NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1907128347|ref|XP_036016804|]
View 

synaptopodin isoform X4 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PHA03247 super family cl33720
large tegument protein UL36; Provisional
576-848 1.60e-06

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 52.25  E-value: 1.60e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  576 SRATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYT-APVQDSLQPTAVS----------- 643
Cdd:PHA03247  2467 SLLLGELFPGAPVYRRPAEARFPFAAGAAPDPGGGGPPDPDAPPAPSRLAPAILPdEPVGEPVHPRMLTwirgleelasd 2546
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  644 ------PTYSSDISPVSPSRAwSPRAKQAPRP------SFSTRNAGIEAQDRPE------------SLPTSPPWTPAASR 699
Cdd:PHA03247  2547 dagdppPPLPPAAPPAAPDRS-VPPPRPAPRPsepavtSRARRPDAPPQSARPRapvddrgdprgpAPPSPLPPDTHAPD 2625
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  700 PPSSLDGWVSPGPWEPGRGSSMSSPPPLPPPPPMSPSWSERSVSPLRSETEARPPSRQLQALL---ARNIINAARRKSAS 776
Cdd:PHA03247  2626 PPPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAArptVGSLTSLADPPPPP 2705
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907128347  777 PRPAPAETLRPFSPPQGPPPPPARMRSPQ-------PASPARNFRGAAFSPIPRSPLPIGPSSCASPRSPQAAPSRPFP 848
Cdd:PHA03247  2706 PTPEPAPHALVSATPLPPGPAAARQASPAlpaapapPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLT 2784
PRK13914 super family cl36314
invasion associated endopeptidase;
15-132 3.12e-06

invasion associated endopeptidase;


The actual alignment was detected with superfamily member PRK13914:

Pssm-ID: 237555 [Multi-domain]  Cd Length: 481  Bit Score: 50.57  E-value: 3.12e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  15 EKVASEEEEVPLVvylKENAALLTANGLHLSQSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTA 94
Cdd:PRK13914  259 EAPAAEKQAAPVV---KENTNTNTATTEKKETTTQQQTAPKAPTEAAKPAPAPSTNTNANKTNTNTNTNTNNTNTSTPSK 335
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 1907128347  95 DINQNPPAAITPVPqNSSQAQCSPNGTLDSKPGTLCAD 132
Cdd:PRK13914  336 NTNTNTNSNTNTNS-NTNANQGSSNNNSNSSASAIIAE 372
PHA03247 super family cl33720
large tegument protein UL36; Provisional
52-344 2.07e-04

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 45.31  E-value: 2.07e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347   52 QSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTADINQNPPAAITPVPQNSSQAQCSPNGTLDSKPGtlca 131
Cdd:PHA03247  2730 QASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPA---- 2805
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  132 dDGQSPVPAeevRSSILLIDKVSAPPSAASTFSREATPLSSSGPPAADLMSSSLLIDMQPSTLVAPAEQEVPghvAVTTP 211
Cdd:PHA03247  2806 -DPPAAVLA---PAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAA---KPAAP 2878
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  212 TKVYSEvhlTLAKPAsvVNRTARPFGIQSPGTSQIEQSPMMGRRQfgEKAWAPPASSMADRSPQPQRHIMSRSPMVERRL 291
Cdd:PHA03247  2879 ARPPVR---RLARPA--VSRSTESFALPPDQPERPPQPQAPPPPQ--PQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAG 2951
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....
gi 1907128347  292 LGQRSPVLERRPLGNFTPPPTYA-ETLSTAPVASRVRSPPSYSTLYPSSDPKPS 344
Cdd:PHA03247  2952 AGEPSGAVPQPWLGALVPGRVAVpRFRVPQPAPSREAPASSTPPLTGHSLSRVS 3005
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
576-848 1.60e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 52.25  E-value: 1.60e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  576 SRATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYT-APVQDSLQPTAVS----------- 643
Cdd:PHA03247  2467 SLLLGELFPGAPVYRRPAEARFPFAAGAAPDPGGGGPPDPDAPPAPSRLAPAILPdEPVGEPVHPRMLTwirgleelasd 2546
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  644 ------PTYSSDISPVSPSRAwSPRAKQAPRP------SFSTRNAGIEAQDRPE------------SLPTSPPWTPAASR 699
Cdd:PHA03247  2547 dagdppPPLPPAAPPAAPDRS-VPPPRPAPRPsepavtSRARRPDAPPQSARPRapvddrgdprgpAPPSPLPPDTHAPD 2625
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  700 PPSSLDGWVSPGPWEPGRGSSMSSPPPLPPPPPMSPSWSERSVSPLRSETEARPPSRQLQALL---ARNIINAARRKSAS 776
Cdd:PHA03247  2626 PPPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAArptVGSLTSLADPPPPP 2705
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907128347  777 PRPAPAETLRPFSPPQGPPPPPARMRSPQ-------PASPARNFRGAAFSPIPRSPLPIGPSSCASPRSPQAAPSRPFP 848
Cdd:PHA03247  2706 PTPEPAPHALVSATPLPPGPAAARQASPAlpaapapPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLT 2784
PRK13914 PRK13914
invasion associated endopeptidase;
15-132 3.12e-06

invasion associated endopeptidase;


Pssm-ID: 237555 [Multi-domain]  Cd Length: 481  Bit Score: 50.57  E-value: 3.12e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  15 EKVASEEEEVPLVvylKENAALLTANGLHLSQSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTA 94
Cdd:PRK13914  259 EAPAAEKQAAPVV---KENTNTNTATTEKKETTTQQQTAPKAPTEAAKPAPAPSTNTNANKTNTNTNTNTNNTNTSTPSK 335
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 1907128347  95 DINQNPPAAITPVPqNSSQAQCSPNGTLDSKPGTLCAD 132
Cdd:PRK13914  336 NTNTNTNSNTNTNS-NTNANQGSSNNNSNSSASAIIAE 372
PHA03247 PHA03247
large tegument protein UL36; Provisional
52-344 2.07e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 45.31  E-value: 2.07e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347   52 QSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTADINQNPPAAITPVPQNSSQAQCSPNGTLDSKPGtlca 131
Cdd:PHA03247  2730 QASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPA---- 2805
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  132 dDGQSPVPAeevRSSILLIDKVSAPPSAASTFSREATPLSSSGPPAADLMSSSLLIDMQPSTLVAPAEQEVPghvAVTTP 211
Cdd:PHA03247  2806 -DPPAAVLA---PAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAA---KPAAP 2878
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  212 TKVYSEvhlTLAKPAsvVNRTARPFGIQSPGTSQIEQSPMMGRRQfgEKAWAPPASSMADRSPQPQRHIMSRSPMVERRL 291
Cdd:PHA03247  2879 ARPPVR---RLARPA--VSRSTESFALPPDQPERPPQPQAPPPPQ--PQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAG 2951
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....
gi 1907128347  292 LGQRSPVLERRPLGNFTPPPTYA-ETLSTAPVASRVRSPPSYSTLYPSSDPKPS 344
Cdd:PHA03247  2952 AGEPSGAVPQPWLGALVPGRVAVpRFRVPQPAPSREAPASSTPPLTGHSLSRVS 3005
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
576-848 1.60e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 52.25  E-value: 1.60e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  576 SRATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYT-APVQDSLQPTAVS----------- 643
Cdd:PHA03247  2467 SLLLGELFPGAPVYRRPAEARFPFAAGAAPDPGGGGPPDPDAPPAPSRLAPAILPdEPVGEPVHPRMLTwirgleelasd 2546
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  644 ------PTYSSDISPVSPSRAwSPRAKQAPRP------SFSTRNAGIEAQDRPE------------SLPTSPPWTPAASR 699
Cdd:PHA03247  2547 dagdppPPLPPAAPPAAPDRS-VPPPRPAPRPsepavtSRARRPDAPPQSARPRapvddrgdprgpAPPSPLPPDTHAPD 2625
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  700 PPSSLDGWVSPGPWEPGRGSSMSSPPPLPPPPPMSPSWSERSVSPLRSETEARPPSRQLQALL---ARNIINAARRKSAS 776
Cdd:PHA03247  2626 PPPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAArptVGSLTSLADPPPPP 2705
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907128347  777 PRPAPAETLRPFSPPQGPPPPPARMRSPQ-------PASPARNFRGAAFSPIPRSPLPIGPSSCASPRSPQAAPSRPFP 848
Cdd:PHA03247  2706 PTPEPAPHALVSATPLPPGPAAARQASPAlpaapapPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLT 2784
PRK13914 PRK13914
invasion associated endopeptidase;
15-132 3.12e-06

invasion associated endopeptidase;


Pssm-ID: 237555 [Multi-domain]  Cd Length: 481  Bit Score: 50.57  E-value: 3.12e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  15 EKVASEEEEVPLVvylKENAALLTANGLHLSQSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTA 94
Cdd:PRK13914  259 EAPAAEKQAAPVV---KENTNTNTATTEKKETTTQQQTAPKAPTEAAKPAPAPSTNTNANKTNTNTNTNTNNTNTSTPSK 335
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 1907128347  95 DINQNPPAAITPVPqNSSQAQCSPNGTLDSKPGTLCAD 132
Cdd:PRK13914  336 NTNTNTNSNTNTNS-NTNANQGSSNNNSNSSASAIIAE 372
PHA03247 PHA03247
large tegument protein UL36; Provisional
491-853 4.59e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 50.71  E-value: 4.59e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  491 SGHAELARCPSPTMSLPSSWKYTTNAPGGFRVASLSPARTPPASlyHGYLPENGVLRPEPTKQQPYQMRPSLYALSPVKE 570
Cdd:PHA03247  2578 SEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDT--HAPDPPPPSPSPAANEPDPHPPPTVPPPERPRDD 2655
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  571 PA----KASSRATSSRTPSRTVSP--RAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYTAPVQDSLQPTAVSP 644
Cdd:PHA03247  2656 PApgrvSRPRRARRLGRAAQASSPpqRPRRRAARPTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPAL 2735
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  645 TYS--------------------SDISPVSPSRAWSPRAKQAPRPSFSTRNAGIEAQDRPESLPTSP---PWTPAASRPP 701
Cdd:PHA03247  2736 PAApappavpagpatpggparpaRPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWdpaDPPAAVLAPA 2815
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  702 SSLDGWVSPGPWEP---GRGSSMSSPPPLPPPPPMSPSWSERSVSPLRSeteaRPPSRQLQALLARNIINAARRKSASPR 778
Cdd:PHA03247  2816 AALPPAASPAGPLPpptSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRR----RPPSRSPAAKPAAPARPPVRRLARPAV 2891
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1907128347  779 PAPAETLRPFSPPQGPPPPPARMRSPQPASPARnfrgAAFSPIPRSPLPIGPSSCASPRSPQAAPSRPFPYRRSP 853
Cdd:PHA03247  2892 SRSTESFALPPDQPERPPQPQAPPPPQPQPQPP----PPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGAVPQP 2962
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
486-706 3.20e-05

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 47.54  E-value: 3.20e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347 486 YVIESSGHAELARCPSP----TMSLPSSWKYTTNAPGGFRVASLSPARTPPASLYHGYLPENGVLRPEPTKQQPyqmrPS 561
Cdd:PRK07003  328 YQIATVGRGELGLAPDEyagfTMTLLRMLAFEPAVTGGGAPGGGVPARVAGAVPAPGARAAAAVGASAVPAVTA----VT 403
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347 562 LYALSPVKEPAKASSRATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYTAPVQDSLQPTA 641
Cdd:PRK07003  404 GAAGAALAPKAAAAAAATRAEAPPAAPAPPATADRGDDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASAPASD 483
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1907128347 642 VSPTYSSDISP--VSPSRAWSPRAKQAPRPSFSTRNAGIEAQDRPEslPTSPPWTPAASRPPSSLDG 706
Cdd:PRK07003  484 APPDAAFEPAPraAAPSAATPAAVPDARAPAAASREDAPAAAAPPA--PEARPPTPAAAAPAARAGG 548
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
490-863 1.04e-04

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 46.32  E-value: 1.04e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  490 SSGHAELARCPSPTMSLPSSWKYTTNAPGGFR--VASLSPARTPPAslyhgylPENGVLRPEPTKQQPYQMRPSLYALSP 567
Cdd:PHA03307    74 GPGTEAPANESRSTPTWSLSTLAPASPAREGSptPPGPSSPDPPPP-------TPPPASPPPSPAPDLSEMLRPVGSPGP 146
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  568 VKEPAKASSRATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGlytAPVQDSLQPTAVSPTYS 647
Cdd:PHA03307   147 PPAASPPAAGASPAAVASDAASSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRP---PRRSSPISASASSPAPA 223
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  648 SDISPVSPSRA--WSPRAKQAPRPSFSTRNAGIEAQDRPESLPTsPPWTPAASRPPSSLDGWVSPGPWEPGRGSSMSSPP 725
Cdd:PHA03307   224 PGRSAADDAGAssSDSSSSESSGCGWGPENECPLPRPAPITLPT-RIWEASGWNGPSSRPGPASSSSSPRERSPSPSPSS 302
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  726 PLPPPPPMSPSWSERSVSPLRSETEARPPSrqlqallarniiNAARRKSASPRPAPaetlRPFSPPQGPPPPPARMRSPQ 805
Cdd:PHA03307   303 PGSGPAPSSPRASSSSSSSRESSSSSTSSS------------SESSRGAAVSPGPS----PSRSPSPSRPPPPADPSSPR 366
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 1907128347  806 PASPARNFRGAAFSPIPRSPLPIGPSSCASPRSPQAAPSRPFPYRRSPTDSDVSLDSE 863
Cdd:PHA03307   367 KRPRPSRAPSSPAASAGRPTRRRARAAVAGRARRRDATGRFPAGRPRPSPLDAGAASG 424
PHA03247 PHA03247
large tegument protein UL36; Provisional
52-344 2.07e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 45.31  E-value: 2.07e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347   52 QSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTADINQNPPAAITPVPQNSSQAQCSPNGTLDSKPGtlca 131
Cdd:PHA03247  2730 QASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPA---- 2805
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  132 dDGQSPVPAeevRSSILLIDKVSAPPSAASTFSREATPLSSSGPPAADLMSSSLLIDMQPSTLVAPAEQEVPghvAVTTP 211
Cdd:PHA03247  2806 -DPPAAVLA---PAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAA---KPAAP 2878
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  212 TKVYSEvhlTLAKPAsvVNRTARPFGIQSPGTSQIEQSPMMGRRQfgEKAWAPPASSMADRSPQPQRHIMSRSPMVERRL 291
Cdd:PHA03247  2879 ARPPVR---RLARPA--VSRSTESFALPPDQPERPPQPQAPPPPQ--PQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAG 2951
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....
gi 1907128347  292 LGQRSPVLERRPLGNFTPPPTYA-ETLSTAPVASRVRSPPSYSTLYPSSDPKPS 344
Cdd:PHA03247  2952 AGEPSGAVPQPWLGALVPGRVAVpRFRVPQPAPSREAPASSTPPLTGHSLSRVS 3005
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
549-717 6.35e-04

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 43.52  E-value: 6.35e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347 549 EPTKQQPYQMRPSLYALSPVKEPAKASSRATSSRTPSRTVSPRaaSPAKPSSLDLVPNLPRAGLPPSPALPRPSrsspgl 628
Cdd:PTZ00449  568 KPSKIPTLSKKPEFPKDPKHPKDPEEPKKPKRPRSAQRPTRPK--SPKLPELLDIPKSPKRPESPKSPKRPPPP------ 639
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347 629 yTAPVQDSLQPTAVSPTYSSdiSPVSPSRAWSPRAKQAPRPSFSTRNAGIEAQDRPESLPTSPPWTPAASRPPSSLDGWV 708
Cdd:PTZ00449  640 -QRPSSPERPEGPKIIKSPK--PPKSPKPPFDPKFKEKFYDDYLDAAAKSKETKTTVVLDESFESILKETLPETPGTPFT 716

                  ....*....
gi 1907128347 709 SPGPWEPGR 717
Cdd:PTZ00449  717 TPRPLPPKL 725
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
566-754 6.92e-04

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 43.44  E-value: 6.92e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347 566 SPVKEPAKASSRATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGlPPSPALPRPSRSSPGLYTAPVQDSLQPTAVSPT 645
Cdd:PRK07764  603 PASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVA-APEHHPKHVAVPDASDGGDGWPAKAGGAAPAAP 681
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347 646 YSSDISPVSPSRAWSPRAKQAPRPSFSTRnagIEAQDRPESLPTSPPWTPAASRPPSSLDGWVSPGPWEPGRGSSMSSPP 725
Cdd:PRK07764  682 PPAPAPAAPAAPAGAAPAQPAPAPAATPP---AGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPPDPAGAPAQP 758
                         170       180
                  ....*....|....*....|....*....
gi 1907128347 726 PLPPPPPMSPSWSERSVSPLRSETEARPP 754
Cdd:PRK07764  759 PPPPAPAPAAAPAAAPPPSPPSEEEEMAE 787
dnaA PRK14086
chromosomal replication initiator protein DnaA;
581-718 2.32e-03

chromosomal replication initiator protein DnaA;


Pssm-ID: 237605 [Multi-domain]  Cd Length: 617  Bit Score: 41.73  E-value: 2.32e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347 581 SRTPSRTVSP--RAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYTAPVQDSLQPTAVSPTYSSDISPVSPSRA 658
Cdd:PRK14086   71 SETLSRELGRpiRIAITVDPSAGEPAPPPPHARRTSEPELPRPGRRPYEGYGGPRADDRPPGLPRQDQLPTARPAYPAYQ 150
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1907128347 659 WSPRAKQAPRPSFS-----TRNAGIEAQDRPEslPTSPPWTPAASRPPSSLDGWVSPGPWEPGRG 718
Cdd:PRK14086  151 QRPEPGAWPRAADDygwqqQRLGFPPRAPYAS--PASYAPEQERDREPYDAGRPEYDQRRRDYDH 213
PRK11907 PRK11907
bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase;
35-126 4.32e-03

bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase;


Pssm-ID: 237019 [Multi-domain]  Cd Length: 814  Bit Score: 40.61  E-value: 4.32e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  35 ALLTANGLHLSQSRETQQSSPNPP-----DTEVPSPAADINQNPSSPNATLTtlaSSSHHSQPTADINQNPPAAITPVpQ 109
Cdd:PRK11907   16 ALLTASNPKLAQAEEIVTTTPATSteaeqTTPVESDATEEADNTETPVAATT---AAEAPSSSETAETSDPTSEATDT-T 91
                          90
                  ....*....|....*..
gi 1907128347 110 NSSQAQCSPNGTLDSKP 126
Cdd:PRK11907   92 TSEARTVTPAATETSKP 108
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
548-859 4.57e-03

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 40.92  E-value: 4.57e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  548 PEPTKQQPYQMRPSLYALSPVKEPAKASSRATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGLPP-------SPALPR 620
Cdd:PHA03307    61 ACDRFEPPTGPPPGPGTEAPANESRSTPTWSLSTLAPASPAREGSPTPPGPSSPDPPPPTPPPASPPpspapdlSEMLRP 140
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  621 PSRSSPGLYTAPVQDSLQPTAV--SPTYSSDISPVSPSRAWSPRAKQAPRPSFSTRNAGIEAQDRPeslptSPPWTPAAS 698
Cdd:PHA03307   141 VGSPGPPPAASPPAAGASPAAVasDAASSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRP-----PRRSSPISA 215
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  699 RPPSSldgwvSPGPWEPGRGSSMSSPPPLPPPPPMSPSWSERSVSPLRSETEARPPSRQLQAllARNIINAARRKSASPR 778
Cdd:PHA03307   216 SASSP-----APAPGRSAADDAGASSSDSSSSESSGCGWGPENECPLPRPAPITLPTRIWEA--SGWNGPSSRPGPASSS 288
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  779 PAPAEtlrpfsPPQGPPPPPARMRSPQPASPARNFRGAAFSPIPRSPLPIGPSSCASPRSPQAAPSRPFPYRRSPTDSDV 858
Cdd:PHA03307   289 SSPRE------RSPSPSPSSPGSGPAPSSPRASSSSSSSRESSSSSTSSSSESSRGAAVSPGPSPSRSPSPSRPPPPADP 362

                   .
gi 1907128347  859 S 859
Cdd:PHA03307   363 S 363
PHA03247 PHA03247
large tegument protein UL36; Provisional
500-782 7.69e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 40.31  E-value: 7.69e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  500 PSPTMSLPSSWKYTTNAPGGFRVASLSPARTPPASLYHGYLPENGVLRPEPTKQQPYQMRPSLYALSPvkePAKASSRAT 579
Cdd:PHA03247  2712 PHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGP---PRRLTRPAV 2788
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  580 SSRTPSRTVSPRAASPAKPssldlvpnlPRAGLPPSPALPRPSRSSPGLytaPVQDSLQPTAVSPTYSSDISPVSPSRAW 659
Cdd:PHA03247  2789 ASLSESRESLPSPWDPADP---------PAAVLAPAAALPPAASPAGPL---PPPTSAQPTAPPPPPGPPPPSLPLGGSV 2856
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907128347  660 SPRAKQAPRPSFSTRNAGIEAQDRPeslPTSPPWTPAASRPPSSL----DGWVSPGPWEPGRGSSMSSPPPLPPPPPMSP 735
Cdd:PHA03247  2857 APGGDVRRRPPSRSPAAKPAAPARP---PVRRLARPAVSRSTESFalppDQPERPPQPQAPPPPQPQPQPPPPPQPQPPP 2933
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 1907128347  736 SWSERSVSPLRSETEARP--------PSRQLQALLARNIINAARR--KSASPRPAPA 782
Cdd:PHA03247  2934 PPPPRPQPPLAPTTDPAGagepsgavPQPWLGALVPGRVAVPRFRvpQPAPSREAPA 2990
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH