabinose efflux permease family transporters, such as alpha proteobacterium quinolone resistance protein NorA (characterized Staphylococcus aureus Quinolone resistance protein NorA belongs to a different group), Desulfovibrio dechloracetivorans bacillibactin exporter, Vibrio aerogenes antiseptic resistance protein. The biological function of those transporters remain unclear. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341026 [Multi-domain]  Cd Length: 374  Bit Score: 54.89  E-value: 7.25e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEH 235
Cdd:cd17473    46 LFIALFAPLAGWLADRFGRKRLLIAGLLLYGIGGVAGLFLDSLYALLASRALLGIGVAGIMTLATALIGDYFEGEERAKM 125
                          90
                  ....*....|...
gi 1907183268 236 LSWLGIFWMTGGI 248
Cdd:cd17473   126 LGLQSAAMSLGGV 138
MFS_MT3072_like cd17475
Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar ...
129-320 9.33e-08

Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily; This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341028 [Multi-domain]  Cd Length: 378  Bit Score: 54.55  E-value: 9.33e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 129 VSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLIS 208
Cdd:cd17475    15 IPALAPFLQEDLHLSLAQVGLLLSALNLGVAVSMLPAGWLLDRFGERRVLAVGLLLMGAAALLMALVGSYPVLLVLLFLV 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 209 GIGIGGSLP----IVFAYFSEflsrEKRGehlswlgiFWMT--------GGIYASAMAWSIIPHYGWGFSMgtnyhfhsw 276
Cdd:cd17475    95 GAGYGSVQPgggrAIMRWFPP----RERG--------LAMGirqtgvplGGALAAALLPPLALHYGWRAAF--------- 153
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 1907183268 277 RVFVIVCALPATVSMValkFMPESPRFLLEMGKHDEAWMILKQV 320
Cdd:cd17475   154 VVAGLVSILAAVLFWL---FYREPPAASAATESASTLLRSLKEV 194
MFS_OAT cd17374
Organic anion transporters of the Major Facilitator Superfamily of transporters; Organic anion ...
538-675 2.31e-07

Organic anion transporters of the Major Facilitator Superfamily of transporters; Organic anion transporters (OATs) generally display broad substrate specificity and they facilitate the exchange of extracellular with intracellular organic anions (OAs). Several OATs have been characterized including OAT1-10 and urate anion exchanger 1 (URAT1, also called SLC22A12). Many OATs occur in renal proximal tubules, the site of active drug secretion. OATs mediate the absorption, distribution, and excretion of a diverse array of environmental toxins, and clinically important drugs, including anti-HIV therapeutics, anti-tumor drugs, antibiotics, anti-hypertensives, and anti-inflammatories, and therefore is critical for the survival of the mammalian species. OAT falls into the SLC22 (solute carrier 22) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340932 [Multi-domain]  Cd Length: 341  Bit Score: 53.06  E-value: 2.31e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 538 IYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSES-------AMIGwqclfCGTSIAAWNAL 610
Cdd:cd17374   203 VFLLQFLFGAVEVPARCLALFLLNHMGRRISQAVLLLLAGLCILANIFVPQEMqtlrtvlAVLG-----KGSSAAAFTIS 277
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1907183268 611 DVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVgITKVVPILLAAASLVGGGLIALRLP 675
Cdd:cd17374   278 YVYTAELFPTVLRQTGMGLNSMFARIGGILAPLIMLLGV-YSPLLPMIIYGVLPILAGLLALLLP 341
MFS_YfcJ_like cd17489
Escherichia coli YfcJ, YhhS, and similar transporters of the Major Facilitator Superfamily; ...
133-320 2.68e-07

Escherichia coli YfcJ, YhhS, and similar transporters of the Major Facilitator Superfamily; This subfamily is composed of Escherichia coli membrane proteins, YfcJ and YhhS, Bacillus subtilis uncharacterized MFS-type transporter YwoG, and similar proteins. YfcJ and YhhS are putative arabinose efflux transporters. YhhS has been implicated glyphosate resistance. YfcJ-like arabinose efflux transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341042 [Multi-domain]  Cd Length: 367  Bit Score: 52.98  E-value: 2.68e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 133 LPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGI 212
Cdd:cd17489    19 LPLYAHDLGGSEAVAGLVVGLFTLAALLARPFAGRLLDRFGRKRLLLIGLLIFALATLLYLLATSVALLLVLRLIHGIGW 98
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 213 GGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMgtnyhfhswrVFVIVCALPATVSMV 292
Cdd:cd17489    99 GAFTTAAATLVADIIPPSRRGEGIGYYGLATTLAMALGPALGLFLYQHLGFAVLF----------IVAAVLALLALLLVF 168
                         170       180
                  ....*....|....*....|....*...
gi 1907183268 293 ALKFMPESPRFLLEMGKHDEAWMILKQV 320
Cdd:cd17489   169 LVKDPPPVAAEEAEAGTRAFRRLVEKKV 196
MFS_OFA_like cd17353
Oxalate:formate antiporter (OFA) and similar proteins of the Major Facilitator Superfamily of ...
109-294 2.82e-07

Oxalate:formate antiporter (OFA) and similar proteins of the Major Facilitator Superfamily of transporters; This subfamily is composed of Oxalobacter formigenes oxalate:formate antiporter (OFA or OxlT) and similar proteins. O. formigenes, a commensal found in the gut of animals and humans, plays an important role in clearing dietary oxalate from the intestinal tract, which is carried out by OFA/OxlT, an anion transporter that facilitates the exchange of divalent oxalate with monovalent formate, the product of oxalate decarboxylation. This exchange generates an electrochemical proton gradient and is the source of energy for ATP synthesis in this cell. The OFA-like subfamily belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340911 [Multi-domain]  Cd Length: 389  Bit Score: 53.38  E-value: 2.82e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 109 WTLFFVLGLALMAdGVEIFVVSfalpsaeKDMCLSSSKKGMLGLIVYLGMMA-----GAFILGGLADKLGRKKVLSMSLA 183
Cdd:cd17353   216 WLLWLMFFLNATA-GLMLIGQA-------KPIGQEFAGLDAGIAALAVSILSifnggGRPFWGWLSDKIGRKNTLSIAFL 287
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 184 INA-SFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIipHYG 262
Cdd:cd17353   288 IQGvAMFLLPFIGSVAVLFVLGVALIGFCYGGGFALFPALTADFFGTKNAGTNYGLLYTAKGVGGLIGPIIAAYV--LYT 365
                         170       180       190
                  ....*....|....*....|....*....|..
gi 1907183268 263 WGFSMgtnyhfhswrVFVIVCALPATVSMVAL 294
Cdd:cd17353   366 GGYNA----------AFIIAAALSLVALALAL 387
xylE PRK10077
D-xylose transporter XylE; Provisional
144-323 2.99e-07

D-xylose transporter XylE; Provisional


Pssm-ID: 182225 [Multi-domain]  Cd Length: 479  Bit Score: 53.54  E-value: 2.99e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 144 SSKKGMLGLIV---YLGMMAGAFILGGLADKLGRKK------VLSMSLAINASFASLSSFVQGYG------AFLFCRLIS 208
Cdd:PRK10077   51 SAANSLLGFCVasaLIGCIIGGALGGYCSNRFGRRDslkiaaVLFFISALGSAWPEFGFTSIGPDntgyvpEFVIYRIIG 130
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 209 GIGIGGSLPIVFAYFSEFLSREKRGEHLSW---------LGIFWMTGGIyASAMAWSIIPHYGWgfsmgtNYHFHSWrvf 279
Cdd:PRK10077  131 GIGVGLASMLSPMYIAEIAPAHIRGKLVSFnqfaiifgqLVVYFVNYFI-ARSGDASWLNTDGW------RYMFASE--- 200
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 1907183268 280 vivcALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDT 323
Cdd:PRK10077  201 ----AIPALLFLMLLYFVPETPRYLMSRGKQEQAEGILRKIMGN 240
MFS_MJ1317_like cd17370
MJ1317 and similar transporters of the Major Facilitator Superfamily; This family is composed ...
150-294 3.42e-07

MJ1317 and similar transporters of the Major Facilitator Superfamily; This family is composed of Methanocaldococcus jannaschii MFS-type transporter MJ1317, Mycobacterium bovis protein Mb2288, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340928 [Multi-domain]  Cd Length: 371  Bit Score: 52.93  E-value: 3.42e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 150 LGLIVYLGMMA----GAFILGGLADKLGRKKVL----SMSLAINASFASLSSFVQGYGAFLFcrliSGIGIGGSLPIVFA 221
Cdd:cd17370   235 LIPLLYALFNLvyalAAYPAGRLSDRIGRKKLLilgyLSLALAYLGFALGSSLWLLLLGFIL----WGLYMGAQESIERA 310
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1907183268 222 YFSEFLSREKRGehlSWLGIFWMTGGIyaSAMAWSIIphygwgfsMGTNYHFHSWRVFVIVCALPATVSMVAL 294
Cdd:cd17370   311 AVADLVPAELRG---TAYGLFNTVVGI--GWLLASLI--------AGYLWDLISPSAAFLFSAVLALIALLLL 370
MFS_PcaK_like cd17365
4-hydroxybenzoate transporter PcaK and similar transporters of the Major Facilitator ...
107-294 6.97e-07

4-hydroxybenzoate transporter PcaK and similar transporters of the Major Facilitator Superfamily; This aromatic acid:H(+) symporter subfamily includes Acinetobacter sp. 4-hydroxybenzoate transporter PcaK, Pseudomonas putida gallate transporter (GalT), Corynebacterium glutamicum gentisate transporter (GenK), Nocardioides sp. 1-hydroxy-2-naphthoate transporter (PhdT), Escherichia coli 3-(3-hydroxy-phenyl)propionate (3HPP) transporter (MhpT), and similar proteins. These transporters are involved in the uptake across the cytoplasmic membrane of specific aromatic compounds such as 4-hydroxybenzoate, gallate, gentisate (2,5-dihydroxybenzoate), 1-hydroxy-2-naphthoate, and 3HPP, respectively. The PcaK-like aromatic acid:H(+) symporter subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340923 [Multi-domain]  Cd Length: 351  Bit Score: 51.82  E-value: 6.97e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 107 FQWTLFFVLG-------LALMADGVEIFVVSFA-----------LPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGL 168
Cdd:cd17365   150 FGWRSVFLLGgvpplilLPLLRGTLLLWVTFFMglllvyllnswLPKLMVEAGYSLSQALTITLLLNIGGVIGSLLLGWL 229
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 169 ADKLGRKKVLSMSLAINASF-ASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGG 247
Cdd:cd17365   230 ADRFGPKRVLALFFALGAVSlALLGVSPASLVLLYVLVFLAGACVNGAQVGLYALAARFYPTEVRATGVGWALGVGRLGA 309
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 1907183268 248 IYASAMAWSIIphyGWGFSMGTNYhfhswrvfvIVCALPATVSMVAL 294
Cdd:cd17365   310 ILGPLLGGLLL---AAGLGPESVF---------LALAIPAALGALAV 344
MFS_GLUT12_Class3 cd17435
Glucose transporter type 12 (GLUT12), a Class 3 GLUT, of the Major Facilitator Superfamily of ...
123-305 1.26e-06

Glucose transporter type 12 (GLUT12), a Class 3 GLUT, of the Major Facilitator Superfamily of transporters; Glucose transporter type 12 (GLUT12) is also called Solute carrier family 2, facilitated glucose transporter member 12 (SLC2A12). It is a facilitative glucose transporter, classified as a Class 3 GLUT, and is expressed in the heart, skeletal muscle, prostate, and small intestine, and is highly upregulated in breast ductal cell carcinoma. It plays a role as a secondary insulin-sensitive glucose transporter in insulin-dependent tissues. The GLUT12 subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340993 [Multi-domain]  Cd Length: 376  Bit Score: 50.95  E-value: 1.26e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 123 GVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKK--VLSMSLAINASFasLSSFVQGYGA 200
Cdd:cd17435    14 GYELGIISGALLQLRTLLALSCHEQEMVVSSLLIGALLASLTGGVLIDRYGRRTaiILTSCLLVLGSL--LLVCSVSYTV 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 201 FLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGI--YASAMAWSIIPHyGWGFSMGtnyhfhswrv 278
Cdd:cd17435    92 LIVGRIAIGVSISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVIGILlaYISNYAFANVSN-GWKYMFG---------- 160
                         170       180
                  ....*....|....*....|....*..
gi 1907183268 279 FVIvcaLPATVSMVALKFMPESPRFLL 305
Cdd:cd17435   161 LVI---PLAALQAIAMYFLPPSPRFLV 184
MFS_OAT cd17374
Organic anion transporters of the Major Facilitator Superfamily of transporters; Organic anion ...
141-298 2.71e-06

Organic anion transporters of the Major Facilitator Superfamily of transporters; Organic anion transporters (OATs) generally display broad substrate specificity and they facilitate the exchange of extracellular with intracellular organic anions (OAs). Several OATs have been characterized including OAT1-10 and urate anion exchanger 1 (URAT1, also called SLC22A12). Many OATs occur in renal proximal tubules, the site of active drug secretion. OATs mediate the absorption, distribution, and excretion of a diverse array of environmental toxins, and clinically important drugs, including anti-HIV therapeutics, anti-tumor drugs, antibiotics, anti-hypertensives, and anti-inflammatories, and therefore is critical for the survival of the mammalian species. OAT falls into the SLC22 (solute carrier 22) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340932 [Multi-domain]  Cd Length: 341  Bit Score: 49.98  E-value: 2.71e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 141 CLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVF 220
Cdd:cd17374    31 CESQSLKSVAQSIFMAGLLVGALIFGHLSDRFGRKFILLLSLLQLAIFGTCAAFAPTFPVYCVLRFLAGFAVSGISINTL 110
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1907183268 221 AYFSEflsrekrgehlsWLGIFWMTGGIYASAMAWSIiphyGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMP 298
Cdd:cd17374   111 ILGTE------------WTTPRHRALAITLTSCFFSI----GQMLLAGLAYAIRDWRLLQLVVSVPFFLFFLYSWWLP 172
MFS_Azr1_MDR_like cd17502
Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance ...
115-248 2.94e-06

Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341045 [Multi-domain]  Cd Length: 337  Bit Score: 49.87  E-value: 2.94e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 115 LGLALMAdgVEIFVVSFALPSAEKDMClSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSF 194
Cdd:cd17502     3 LALFLAA--LDQTIVATALPTIVAEFG-GLSLVSWVGTAYLLTSTAFQPIYGKLSDLFGRKWVLLIAIVIFELGSLLCGL 79
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 1907183268 195 VQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGI 248
Cdd:cd17502    80 APNMTMLIVGRAIQGIGGGGLMSLAFIIIADLVPPRERGKYQGYIGAVFGIASV 133
MFS_MefA_like cd06173
Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of ...
109-296 3.05e-06

Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters; This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340863 [Multi-domain]  Cd Length: 383  Bit Score: 49.92  E-value: 3.05e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 109 WTLFFVLGLALMADGVEIFVVSFAlpsaEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASF 188
Cdd:cd06173   212 LLLLALALFALLGGALTVLLPLLA----KEVLGGGAAGYGLLLAAFGVGALLGALLLGRLSKRRRRGRLLLIGALLLGLA 287
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 189 ASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGfsmg 268
Cdd:cd06173   288 LLVLGLSPSLWLLLAALFLLGLAGGLFNVPLNTLLQLRVPDELRGRVFSVYNALNSGAMPLGALLAGLLADALGLS---- 363
                         170       180
                  ....*....|....*....|....*...
gi 1907183268 269 tnyhfhswRVFVIVCALPATVSMVALKF 296
Cdd:cd06173   364 --------AVFLLAGALLLLAALLLLLL 383
MFS_FsR cd17478
Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters; ...
148-302 3.77e-06

Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters; Fosmidomycin resistance protein (FsR) confers resistance against fosmidomycin. It shows sequence similarity with the bacterial drug-export proteins that mediate resistance to tetracycline and chloramphenicol. This FsR family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341031 [Multi-domain]  Cd Length: 365  Bit Score: 49.48  E-value: 3.77e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 148 GMLGLIVYLGMMAGAF---ILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFS 224
Cdd:cd17478    31 AQAGLLVSVFSITSSLlqpLFGYLADRKPRRYLLPLGPLLTGLGLSLLGFAPNYWLLLLLVALAGIGSAAFHPEGARLAS 110
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1907183268 225 EfLSREKRGehlSWLGIFwMTGGIYASAMAWSIIphyGWGFSMGTNYHfhswrvFVIVCALPATVSMVALKFMPESPR 302
Cdd:cd17478   111 Q-AAGGRRG---LAMSIF-SVGGNLGFALGPLIA---AALVALFGGLG------LLILLIIPGLAVALLLLRLRPLKK 174
MFS_FucP_MFSD4_like cd17333
Bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein ...
109-248 4.13e-06

Bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein 4, and similar proteins; This family is composed of bacterial L-fucose permease (FucP), eukaryotic Major facilitator superfamily domain-containing protein 4 (MFSD4) proteins, and similar proteins. L-fucose permease facilitates the uptake of L-fucose across the boundary membrane with the concomitant transport of protons into the cell; it can also transport L-galactose and D-arabinose. The MFSD4 subfamily consists of two vertebrate members: MFSD4A and MFSD4B. The function of MFSD4A is unknown. MFSD4B is more commonly know as Sodium-dependent glucose transporter 1 (NaGLT1), a primary fructose transporter in rat renal brush-border membranes that also facilitates sodium-independent urea uptake. The FucP/MFSD4 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340891 [Multi-domain]  Cd Length: 372  Bit Score: 49.63  E-value: 4.13e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 109 WTLFFVLGLALMADGVEIfvvsfalPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASF 188
Cdd:cd17333     2 YISFFSNGLTDALLGILG-------PSLEEAFNLNVADVSVIFSSQNAGYLIGSLLAGFLMKRLGRRRTLILGLLLISLA 74
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 189 ASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEfLSREKRGEHLSWLGIFWMTGGI 248
Cdd:cd17333    75 LALIFATPSIYLFVVLMFLAGLGAGILDTGANTFVGA-LFEESSATRLNVLHGFFGLGAL 133
MFS_MJ1317_like cd17370
MJ1317 and similar transporters of the Major Facilitator Superfamily; This family is composed ...
533-645 4.53e-06

MJ1317 and similar transporters of the Major Facilitator Superfamily; This family is composed of Methanocaldococcus jannaschii MFS-type transporter MJ1317, Mycobacterium bovis protein Mb2288, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340928 [Multi-domain]  Cd Length: 371  Bit Score: 49.46  E-value: 4.53e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 533 DNDFLIYLVSFLG-SLSVLPG-----NIISAL-------LMDRIGRLKMIGGSMLISAVCCF-FLFFGNSESAMIGwqCL 598
Cdd:cd17370   218 SFAFLILRAQELGlSAALIPLlyalfNLVYALaaypagrLSDRIGRKKLLILGYLSLALAYLgFALGSSLWLLLLG--FI 295
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 1907183268 599 FCGTSIAAWNAL-DVITVELYPTNQRATAFGILNGLCKFGAILGNTIF 645
Cdd:cd17370   296 LWGLYMGAQESIeRAAVADLVPAELRGTAYGLFNTVVGIGWLLASLIA 343
PRK12307 PRK12307
MFS transporter;
106-263 4.93e-06

MFS transporter;


Pssm-ID: 237051 [Multi-domain]  Cd Length: 426  Bit Score: 49.54  E-value: 4.93e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN 185
Cdd:PRK12307   14 RPQKNALFSAWLGYVFDGFDFMLIFYIMYLIKADLGLTDMEGAFLATAAFIGRPFGGALFGLLADKFGRKPLMMWSIVAY 93
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1907183268 186 ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGW 263
Cdd:PRK12307   94 SVGTGLSGLASGVIMLTLSRFIVGMGMAGEYACASTYAVESWPKHLKSKASAFLVSGFGIGNIIAAYFMPSFAEAYGW 171
MFS_SLC22A15 cd17377
Solute carrier family 22 member 15 of the Major Facilitator Superfamily of transporters; ...
144-298 4.95e-06

Solute carrier family 22 member 15 of the Major Facilitator Superfamily of transporters; Solute carrier family 22 member 15 (SLC22A15) is also called fly-like putative transporter 1 (FLIPT1). It is expressed at the highest levels in the kidney and brain. It is a member of the SLC22 family of transporters, which includes organic cation transporters (OCTs), organic zwitterion/cation transporters (OCTNs), and organic anion transporters (OATs). SLC22 transporters interact with a variety of compounds that include drugs of abuse, environmental toxins, opioid analgesics, antidepressant and anxiolytic agents, and neurotransmitters and their metabolites. SLC22A15 belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340935 [Multi-domain]  Cd Length: 353  Bit Score: 49.01  E-value: 4.95e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 144 SSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYF 223
Cdd:cd17377    38 AYKVSLASSFFFAGVLIGVVSFGQLSDRFGRKPVYLTGLALDILFAYFNALAPSYEFFAVSRFLVGVMNGGMSLVAFVLL 117
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907183268 224 SEFLSREkrgehlswlgiFW-MTGGIYASAMAWSIIPHYGWGfsmgtnYHFHSWRVFVIVCALPATVSMVALKFMP 298
Cdd:cd17377   118 NECVGKS-----------YWaLAGSLGGLFFAVGIAQYALLG------YFIRSWRTLAVVVNLQGTLVFLLSLFIP 176
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
537-674 6.36e-06

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 48.73  E-value: 6.36e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 537 LIYLVSFLGSLSVLPgniISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVE 616
Cdd:cd17325   239 LLFGAQGLASALSQP---PAGKLSDRIGRKPLILIGLLLSAVALLLLPLATSFWLLLLLLALLGLGLGLVFPATLALLAD 315
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1907183268 617 LYPTNQRATAFGILNGLCKFGAILGNTI---FASFVGITkvVPILLAAASLVGGGLIALRL 674
Cdd:cd17325   316 IVPPEGRGTAMGLFNTAFSLGMVLGPLLggfLYDAFGFA--TPFLAAAALLLLAAVLFLLL 374
PRK10473 PRK10473
MdtL family multidrug efflux MFS transporter;
154-241 7.90e-06

MdtL family multidrug efflux MFS transporter;


Pssm-ID: 182486 [Multi-domain]  Cd Length: 392  Bit Score: 48.48  E-value: 7.90e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 154 VYLGMMAGAFILGG-LADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKR 232
Cdd:PRK10473   46 VYLAGMAAAMLFAGkIADRSGRKPVAIPGAALFIIASLLCSLAETSSLFLAGRFLQGIGAGCCYVVAFAILRDTLDDRRR 125
                          90
                  ....*....|
gi 1907183268 233 GEHLSWL-GI 241
Cdd:PRK10473  126 AKVLSLLnGI 135
BtlA COG2270
MFS-type transporter involved in bile tolerance, Atg22 family [General function prediction ...
111-302 8.63e-06

MFS-type transporter involved in bile tolerance, Atg22 family [General function prediction only];


Pssm-ID: 225179 [Multi-domain]  Cd Length: 438  Bit Score: 48.46  E-value: 8.63e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 111 LFFVLGLALMADGVEIfVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFAS 190
Cdd:COG2270   255 VLFLIARFFYIDGVNT-ILAMGGVFGAADLGLSSTELLLIGIALSVVAALGAIIAGFLDERFGSKPVLMIGLVILSIAAL 333
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 191 LSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMaWSIIphygwgfsmgTN 270
Cdd:COG2270   334 YLIFLEGELDFWILGLLVGTSLGGAQASSRSYLARLVPKGKEGRFFGLYALTGRAASFLGPFL-VAVI----------TQ 402
                         170       180       190
                  ....*....|....*....|....*....|..
gi 1907183268 271 YhFHSWRVFVIVCALPATVSMVALKFMPESPR 302
Cdd:COG2270   403 I-TGSSRAGVLSIIVLLLIGLLLLLRVKVPGR 433
MFS_NepI_like cd17324
Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator ...
541-680 1.14e-05

Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily; This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340882 [Multi-domain]  Cd Length: 370  Bit Score: 47.93  E-value: 1.14e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 541 VSFLGSLSVLP---GNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVEL 617
Cdd:cd17324    36 AGLLVSAYALGyalGALLLGPLSDRIERRRLLLVLLLLFILGNLLAALAPSFALLLLARALAGLAHGGFWAIAAAYAADL 115
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907183268 618 YPTNQRATAFGILNGLCKFGAILGN---TIFASFVGItKVVPILLAAASLVGGGLIALRLPETREQ 680
Cdd:cd17324   116 VPPEKRGRAIGLVFSGLTLGLVLGRplgGLLGQLLGW-RAAFLAIAVLALLAALLLWRLLPSLPPK 180
MFS_SLC22A7_OAT2 cd17447
Solute carrier family 22 member 7 (also called Organic anion transporter 2) of the Major ...
538-675 1.20e-05

Solute carrier family 22 member 7 (also called Organic anion transporter 2) of the Major Facilitator Superfamily of transporters; Solute carrier family 22 member 7 (SLC22A7), also called organic anion transporter 2 (OAT2) mediates sodium-independent transport of a variety of organic anions including prostaglandin E2, prostaglandin F2, tetracycline, bumetanide, estrone sulfate, glutarate, dehydroepiandrosterone sulfate, allopurinol, 5-fluorouracil, paclitaxel, L-ascorbic acid, salicylate, ethotrexate, and alpha-ketoglutarate. It also plays a role in renal uric acid uptake from blood as a first step of tubular secretion. OAT2 belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS)of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341005 [Multi-domain]  Cd Length: 341  Bit Score: 47.80  E-value: 1.20e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 538 IYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMI--GWQCLFCGTSIAAWNALDVITV 615
Cdd:cd17447   203 VYLTQFIYGAIELPAKLLAYLLLDRIGRRLTQAGSLILTGLSIGINILIPSEFTVVrtVIAVLGKGFSEAAFTTVFLYTS 282
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 616 ELYPTNQRATAFGILNGLCKFGAILGNTIFAsFVGITKVVPILLAAASLVGGGLIALRLP 675
Cdd:cd17447   283 ELYPTVLRQNGMGYTSFIARLGGSLAPLVIL-LDDVWLSLPQVIFCGVALLAGGVAFLLP 341
MFS_YcaD_like cd17477
YcaD and similar transporters of the Major Facilitator Superfamily; This family is composed of ...
111-301 1.27e-05

YcaD and similar transporters of the Major Facilitator Superfamily; This family is composed of Escherichia coli MFS-type transporter YcaD, Bacillus subtilis MFS-type transporter YfkF, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341030 [Multi-domain]  Cd Length: 360  Bit Score: 47.94  E-value: 1.27e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 111 LFFVLGLALMADGVEIFVVSFALpsaeKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFAS 190
Cdd:cd17477     1 LLLSVALLGLGSGLLLPLLSLRL----EREGVSTALIGLVASAYYLGILLGSPLVPRLIRRVGHIRAFAAGAAITAVSVL 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 191 LSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFwMTGGIYASAMAWSIIPHYGwgfsmgtn 270
Cdd:cd17477    77 LLALTDSPWVWFLLRFVMGIGLAGLFVVSESWLNALATNENRGRVLGLYSTV-LGLGFALGPLLLALVGTAG-------- 147
                         170       180       190
                  ....*....|....*....|....*....|.
gi 1907183268 271 yhfhsWRVFVIVCALPAtVSMVALKFMPESP 301
Cdd:cd17477   148 -----ALPFLIAAVLLL-LALVPLLLTRRAA 172
MFS_FEN2_like cd17327
Pantothenate transporter FEN2 and similar transporters of the Major Facilitator Superfamily; ...
153-342 1.29e-05

Pantothenate transporter FEN2 and similar transporters of the Major Facilitator Superfamily; This family is composed of Saccharomyces cerevisiae pantothenate transporter FEN2 (or fenpropimorph resistance protein 2) and similar proteins from fungi and bacteria including fungal vitamin H transporter, allantoate permease, and high-affinity nicotinic acid transporter, as well as Pseudomonas putida phthalate transporter and nicotinate degradation protein T (nicT). These proteins are involved in the uptake into the cell of specific substrates such as pathothenate, biotin, allantoate, and nicotinic acid, among others. The FEN2-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340885 [Multi-domain]  Cd Length: 406  Bit Score: 48.01  E-value: 1.29e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 153 IVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKR 232
Cdd:cd17327    49 VFYVGYIIFELPGNLLLQRFPPSKWLSVFIVLWGLLTLLTAAVKNFGGLIALRFFLGLFESGVFPGFILYLGMWYKREEQ 128
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 233 GEHLSWLGIFWMTGGIYASAMAWSIiphygwgFSMGTNYHFHSWR-VFVIVCALPATVSMVALKFMPESP---RFLLEMG 308
Cdd:cd17327   129 AKRIAFFYAAAGLGSIFGGLLAYGV-------FKILGVGGLAGWRwLFIIEGLITIIIGLVIFFWLPDNPskaWFLTEEE 201
                         170       180       190
                  ....*....|....*....|....*....|....
gi 1907183268 309 KHdeawMILKQVHDtnmRAKGTPEKVFTVSHIKT 342
Cdd:cd17327   202 KE----LAVERLRA---NQTGKGDQKFKWKQIKE 228
MFS_SLC22A16_CT2 cd17375
Solute carrier family 22 member 16 (also called Carnitine transporter 2) of the Major ...
539-675 1.30e-05

Solute carrier family 22 member 16 (also called Carnitine transporter 2) of the Major Facilitator Superfamily of transporters; Solute carrier family 22 member 16 (SLC22A16) is also called carnitine transporter 2 (CT2), fly-like putative transporter 2 (FLIPT2), organic cation transporter OKB1, or organic cation/carnitine transporter 6 (OCT6). It is a partially sodium-ion dependent high affinity carnitine transporter. It also transports organic cations such as tetraethylammonium (TEA) and doxorubicin. It is one of several organic cation transporters (OCTs) that falls into the SLC22 (solute carrier 22) family. OCTs are broad-specificity transporters that play a critical role in the excretion and distribution of endogeneous organic cations and for the uptake, elimination and distribution of cationic drugs, toxins, and environmental waste products. SLC22A16 belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340933 [Multi-domain]  Cd Length: 341  Bit Score: 47.82  E-value: 1.30e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 539 YLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSI--AAWNALDVITVE 616
Cdd:cd17375   204 YLNLFLVGAVEIPSYIIACIGMDKLGRRNTLAPFLLLSALACMLIMVIPQDYEVLTIVLSMTGKFAiaIAFGLIYLYTAE 283
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1907183268 617 LYPTNQRATAFGILNGLCKFGailgnTIFASF-VGITKV---VPILLAAASLVGGGLIALRLP 675
Cdd:cd17375   284 LYPTIVRSLAVGSGSMMCRVG-----SVVAPFcVYLSDVwifLPQLLVGIMAFLSGILTLMLP 341
MFS_Tpo1_MDR_like cd17323
Yeast Polyamine transporter 1 (Tpo1) and similar multidrug resistance (MDR) transporters of ...
150-233 1.75e-05

Yeast Polyamine transporter 1 (Tpo1) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This family is composed of fungal multidrug resistance (MDR) transporters including several proteins from Saccharomyces cerevisiae such as polyamine transporters 1-4 (Tpo1-4), quinidine resistance proteins 1-3 (Qdr1-3), dityrosine transporter 1 (Dtr1), fluconazole resistance protein 1 (Flr1), and protein HOL1. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, Flr1 confers resistance to the azole derivative fluconazole while Tpo1 confers resistance and adaptation to quinidine and ketoconazole. The polyamine transporters are involved in the detoxification of excess polyamines in the cytoplasm. Tpo1-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340881 [Multi-domain]  Cd Length: 376  Bit Score: 47.57  E-value: 1.75e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 150 LGLIVY-LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLS 228
Cdd:cd17323    38 LGVSLFvLGFGLGPLIWAPLSELYGRRPVYLVSLFIFVIFQIGCALAPNIAMLIILRFLQGFFGSSPLAIGAGTIADLFT 117

                  ....*
gi 1907183268 229 REKRG 233
Cdd:cd17323   118 PEERG 122
MFS_OPA_SLC37 cd17312
Organophosphate:Pi antiporter/Solute Carrier family 37 of the Major Facilitator Superfamily of ...
130-308 1.89e-05

Organophosphate:Pi antiporter/Solute Carrier family 37 of the Major Facilitator Superfamily of transporters; Organophosphate:Pi antiporters (OPA) are integral membrane proteins responsible for the transport of specific organophosphates or sugar phosphates across biological membranes with the simultaneous translocation of inorganic phosphate into the opposite direction. The OPA family is also called solute carrier family 37 (SLC37) in vertebrates. Members include glucose-6-phosphate (Glc6P) transporter (also called translocase or exchanger), glycerol-3-phosphate permease, 2-phosphonopropionate transporter, phosphoglycerate transporter, as well as membrane sensor protein UhpC from Escherichia coli. UhpC is both a sensor and a transport protein; it recognizes external Glc6P and induces transport by UhpT, and it can also transport Glc6P. Vertebrates contain four SLC37 or sugar-phosphate exchange (SPX) proteins: SLC37A1 (SPX1), SLC37A2 (SPX2), SLC37A3 (SPX3), and SLC37AA4 (SPX4). The OPA/SLC37 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340870 [Multi-domain]  Cd Length: 364  Bit Score: 47.27  E-value: 1.89e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 130 SFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISG 209
Cdd:cd17312    23 SVAKPPIVEEIGLSKDDLGIIGSAFLIAYAVGKFISGFLSDRSNIRRFMSAGLLLSALANIFMGFSTSLWFFAVLWGLNG 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 210 IGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFsmgtnyhfhswrVFVIVCALPATV 289
Cdd:cd17312   103 LFQSMGWPPCVKLLGNWFSKKERGTVYGIWSTSHNFGGILAPILAASLASYYGWRA------------AFLVPGIVGLVV 170
                         170
                  ....*....|....*....
gi 1907183268 290 SMVALKFMPESPRFLLEMG 308
Cdd:cd17312   171 AIILFFFLRDSPPYVWVLS 189
UhpC COG2271
Sugar phosphate permease [Carbohydrate transport and metabolism];
106-263 1.97e-05

Sugar phosphate permease [Carbohydrate transport and metabolism];


Pssm-ID: 225180 [Multi-domain]  Cd Length: 448  Bit Score: 47.65  E-value: 1.97e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 106 RFQWTLFFV--LGLALMADGVEIFvvSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLA 183
Cdd:COG2271    25 RWRIQIFLSifIGYAAFYLTRKNF--NLAMPALIEDGGLSKTQLGILGSAFSITYGVSKFVMGVLSDRSNPRYFMAFGLI 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 184 INASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGehlSWLGIfWMT----GGIYASAMA--WSI 257
Cdd:COG2271   103 LSAIVNILFGFSPSLFLFAVLWVLNGWFQGMGWPPCARTITHWFSRKERG---TWWSI-WNTshniGGALAPLVAllAFF 178

                  ....*.
gi 1907183268 258 IPHYGW 263
Cdd:COG2271   179 AFHGGW 184
MFS_NRT2_like cd17341
Plant Nitrate transporter NRT2 family and Bacterial Nitrate/Nitrite transporters of the Major ...
127-309 1.98e-05

Plant Nitrate transporter NRT2 family and Bacterial Nitrate/Nitrite transporters of the Major Facilitator Superfamily; This family is composed of plant NRT2 family high-affinity nitrate transporters as well as nitrate and nitrite transporters from bacteria including Bacillus subtilis nitrate transporter NasA and nitrite extrusion protein NarK, Staphylococcus aureus NarT, Synechococcus sp. nitrate permease NapA, Mycobacterium tuberculosis NarK2 and nitrite extrusion protein NarU. NRT2 family proteins are involved in the uptake of nitrate by plant roots from the soil through the high-affinity transport system (HATS). There are seven Arabidopsis thaliana NRT2 proteins, called AtNRT2:1 to AtNRT2:7. The NRT2-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340899 [Multi-domain]  Cd Length: 384  Bit Score: 47.25  E-value: 1.98e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 127 FVVSFALPSAE----KDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFA-SLSSFVQGYGAF 201
Cdd:cd17341    12 FMVWFLFAPLGpvirDDLGLSTSQIGLLVAIPVLAGALLRLPYGFLCDRFGGRRVFIASLLLLLIPLlALALAVSSYWGL 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 202 LFCRLISGIGiGGSLPIVFAYFSEFLSREKRGehLSWLGIFWMtGGIYASAMAWSIIPHYGWGFSMGTNYhfhSWR-VFV 280
Cdd:cd17341    92 LVLGFLLGFA-GANFASGQPWASFWFPKEKIG--GAAGGIAGA-GNMGVAVSQLLAPLIAGAIVFDGGFV---GWRnAFF 164
                         170       180       190
                  ....*....|....*....|....*....|..
gi 1907183268 281 IVCALPATVSMVALKFM---PESPRFLLEMGK 309
Cdd:cd17341   165 VPGILLAIAAVLVLLFGddlPTGKASALEFLK 196
MFS_GLUT6_Class3 cd17434
Glucose transporter type 6, a Class 3 GLUT, of the Major Facilitator Superfamily of ...
130-334 2.12e-05

Glucose transporter type 6, a Class 3 GLUT, of the Major Facilitator Superfamily of transporters; Glucose transporter type 6 (GLUT6) is also called Solute carrier family 2, facilitated glucose transporter member 6 (SLC2A6). It is classified as a Class 3 GLUT protein, and is a facilitative glucose transporter that binds cytochalasin B with low affinity. It is found in the brain, spleen, and leucocytes. GLUT6 may function in oxalate secretion. SLC2A6 has been identified as an oxalate nephrolithiasis gene in mice; its deletion causes spontaneous calcium oxalate nephrolithiasis in the setting of hyperoxalaemia, hyperoxaluria, and nephrocalcinosis. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340992 [Multi-domain]  Cd Length: 417  Bit Score: 47.52  E-value: 2.12e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 130 SFALPSAEKD----MCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCR 205
Cdd:cd17434    22 SPVIPALEQGddprLHLNVHQISWFGSVFTLGAAAGGLSAMFLNDRLGRKLSIMFSAVPSALGYLLMGSAQGIWMLLLGR 101
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 206 LISGIGIG---GSLPIvfaYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsIIPhygwgfsmgtnyhfhsWRVFVIV 282
Cdd:cd17434   102 FLTGFAGGitaASIPV---YVSEISHPGVRGALGACPQIMAVFGSLALYALGL-LLP----------------WRWLAVA 161
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1907183268 283 CALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKV 334
Cdd:cd17434   162 GEVPVVIMILLLCFMPNSPRFLISKGKDEKALKALAWLRGPNTDYMTEFEQI 213
MFS_SLC22A4_5_OCTN1_2 cd17376
Solute carrier family 22 members 4 and 5 (also called Organic cation/carnitine transporters 1 ...
153-298 2.42e-05

Solute carrier family 22 members 4 and 5 (also called Organic cation/carnitine transporters 1 and 2) of the Major Facilitator Superfamily of transporters; This subfamily is composed of solute carrier family 22 members 4 (SLC22A4) and 5 (SLC22A5), and similar proteins. SLC22A4 is also called ergothioneine transporter (ETT) or organic cation/carnitine transporter 1 (OCTN1). It is a sodium-ion dependent, low affinity carnitine transporter, and a highly specific transporter for the uptake of ergothioneine (ET), a thiolated derivative of histidine with antioxidant properties. ET is a natural compound produced only by certain fungi and bacteria and must be absorbed from the diet by humans and other vetebrates. SLC22A5, also called organic cation/carnitine transporter 2 (OCTN2), is a sodium-ion dependent, high affinity carnitine transporter involved in the active cellular uptake of carnitine. SLC22A4/5 belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340934 [Multi-domain]  Cd Length: 342  Bit Score: 47.08  E-value: 2.42e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 153 IVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYgaFLFCRLISGIGIGGSLPIVFAYF--SEFLSRE 230
Cdd:cd17376    43 LFFVGVLLGSFISGQLSDRFGRKKVLFATMAVQTGFSFLQIFSPSW--EMFTVLFVIVGMGQISNYVVAFVlgTEILGKS 120
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1907183268 231 KRgehlswlGIFWMTGGIYASAMAWSIIPHYGwgfsmgtnYHFHSWRVFVIVCALPATVSMVALKFMP 298
Cdd:cd17376   121 VR-------ILFSTLGVCIFYAIGYMLLPLFA--------YFIRDWRMLLLALTLPGVLCVPLWWFIP 173
BtlA COG2270
MFS-type transporter involved in bile tolerance, Atg22 family [General function prediction ...
538-679 3.46e-05

MFS-type transporter involved in bile tolerance, Atg22 family [General function prediction only];


Pssm-ID: 225179 [Multi-domain]  Cd Length: 438  Bit Score: 46.53  E-value: 3.46e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 538 IYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVEL 617
Cdd:COG2270   290 LLLIGIALSVVAALGAIIAGFLDERFGSKPVLMIGLVILSIAALYLIFLEGELDFWILGLLVGTSLGGAQASSRSYLARL 369
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1907183268 618 YPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVV--PILLAAASLVGGGLIALRLPETRE 679
Cdd:COG2270   370 VPKGKEGRFFGLYALTGRAASFLGPFLVAVITQITGSSraGVLSIIVLLLIGLLLLLRVKVPGR 433
MFS_MCT_SLC16 cd17352
Monocarboxylate transporter (MCT) family of the Major Facilitator Superfamily of transporters; ...
539-675 3.53e-05

Monocarboxylate transporter (MCT) family of the Major Facilitator Superfamily of transporters; The animal Monocarboxylate transporter (MCT) family is also called Solute carrier family 16 (SLC16 or SLC16A). It is composed of 14 members, MCT1-14. MCTs play an integral role in cellular metabolism via lactate transport and have been implicated in metabolic synergy in tumors. MCT1-4 are proton-coupled transporters that facilitate the transport across the plasma membrane of monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and ketone bodies such as acetoacetate, beta-hydroxybutyrate and acetate. MCT8 and MCT10 are transporters which stimulate the cellular uptake of thyroid hormones such as thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). MCT10 also functions as a sodium-independent transporter that mediates the uptake or efflux of aromatic acids. Many members are orphan transporters whose substrates are yet to be determined. The MCT family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340910 [Multi-domain]  Cd Length: 361  Bit Score: 46.39  E-value: 3.53e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 539 YLVSFLGSLSvLPGNIISALLMDR--IGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWqCLFCGTSIAAWNAL-DVITV 615
Cdd:cd17352   222 FLLSIIGISD-IVGRILLGLLADKprIGRLYLYIFTLLILGLSLLAFPLATTYVGLIVF-SVLFGFCSGSYSSLtPVILA 299
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1907183268 616 ELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKV--VPILLAAASLVGGGLIALRLP 675
Cdd:cd17352   300 DLVGLEKLSNAYGLVLLFQGLAALVGPPIAGLLRDYTGDydAAFYFCGACLLLSGVLLFLLP 361
2_A_01_02 TIGR00880
Multidrug resistance protein;
538-677 5.03e-05

Multidrug resistance protein;


Pssm-ID: 273318 [Multi-domain]  Cd Length: 141  Bit Score: 43.79  E-value: 5.03e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 538 IYLVSFlgSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIG---WQCLFCGTSIAAWNALdviT 614
Cdd:TIGR00880   2 LLLAGY--ALGQLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSSNITVLIIarfLQGFGAAFALVAGAAL---I 76
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907183268 615 VELYPTNQRATAFGILNGLCKFGAILGnTIFASFVG--ITKVVPIL-LAAASLVGGGLIALRLPET 677
Cdd:TIGR00880  77 ADIYPPEERGVALGLMSAGIALGPLLG-PPLGGVLAqfLGWRAPFLfLAILALAAFILLAFLLPET 141
MFS_ExuT_GudP_like cd17319
Hexuronate transporter, Glucarate transporter, and similar transporters of the Major ...
540-675 6.22e-05

Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily; This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340877 [Multi-domain]  Cd Length: 358  Bit Score: 45.64  E-value: 6.22e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 540 LVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYP 619
Cdd:cd17319    42 LIASAFFLGYALFQVPGGWLLDRFGARKVLAVSMLLWSLFTALTGFATSLTSLYVLRFLLGVAEAGFFPGAIKALAEWFP 121
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1907183268 620 TNQRATAFGILNglckFGAILGNTIFASFVGI------TKVVPILLAAASLVGGGLIALRLP 675
Cdd:cd17319   122 ARERGRATGLFN----SGAPLGAAIGPPLSGWllllfgWRWAFIIEGLLGLLLAVLWWFYLR 179
PRK03893 PRK03893
putative sialic acid transporter; Provisional
108-263 6.80e-05

putative sialic acid transporter; Provisional


Pssm-ID: 179668 [Multi-domain]  Cd Length: 496  Bit Score: 45.84  E-value: 6.80e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 108 QWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKkvLSMSLAINA- 186
Cdd:PRK03893   18 QWKAFSAAWLGYLLDGFDFVLITLVLTEVQGEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRR--LAMVISIVLf 95
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1907183268 187 SFASLS-SFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGW 263
Cdd:PRK03893   96 SVGTLAcGFAPGYWTLFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSIGAVVAAQVYSLVVPVWGW 173
MFS_arabinose_efflux_permease_like cd17473
Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily; ...
83-298 8.32e-05

Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily; This family includes a group of putative arabinose efflux permease family transporters, such as alpha proteobacterium quinolone resistance protein NorA (characterized Staphylococcus aureus Quinolone resistance protein NorA belongs to a different group), Desulfovibrio dechloracetivorans bacillibactin exporter, Vibrio aerogenes antiseptic resistance protein. The biological function of those transporters remain unclear. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341026 [Multi-domain]  Cd Length: 374  Bit Score: 45.26  E-value: 8.32e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268  83 ERMEDEEELAHQYETIIDECGHGRFqWTLFFVLGLALMAdgveIFVVSFALPSAEKDMCL-SSSKKGMLGLIVYLGMMAG 161
Cdd:cd17473   175 EPARKSKSAASPGAATAAALPWKRV-LPIYFLAFLAMLL----FYVIPIQLPFLLQERGGgSAALIGLALAIASLAGAIG 249
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 162 AFILGGLADKLGRKKVLSMSLAINA-SFASLSsFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLG 240
Cdd:cd17473   250 ALLFGRLKRRLGKRRLLAIGFALMAlGFLLLA-LASGLWVVLLGAILAGLGFGLLLPTLNSWAMSLVPPELRGRAMGIVT 328
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 1907183268 241 IFwMTGGIYASAMAWSIIPHYGWGFSmgtnyhfhswRVFVIVCALpATVSMVALKFMP 298
Cdd:cd17473   329 SA-FFLGQFLSPLVLGPLVNLTGGLS----------GAFLILGVL-ALVLAIVLLLLR 374
MFS_MdtH_MDR_like cd17329
Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the ...
540-678 1.07e-04

Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340887 [Multi-domain]  Cd Length: 376  Bit Score: 44.91  E-value: 1.07e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 540 LVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWqclFCGTSIAA---WNALDVITVE 616
Cdd:cd17329    39 LVLALSAVAGIVASLIGGRLADRFGRKPVMLAGLLLRALGFALLGFAHSPWLFAIA---LVLTGFGGglfEPASEAMIAD 115
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1907183268 617 LYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALR-LPETR 678
Cdd:cd17329   116 VTTPENRTRAFSLLYWAINLGVAIGPLLGGLLLLYSFRLLFLAAAVLFLLAALVLLFlLPETR 178
MFS_ProP cd17366
Proline/betaine transporter of the Major Facilitator Superfamily of transporters; This ...
161-263 1.81e-04

Proline/betaine transporter of the Major Facilitator Superfamily of transporters; This subfamily is composed of Escherichia coli proline/betaine transporter, also called proline porter II (PPII), and similar proteins. ProP is a proton symporter that senses osmotic shifts and responds by importing osmolytes such as proline, glycine betaine, stachydrine, pipecolic acid, ectoine and taurine. It is both an osmosensor and an osmoregulator which is available to participate early in the bacterial osmoregulatory response. The ProP subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340924 [Multi-domain]  Cd Length: 377  Bit Score: 44.27  E-value: 1.81e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 161 GAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGA--------FLFCRLISGIGIGGSLPIVFAYFSEFLSREKR 232
Cdd:cd17366    56 GGLVFGPLGDKYGRQKVLAITIILMAASTFCIGLLPTYATigvwapilLLLARMVQGFSTGGEYGGAATFVAEYAPDRKR 135
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 1907183268 233 GEHLSWLGIFWMTGGIYAS----AMAWSIIP----HYGW 263
Cdd:cd17366   136 GFLGSWLEFGTLAGFILGAglvtLLTLLLTEaqmlDWGW 174
MFS_CitA cd17368
Citrate-proton symporter of the Major Facilitator Superfamily of transporters; Citrate-proton ...
161-238 2.42e-04

Citrate-proton symporter of the Major Facilitator Superfamily of transporters; Citrate-proton symporter, also called citrate carrier protein or citrate transporter or citrate utilization protein A (CitA), is a proton symporter that functions in the uptake of citrate across the boundary membrane. It allows the utilization of citrate as a sole source of carbon and energy. In Klebsiella pneumoniae, the gene encoding this protein is called citH, instead of citA, which is the case for Escherichia coli and other organisms. CitA belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340926 [Multi-domain]  Cd Length: 407  Bit Score: 43.90  E-value: 2.42e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 161 GAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGA--------FLFCRLISGIGIGGSLPIVFAYFSEFLSREKR 232
Cdd:cd17368    56 GAIVLGAYADRIGRKPAMTLTLAIMALGTLLIALAPTYATigiaapllVLLARLLQGFAAGGEVGGVTAYLVEAAPPGRR 135

                  ....*.
gi 1907183268 233 GEHLSW 238
Cdd:cd17368   136 GFYTSW 141
MFS_SLC46_TetA_like cd17330
Eukaryotic Solute carrier 46 (SLC46) family, Bacterial Tetracycline resistance proteins, and ...
538-675 2.73e-04

Eukaryotic Solute carrier 46 (SLC46) family, Bacterial Tetracycline resistance proteins, and similar proteins of the Major Facilitator Superfamily of transporters; This family is composed of the eukaryotic proteins MFSD9, MFSD10, MFSD14, and SLC46 family proteins, as well as bacterial multidrug resistance (MDR) transporters such as tetracycline resistance protein TetA and multidrug resistance protein MdtG. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. TetA proteins confer resistance to tetracycline while MdtG confers resistance to fosfomycin and deoxycholate. The Solute carrier 46 (SLC46) family is composed of three vertebrate members (SLC46A1, SLC46A2, and SLC46A3), the best-studied of which is SLC46A1, which functions both as an intestinal proton-coupled high-affinity folate transporter involved in the absorption of folates and as an intestinal heme transporter which mediates heme uptake. MFSD10 facilitates the uptake of organic anions such as some non-steroidal anti-inflammatory drugs (NSAIDs) and confers resistance to such NSAIDs. The SLC46/TetA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340888 [Multi-domain]  Cd Length: 349  Bit Score: 43.72  E-value: 2.73e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 538 IYLVSFLGS---LSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCL---FCGTSIAAWNALD 611
Cdd:cd17330    33 GYYVGLLQSsysLGQFLASPLWGRLSDRYGRKPVLLLSLAGSAVSYVLLGLSRNLWLLFLARFLdglTGGNVSVAQAYIA 112
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1907183268 612 VITVElyptNQRATAFGILNGLCKFGAILGNTI---FASFVGITkvVPILLAAASLVGGGLIALRLP 675
Cdd:cd17330   113 DITDE----EERAKAFGIISAAFGLGFILGPALggfLSTPYGYA--LPFLVAAALALLNLVLVLFFL 173
MFS_SLC22A6_OAT1_like cd17446
Solute carrier family 22 member 6 (also called Organic anion transporter 1) and similar ...
141-263 3.53e-04

Solute carrier family 22 member 6 (also called Organic anion transporter 1) and similar transporters of the Major Facilitator Superfamily; This subfamily includes solute carrier family 22 member 6 (SLC22A6, also called organic anion transporter 1 or OAT1 or para-aminohippurate (PAH) transporter), SLC22A8 (or OAT3), and SLC22A20 (or OAT6). OAT1 and OAT3 are involved in the renal elimination of endogenous and exogenous organic anions (OAs). They function as OA exchangers, coupling the uptake of OAs against an electrochemical gradient with the efflux of intracellular dicarboxylates. SLC22A20 is an OA transporter that mediates the uptake of estrone sulfate. The OAT1-like subfamily belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341004 [Multi-domain]  Cd Length: 339  Bit Score: 43.17  E-value: 3.53e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 141 CLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVF 220
Cdd:cd17446    29 CNHRALRQLAQSIYMAGVLVGAIVFGGLSDRFGRRPLLIWSYLQMAVSGTCAAFSPSFPIYCVFRFLTGMALSGIVLNSV 108
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 1907183268 221 AYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsIIPHYGW 263
Cdd:cd17446   109 SLNVEWMPTRVRAVVGTLLGYCYTLGQLILAGVAY-AIRDWRW 150
MFS_MucK cd17371
Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily; ...
107-269 3.71e-04

Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily; This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340929 [Multi-domain]  Cd Length: 389  Bit Score: 43.44  E-value: 3.71e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 107 FQWTLF------FVLGLALMADGVEI--FVVSFALPS---AEKDMclssSKKGMLGLIV--YLGMMAGAFILGGLADKLG 173
Cdd:cd17371   198 SLRELFsppllrTTLLASLLATGALGgyYGITTWLPSyltGERGL----SFEGSAGYLVvtILGGFLGYLAGGFLADRIG 273
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 174 RKKVLSMSLAinASFASLSSFVQG---YGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYA 250
Cdd:cd17371   274 RRNNFALFAL--GSAISILLYFFLplsPTLILILGFPLGFFASGPFSGMGAYLTELFPTAVRATAQGFCYNVGRIIGALF 351
                         170
                  ....*....|....*....
gi 1907183268 251 SAMAWSIIPHYGWGFSMGT 269
Cdd:cd17371   352 PFLVGFLATSGSLGTAIAV 370
2A0104 TIGR00881
phosphoglycerate transporter family protein; [Transport and binding proteins, Carbohydrates, ...
130-302 4.08e-04

phosphoglycerate transporter family protein; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273319 [Multi-domain]  Cd Length: 379  Bit Score: 43.13  E-value: 4.08e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 130 SFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISG 209
Cdd:TIGR00881  15 ALAMPYLVEEIGLSKTDLGLLLSSFSIAYGISKFVMGSVSDRSNPRVFLPIGLILCAIVNLFFGFSTSLWVMAALWALNG 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907183268 210 IGIGGSLPIVFAYFSEFLSREKRGehlSWLGiFWMTGGIYASAMAWSIiphygwgFSMGTNYHFhSWRVFVIVCALPA-T 288
Cdd:TIGR00881  95 IFQ