NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1907156435|ref|XP_036020098|]
View 

FK506-binding protein 15 isoform X2 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
40-133 3.95e-28

FKBP-type peptidyl-prolyl cis-trans isomerase;


:

Pssm-ID: 395196  Cd Length: 94  Bit Score: 108.83  E-value: 3.95e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435   40 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGW 119
Cdd:pfam00254    4 KAKKGDRVTVHYTGRLED----GTVFDSSYDRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGG 79
                           90
                   ....*....|....
gi 1907156435  120 TQPTDSILVFEVEV 133
Cdd:pfam00254   80 VIPPNATLVFEVEL 93
Smc super family cl34174
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
409-738 4.68e-20

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


The actual alignment was detected with superfamily member COG1196:

Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 96.71  E-value: 4.68e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  409 IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVT 488
Cdd:COG1196    679 LEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEEL--------KRELAALEEELEQLQSRLEELEEELEELE 750
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  489 EELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 568
Cdd:COG1196    751 EELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEI 830
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  569 TSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIR------KSHQEELDRLRQLLKKARVSTDQaaAEQLTL 642
Cdd:COG1196    831 EELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEeledelKELEEEKEELEEELRELESELAE--LKEEIE 908
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  643 AQAELQSQWEAKCEQLLASARDEHLQQYRE-VCAQRDAHQQKLALLQDECLALQA-QIAAFTEQKEHMQRLEKTKSQapa 720
Cdd:COG1196    909 KLRERLEELEAKLERLEVELPELEEELEEEyEDTLETELEREIERLEEEIEALGPvNLRAIEEYEEVEERYEELKSQ--- 985
                          330
                   ....*....|....*...
gi 1907156435  721 graAADPSEKVKKIMNQV 738
Cdd:COG1196    986 ---REDLEEAKEKLLEVI 1000
PHA03247 super family cl33720
large tegument protein UL36; Provisional
792-977 1.57e-04

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.08  E-value: 1.57e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  792 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 871
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  872 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 949
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1907156435  950 PalDPESQGGEAQPPECKQAEDVSSS-GP 977
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
PHA03247 super family cl33720
large tegument protein UL36; Provisional
150-343 9.44e-03

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 40.31  E-value: 9.44e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  150 SSRDSAAPSPIPASDSLSADPVVTPLPLPLKPGEPGlrskSNSLSEQLTVNSNPDTVKAKLISRMAKMGQPMLPILPPQ- 228
Cdd:PHA03247  2607 DPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHP----PPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQr 2682
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  229 ----------------LDSNDSETEDATVLRGAGQSLVTPSIQPSLQPAHPVLPqmASQAPQPSGSGLQTPSAALMQAvs 292
Cdd:PHA03247  2683 prrraarptvgsltslADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALP--AAPAPPAVPAGPATPGGPARPA-- 2758
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1907156435  293 ldSHSAVSGNAQNFQPYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAPH 343
Cdd:PHA03247  2759 --RPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADP 2807
 
Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
40-133 3.95e-28

FKBP-type peptidyl-prolyl cis-trans isomerase;


Pssm-ID: 395196  Cd Length: 94  Bit Score: 108.83  E-value: 3.95e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435   40 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGW 119
Cdd:pfam00254    4 KAKKGDRVTVHYTGRLED----GTVFDSSYDRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGG 79
                           90
                   ....*....|....
gi 1907156435  120 TQPTDSILVFEVEV 133
Cdd:pfam00254   80 VIPPNATLVFEVEL 93
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
409-738 4.68e-20

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 96.71  E-value: 4.68e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  409 IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVT 488
Cdd:COG1196    679 LEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEEL--------KRELAALEEELEQLQSRLEELEEELEELE 750
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  489 EELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 568
Cdd:COG1196    751 EELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEI 830
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  569 TSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIR------KSHQEELDRLRQLLKKARVSTDQaaAEQLTL 642
Cdd:COG1196    831 EELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEeledelKELEEEKEELEEELRELESELAE--LKEEIE 908
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  643 AQAELQSQWEAKCEQLLASARDEHLQQYRE-VCAQRDAHQQKLALLQDECLALQA-QIAAFTEQKEHMQRLEKTKSQapa 720
Cdd:COG1196    909 KLRERLEELEAKLERLEVELPELEEELEEEyEDTLETELEREIERLEEEIEALGPvNLRAIEEYEEVEERYEELKSQ--- 985
                          330
                   ....*....|....*...
gi 1907156435  721 graAADPSEKVKKIMNQV 738
Cdd:COG1196    986 ---REDLEEAKEKLLEVI 1000
FkpA COG0545
FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein ...
31-137 4.14e-18

FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223619 [Multi-domain]  Cd Length: 205  Bit Score: 84.00  E-value: 4.14e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435   31 QDLVAAEGPAVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGsgKVVKGLEDGLLGMKKGGKRLIITPSACA 110
Cdd:COG0545    106 KVLKAGDGAAPKKGDTVTVHYTGTLID----GTVFDSSYDRGQPAEFPLG--GVIPGWDEGLQGMKVGGKRKLTIPPELA 179
                           90       100
                   ....*....|....*....|....*..
gi 1907156435  111 AGSEGVIGwTQPTDSILVFEVEVRRVK 137
Cdd:COG0545    180 YGERGVPG-VIPPNSTLVFEVELLDVK 205
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
421-689 2.66e-15

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 81.26  E-value: 2.66e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  421 ERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLM------MEKRNNSLQTATENTQARILHAEQEKAKVTEELAAA 494
Cdd:TIGR02168  235 EELREELEELQEELKEAEEELEELTAELQELEEKLEELrlevseLEEEIEELQKELYALANEISRLEQQKQILRERLANL 314
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  495 TAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEE 574
Cdd:TIGR02168  315 ERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQ 394
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  575 LTDLRAEKTSLEKNLS---ERKKKSAQERCQAEAEMDEIRKS-HQEELDRLRQLLKKArVSTDQAAAEQLTLAQAELqsq 650
Cdd:TIGR02168  395 IASLNNEIERLEARLErleDRRERLQQEIEELLKKLEEAELKeLQAELEELEEELEEL-QEELERLEEALEELREEL--- 470
                          250       260       270
                   ....*....|....*....|....*....|....*....
gi 1907156435  651 weAKCEQLLASARDEHLQqyrevcaqrdaHQQKLALLQD 689
Cdd:TIGR02168  471 --EEAEQALDAAERELAQ-----------LQARLDSLER 496
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
418-717 3.17e-10

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 63.17  E-value: 3.17e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  418 QENERLKQELL---------EKSSRIE-------------EQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQA 475
Cdd:pfam15742   13 EEVQQLRQDLHrlqilcssaERELRYEreknldlkqhnslLQEENIKIKAELKQ--AQQKLLDSTKMCSSLTAEWEHCQQ 90
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  476 RILHAEQEKAKVTEELAAATA---QVSHLQLKMTAHQKKETELQLQLTD--NLKETDLLRGHVTRLQADLSELREASEQT 550
Cdd:pfam15742   91 KIRELELEVLKQAQSIKSQNSlqeKLAQEKSKVAEAEKKILELQQKLEHahKVCLTETCILEKKQLEEEIKEAQENEAKL 170
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  551 QTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKShqEELDRLRQLLKkarv 630
Cdd:pfam15742  171 KQQYQEEQQKRKLLDQNVNELQQQVRILQDKEAQLERTNSQQQLRIQQQEAQLKQLENEKRKS--DEHLKSNQELS---- 244
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  631 stdqaaaEQLTLAQAELQSQWEaKCEQLLASArDEHLQQYREVCAQRDAHQQKL-ALLQDECLALQAQIAAFTEQKEHMQ 709
Cdd:pfam15742  245 -------EKLSSLQQEKEALQE-ELQQFLKQL-DVHVRKYNEKHHHHKAKLRRAkDRLLHEVEQRDERIKQLENEIRILQ 315

                   ....*...
gi 1907156435  710 RLEKTKSQ 717
Cdd:pfam15742  316 SQIEKEKA 323
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
480-875 6.44e-10

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 63.39  E-value: 6.44e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  480 AEQEKaKVTEELAAATAQVSHLQLK-MTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-----EASEQTQTK 553
Cdd:NF033930    85 AKKEK-KASEEEQKANLAVQKAYVKyRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRakvvpEAEELAETK 163
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  554 FKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSaqERCQAEAEMDEIrkshQEELDRLRQLLKKARVSTD 633
Cdd:NF033930   164 KKAEEAKAEEPVAKKKVDEAKKKVEEAKKKVEAEEAEIEKLQN--EEVALEAKIAEL----ENQVDNLEKELAEIDESDS 237
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  634 QAAAEQ---------LTLAQAELqSQWEAKCEQLLASARDEHLQQyrevcaQRDAHQQKLALLQDECLALQAQIAAFTEQ 704
Cdd:NF033930   238 EDYIKEglrapleseLDAKQAKL-AKKQTELEKLLDSLDPEGKTQ------DELDKEAAEEELSKKIDELDNEVAKLEKE 310
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  705 KEHMQRLEKtkSQAPAGRAAADPSEKVKKImnqvfqslrgefELEEsydggtilrtimhTIKMVTlQLLNHQEEEEEEEE 784
Cdd:NF033930   311 VSDLENSDN--NVADYYKEALEKDLATKKA------------ELEK-------------TQKDLD-KALNELGPDGDEEE 362
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  785 EEEEEKKPLRPSlEQPGPA----TPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPEngaqtrkgEPAEAEVPS 860
Cdd:NF033930   363 TPAPAPQPEQPA-PAPAPApkpeQPAPAPKPEKPADQQAEEDYARRSEEEYNRLTQQQPPKAE--------KPAPAPAPK 433
                          410
                   ....*....|....*
gi 1907156435  861 eikdsslPPQPAGIP 875
Cdd:NF033930   434 -------PEQPAPAP 441
PTZ00121 PTZ00121
MAEBL; Provisional
419-732 4.98e-09

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 60.93  E-value: 4.98e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  419 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKvTEELAAATAQV 498
Cdd:PTZ00121  1312 EEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKK-ADAAKKKAEEK 1390
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  499 shlqlKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEqtqTKFKSEkQSRRQLELKVTSlEEELTDL 578
Cdd:PTZ00121  1391 -----KKADEAKKKAEEDKKKADELKKAAAAKKKADEAKKKAEEKKKADE---AKKKAE-EAKKADEAKKKA-EEAKKAE 1460
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  579 RAEKTSLEKNLSERKKKSAQERCQAE--AEMDEIRKSHQEELDRLRQLLKKA---RVSTDQAAAEQLTLAQAELQSQWEA 653
Cdd:PTZ00121  1461 EAKKKAEEAKKADEAKKKAEEAKKADeaKKKAEEAKKKADEAKKAAEAKKKAdeaKKAEEAKKADEAKKAEEAKKADEAK 1540
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  654 KCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK--EHMQRLEKTKSQAPAGRAAADPSEKV 731
Cdd:PTZ00121  1541 KAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEAriEEVMKLYEEEKKMKAEEAKKAEEAKI 1620

                   .
gi 1907156435  732 K 732
Cdd:PTZ00121  1621 K 1621
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
395-600 2.00e-05

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 48.47  E-value: 2.00e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  395 MLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDliernqryvEQSNLMMEKRNNSLQTATENTQ 474
Cdd:NF038025    23 DLLENMAKEKDEKQIKKAADEVTAEKDDLLDELENEQEEEPETFTEQKE---------EEDKEDLEAILDELATEANKAS 93
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  475 ARILHAEQEKAKVTEELAAataqvshlqlkmtahqKKETELQLqltdNLKEtdllrghvtrlqaDLSELREaseqtqtkf 554
Cdd:NF038025    94 AELDEVNAEIQGVKEEIKE----------------KQEQLMVL----DTKE-------------ELDELSE--------- 131
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*..
gi 1907156435  555 ksEKQSRRQ-LELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQER 600
Cdd:NF038025   132 --EELAERQeLEAEIKQLEAQLDELEEEKEELEEELKTIRKDQWSQT 176
PspC_subgroup_1 NF033838
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ...
409-847 4.41e-05

pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.


Pssm-ID: 411407 [Multi-domain]  Cd Length: 684  Bit Score: 47.70  E-value: 4.41e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  409 IMSNIQRIIQEnerlKQELLEKSSRIEEQ--NDKISDLierNQRYVEQSNLMMEKRNNSLQTAT-ENTQARILHAEQEKA 485
Cdd:NF033838    63 VESHLEKILSE----IQKSLDKRKHTQNValNKKLSDI---KTEYLYELNVLKEKSEAELTSKTkKELDAAFEQFKKDTL 135
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  486 KVTEELAAATAQVSHLQLKmtAHQKKETELQLQLTDNLK--ETDLLRGHVTRLQADLSELREASEQTQtkfksEKQSRRQ 563
Cdd:NF033838   136 EPGKKVAEATKKVEEAEKK--AKDQKEEDRRNYPTNTYKtlELEIAESDVEVKKAELELVKEEAKEPR-----DEEKIKQ 208
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  564 LELKVTSLEEELTDLRAEKTSLEKnlSERKKKSAQERCQAEAEMDEIRKSHQEELDRL--RQLL----------KKARvS 631
Cdd:NF033838   209 AKAKVESKKAEATRLEKIKTDREK--AEEEAKRRADAKLKEAVEKNVATSEQDKPKRRakRGVLgepatpdkkeNDAK-S 285
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  632 TDQAAAEQlTLAQAELqsqweaKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAqiaAFTEQKEHMQRL 711
Cdd:NF033838   286 SDSSVGEE-TLPSPSL------KPEKKVAEAEKKVEEAKKKAKDQKEEDRRNYPTNTYKTLELEI---AESDVKVKEAEL 355
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  712 EKTKSQAPAGRAaadpSEKVKKIMNQVfQSLRGEfeleesydgGTILRTIMHTIKMVTLQLLNHQEEEEEEEEEEEEEKK 791
Cdd:NF033838   356 ELVKEEAKEPRN----EEKIKQAKAKV-ESKKAE---------ATRLEKIKTDRKKAEEEAKRKAAEEDKVKEKPAEQPQ 421
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156435  792 PL---RPSLEQPGPATPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPENGAQ 847
Cdd:NF033838   422 PApapQPEKPAPKPEKPAEQPKAEKPADQQAEEDYARRSEEEYNRLTQQQPPKTEKPAQ 480
PHA03247 PHA03247
large tegument protein UL36; Provisional
792-977 1.57e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.08  E-value: 1.57e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  792 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 871
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  872 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 949
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1907156435  950 PalDPESQGGEAQPPECKQAEDVSSS-GP 977
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
PRK11570 PRK11570
peptidyl-prolyl cis-trans isomerase; Provisional
33-133 8.31e-04

peptidyl-prolyl cis-trans isomerase; Provisional


Pssm-ID: 183207  Cd Length: 206  Bit Score: 41.71  E-value: 8.31e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435   33 LVAAEGPAVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSgkVVKGLEDGLLGMKKGGKRLIITPSACAAG 112
Cdd:PRK11570   109 LTQGEGAIPARTDRVRVHYTGKLID----GTVFDSSVARGEPAEFPVNG--VIPGWIEALTLMPVGSKWELTIPHELAYG 182
                           90       100
                   ....*....|....*....|.
gi 1907156435  113 SEGViGWTQPTDSILVFEVEV 133
Cdd:PRK11570   183 ERGA-GASIPPFSTLVFEVEL 202
BREX_BrxC NF033441
BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, ...
533-734 1.26e-03

BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, from BREX (bacteriophage exclusion) systems of type 1.


Pssm-ID: 380283  Cd Length: 1173  Bit Score: 42.96  E-value: 1.26e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  533 VTRLQADLSELREAS--EQTQTKFKSEKQSRRQLELKVTSLEEELT--------DLRAEKTSLEKNLSERKKKSAQErcq 602
Cdd:NF033441   928 LEPALALLEEILSIKdnEEFLKALNKKEDDLLDLIEDWEDVKSFFEgdqlpiwdRALRLLKEYEDNLDYELDEEAEE--- 1004
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  603 AEAEMDEI-------RKSHQ--EELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSqwEAKCEQLLASARDEHLQQYREv 673
Cdd:NF033441  1005 AIEELRSIladpdpySRIPDlpPLLEALREALREALEELREAALEAIEEAKAELEA--DLEWQELSDEQQNRLLAPFDE- 1081
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1907156435  674 CAQRDAHQQKLALLQDeclaLQAQIA--AFTEQKEHMQRL--EKTKSQAPAGRAAADPSEKVKKI 734
Cdd:NF033441  1082 LKERIEPEVSIASLRA----LLDQLAdaLLDRLLDRIEALiqRFQEEKAEPEVKEAAAEPPEPKV 1142
PHA03247 PHA03247
large tegument protein UL36; Provisional
150-343 9.44e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 40.31  E-value: 9.44e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  150 SSRDSAAPSPIPASDSLSADPVVTPLPLPLKPGEPGlrskSNSLSEQLTVNSNPDTVKAKLISRMAKMGQPMLPILPPQ- 228
Cdd:PHA03247  2607 DPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHP----PPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQr 2682
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  229 ----------------LDSNDSETEDATVLRGAGQSLVTPSIQPSLQPAHPVLPqmASQAPQPSGSGLQTPSAALMQAvs 292
Cdd:PHA03247  2683 prrraarptvgsltslADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALP--AAPAPPAVPAGPATPGGPARPA-- 2758
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1907156435  293 ldSHSAVSGNAQNFQPYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAPH 343
Cdd:PHA03247  2759 --RPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADP 2807
 
Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
40-133 3.95e-28

FKBP-type peptidyl-prolyl cis-trans isomerase;


Pssm-ID: 395196  Cd Length: 94  Bit Score: 108.83  E-value: 3.95e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435   40 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGW 119
Cdd:pfam00254    4 KAKKGDRVTVHYTGRLED----GTVFDSSYDRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGG 79
                           90
                   ....*....|....
gi 1907156435  120 TQPTDSILVFEVEV 133
Cdd:pfam00254   80 VIPPNATLVFEVEL 93
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
409-738 4.68e-20

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 96.71  E-value: 4.68e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  409 IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVT 488
Cdd:COG1196    679 LEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEEL--------KRELAALEEELEQLQSRLEELEEELEELE 750
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  489 EELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 568
Cdd:COG1196    751 EELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEI 830
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  569 TSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIR------KSHQEELDRLRQLLKKARVSTDQaaAEQLTL 642
Cdd:COG1196    831 EELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEeledelKELEEEKEELEEELRELESELAE--LKEEIE 908
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  643 AQAELQSQWEAKCEQLLASARDEHLQQYRE-VCAQRDAHQQKLALLQDECLALQA-QIAAFTEQKEHMQRLEKTKSQapa 720
Cdd:COG1196    909 KLRERLEELEAKLERLEVELPELEEELEEEyEDTLETELEREIERLEEEIEALGPvNLRAIEEYEEVEERYEELKSQ--- 985
                          330
                   ....*....|....*...
gi 1907156435  721 graAADPSEKVKKIMNQV 738
Cdd:COG1196    986 ---REDLEEAKEKLLEVI 1000
FkpA COG0545
FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein ...
31-137 4.14e-18

FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223619 [Multi-domain]  Cd Length: 205  Bit Score: 84.00  E-value: 4.14e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435   31 QDLVAAEGPAVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGsgKVVKGLEDGLLGMKKGGKRLIITPSACA 110
Cdd:COG0545    106 KVLKAGDGAAPKKGDTVTVHYTGTLID----GTVFDSSYDRGQPAEFPLG--GVIPGWDEGLQGMKVGGKRKLTIPPELA 179
                           90       100
                   ....*....|....*....|....*..
gi 1907156435  111 AGSEGVIGwTQPTDSILVFEVEVRRVK 137
Cdd:COG0545    180 YGERGVPG-VIPPNSTLVFEVELLDVK 205
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
421-717 1.35e-16

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 85.54  E-value: 1.35e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  421 ERLKQELLEKSSRIEEQNDKISDLI--------------ERNQRYVEQSNlmmEKRnnSLQTATenTQARILHAEQEKAK 486
Cdd:COG1196    171 KERKEEAERKLERTEENLERLEDLLeelekqleklerqaEKAERYQELKA---ELR--ELELAL--LLAKLKELRKELEE 243
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  487 VTEELAAATAQVSHLQLKMtahQKKETELQlQLTDNLKEtdlLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLEL 566
Cdd:COG1196    244 LEEELSRLEEELEELQEEL---EEAEKEIE-ELKSELEE---LREELEELQEELLELKEEIEELEGEISLLRERLEELEN 316
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  567 KVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLL--KKARVSTDQAAAE-QLTLA 643
Cdd:COG1196    317 ELEELEERLEELKEKIEALKEELEERETLLEELE-QLLAELEEAKEELEEKLSALLEELeeLFEALREELAELEaELAEI 395
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1907156435  644 QAELQSQweAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQ-RLEKTKSQ 717
Cdd:COG1196    396 RNELEEL--KREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRdRLKELERE 468
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
421-689 2.66e-15

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 81.26  E-value: 2.66e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  421 ERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLM------MEKRNNSLQTATENTQARILHAEQEKAKVTEELAAA 494
Cdd:TIGR02168  235 EELREELEELQEELKEAEEELEELTAELQELEEKLEELrlevseLEEEIEELQKELYALANEISRLEQQKQILRERLANL 314
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  495 TAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEE 574
Cdd:TIGR02168  315 ERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQ 394
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  575 LTDLRAEKTSLEKNLS---ERKKKSAQERCQAEAEMDEIRKS-HQEELDRLRQLLKKArVSTDQAAAEQLTLAQAELqsq 650
Cdd:TIGR02168  395 IASLNNEIERLEARLErleDRRERLQQEIEELLKKLEEAELKeLQAELEELEEELEEL-QEELERLEEALEELREEL--- 470
                          250       260       270
                   ....*....|....*....|....*....|....*....
gi 1907156435  651 weAKCEQLLASARDEHLQqyrevcaqrdaHQQKLALLQD 689
Cdd:TIGR02168  471 --EEAEQALDAAERELAQ-----------LQARLDSLER 496
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
379-705 4.53e-15

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 80.50  E-value: 4.53e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  379 LMTKVEELQKHSSgnsMLLPSMSV-TMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNL 457
Cdd:TIGR02169  693 LQSELRRIENRLD---ELSQELSDaSRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQEIENVKSELKELEARIEE 769
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  458 MMEKRNNsLQTATENTQARILHA-----EQEKAKVTEELAAATAQVSHLQLKMtahqkKETELQLQLTDNLKETdlLRGH 532
Cdd:TIGR02169  770 LEEDLHK-LEEALNDLEARLSHSripeiQAELSKLEEEVSRIEARLREIEQKL-----NRLTLEKEYLEKEIQE--LQEQ 841
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  533 VTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKsaqeRCQAEAEMDEIRK 612
Cdd:TIGR02169  842 RIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERK----IEELEAQIEKKRK 917
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  613 sHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQ-SQWEAKCEQLLASARD------EHLQQYREVCAQRDAHQQKLA 685
Cdd:TIGR02169  918 -RLSELKAKLEALEEELSEIEDPKGEDEEIPEEELSlEDVQAELQRVEEEIRAlepvnmLAIQEYEEVLKRLDELKEKRA 996
                          330       340
                   ....*....|....*....|
gi 1907156435  686 LLQDECLALQAQIAAFTEQK 705
Cdd:TIGR02169  997 KLEEERKAILERIEEYEKKK 1016
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
410-753 7.95e-15

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 79.76  E-value: 7.95e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  410 MSNIQRIiQENERLKQELLEkssRIEEQNDKISDLIERNQRYVEQSN-------LMMEKRNNSLQTATENTQARILHAEQ 482
Cdd:COG1196    178 ERKLERT-EENLERLEDLLE---ELEKQLEKLERQAEKAERYQELKAelrelelALLLAKLKELRKELEELEEELSRLEE 253
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  483 EKAKVTEELAAATAQVSHLQLKMTAHQKKETELQ---LQLTDNLKETD----LLRGHVTRLQADLSELREASEQTQTKFK 555
Cdd:COG1196    254 ELEELQEELEEAEKEIEELKSELEELREELEELQeelLELKEEIEELEgeisLLRERLEELENELEELEERLEELKEKIE 333
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  556 SEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRK----------SHQEELDRLRQLL 625
Cdd:COG1196    334 ALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFEALREELAELEAelaeirneleELKREIESLEERL 413
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  626 KKARVSTDQAAAEQLTLAQ--AELQSQWEAKCEQLlasarDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIaafte 703
Cdd:COG1196    414 ERLSERLEDLKEELKELEAelEELQTELEELNEEL-----EELEEQLEELRDRLKELERELAELQEELQRLEKEL----- 483
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|
gi 1907156435  704 qKEHMQRLEKTKSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFELEESYD 753
Cdd:COG1196    484 -SSLEARLDRLEAEQRASQGVRAVLEALESGLPGVYGPVAELIKVKEKYE 532
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
407-717 1.71e-13

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 75.18  E-value: 1.71e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  407 SMIMSNIQRIIQENERLKQELLEKSSRIEEQndkISDLIERNQRYVEQSNLMME----KRNNSLQTATENTQARILHAEQ 482
Cdd:COG0419    170 EKLSELLKEVIKEAKAKIEELEGQLSELLED---IEDLLEALEEELKELKKLEEiqeeQEEEELEQEIEALEERLAELEE 246
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  483 EKaKVTEELAAATAQVSHLQLKMTAHQKKE----TELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQ---TKFK 555
Cdd:COG0419    247 EK-ERLEELKARLLEIESLELEALKIREEElrelERLLEELEEKIERLEELEREIEELEEELEGLRALLEELEellEKLK 325
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  556 SEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMD---EIRKSHQEELDRLRQLL--KKARV 630
Cdd:COG0419    326 SLEERLEKLEEKLEKLESELEELAEEKNELAKLLEERLKELEERLEELEKELEkalERLKQLEEAIQELKEELaeLSAAL 405
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  631 STDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRE--------------VCAQ--RDAHQQKLALLQDECL-A 693
Cdd:COG0419    406 EEIQEELEELEKELEELERELEELEEEIKKLEEQINQLESKElmiaelagagekcpVCGQelPEEHEKELLELYELELeE 485
                          330       340
                   ....*....|....*....|....
gi 1907156435  694 LQAQIAAFTEQKEHMQRLEKTKSQ 717
Cdd:COG0419    486 LEEELSREKEEAELREEIEELEKE 509
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
469-750 3.75e-13

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 73.94  E-value: 3.75e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  469 ATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASE 548
Cdd:TIGR02168  664 GSAKTNSSILERRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVE 743
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  549 QTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKK--SAQERCQA-EAEMDEIRKSHQEELDRLRQLL 625
Cdd:TIGR02168  744 QLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQieQLKEELKAlREALDELRAELTLLNEEAANLR 823
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  626 KKARVSTDQAAAEQLTLaqAELQSQWEAKCEQL---------LASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQA 696
Cdd:TIGR02168  824 ERLESLERRIAATERRL--EDLEEQIEELSEDIeslaaeieeLEELIEELESELEALLNERASLEEALALLRSELEELSE 901
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 1907156435  697 QIAaftEQKEHMQRLEKTKSQAPAGRAAADPS-EKVKKIMNQVFQSLRGEFELEE 750
Cdd:TIGR02168  902 ELR---ELESKRSELRRELEELREKLAQLELRlEGLEVRIDNLQERLSEEYSLTL 953
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
355-626 6.55e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 70.09  E-value: 6.55e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  355 MTEARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSvtMETSMIMSNIQRIIQENERLKQELLEKSSRI 434
Cdd:TIGR02168  686 IEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALR--KDLARLEAEVEQLEERIAQLSKELTELEAEI 763
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  435 EEQNDKISDL----------IERNQRYVEQSNLMMEK------------------------RNNSLQTATENTQARILHA 480
Cdd:TIGR02168  764 EELEERLEEAeeelaeaeaeIEELEAQIEQLKEELKAlrealdelraeltllneeaanlreRLESLERRIAATERRLEDL 843
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  481 EQEKAKVTEELAAATAQVSHLQLKMTahqkketELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQS 560
Cdd:TIGR02168  844 EEQIEELSEDIESLAAEIEELEELIE-------ELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRE 916
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907156435  561 RRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLK 626
Cdd:TIGR02168  917 LEELREKLAQLELRLEGLEVRIDNLQERLSEEYSLTLEEAEALENKIEDDEEEARRRLKRLENKIK 982
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
474-718 7.50e-12

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 69.74  E-value: 7.50e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  474 QARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTK 553
Cdd:COG1196    659 KRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSR 738
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  554 FKSEKQSRRQLELKVTSL-------EEELTDLRAEKTSLEknlsERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLK 626
Cdd:COG1196    739 LEELEEELEELEEELEELqerleelEEELESLEEALAKLK----EEIEELEEKRQALQEELEELEEELEEAERRLDALER 814
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  627 KARVSTDQAAAEQLTLAQAELQ-SQWEAKCEQL------LASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIa 699
Cdd:COG1196    815 ELESLEQRRERLEQEIEELEEEiEELEEKLDELeeeleeLEKELEELKEELEELEAEKEELEDELKELEEEKEELEEEL- 893
                          250
                   ....*....|....*....
gi 1907156435  700 afTEQKEHMQRLEKTKSQA 718
Cdd:COG1196    894 --RELESELAELKEEIEKL 910
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
408-737 8.94e-12

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 69.40  E-value: 8.94e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  408 MIMSNIQRIIQENERLKQeLLEKSSRIEEQNDKISDLIE-----RNQRYVEQSNLMMEKRNN--SLQTATENTQARILHA 480
Cdd:COG0419    309 GLRALLEELEELLEKLKS-LEERLEKLEEKLEKLESELEelaeeKNELAKLLEERLKELEERleELEKELEKALERLKQL 387
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  481 EQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQ---LQLTDNLKETDLLRGHVTRLQADLSELREASEQ-----TQT 552
Cdd:COG0419    388 EEAIQELKEELAELSAALEEIQEELEELEKELEELErelEELEEEIKKLEEQINQLESKELMIAELAGAGEKcpvcgQEL 467
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  553 KFKSEKQSRRQLELKVTSLEEELTdLRAEKTSLEKNLSERKKK---SAQERCQAEAEMDEIRKSHQEELDRLRQLLKKAR 629
Cdd:COG0419    468 PEEHEKELLELYELELEELEEELS-REKEEAELREEIEELEKElreLEEELIELLELEEALKEELEEKLEKLENLLEELE 546
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  630 VSTDQAAAEQLtlaQAELQSqweakCEQLLASARDEhLQQYREVCAQrdahQQKLALLQDECLALQAQIAAFTEQKEHMQ 709
Cdd:COG0419    547 ELKEKLQLQQL---KEELRQ-----LEDRLQELKEL-LEELRLLRTR----KEELEELRERLKELKKKLKELEERLSQLE 613
                          330       340
                   ....*....|....*....|....*...
gi 1907156435  710 RLEKTKSQAPAGRAAADPSEKVKKIMNQ 737
Cdd:COG0419    614 ELLQSLELSEAENELEEAEEELESELEK 641
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
475-753 1.10e-11

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 69.32  E-value: 1.10e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  475 ARILHAE-QEKAKVTEELAAataqVSHLQLKmtahqKKETELQL--------QLTDNLKEtdlLRGHVTRLQA------- 538
Cdd:TIGR02168  147 SEIIEAKpEERRAIFEEAAG----ISKYKER-----RKETERKLertrenldRLEDILNE---LERQLKSLERqaekaer 214
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  539 ------------------DLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKK----- 595
Cdd:TIGR02168  215 ykelkaelrelelallvlRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKElyala 294
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  596 SAQERCQAEAEMDEIRKSH----QEELDRLRQLLKKARVsTDQAAAEQLTLAQAELQSQWEAKCEQL--LASARDEHLQQ 669
Cdd:TIGR02168  295 NEISRLEQQKQILRERLANlerqLEELEAQLEELESKLD-ELAEELAELEEKLEELKEELESLEAELeeLEAELEELESR 373
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  670 YREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQ-RLEKTKSQAPAGRAAADPSEKvKKIMNQVFQSLRGEFEL 748
Cdd:TIGR02168  374 LEELEEQLETLRSKVAQLELQIASLNNEIERLEARLERLEdRRERLQQEIEELLKKLEEAEL-KELQAELEELEEELEEL 452

                   ....*
gi 1907156435  749 EESYD 753
Cdd:TIGR02168  453 QEELE 457
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
414-646 1.77e-10

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 65.47  E-value: 1.77e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  414 QRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQtateNTQARILHAEQEKAKVTEELAA 493
Cdd:TIGR02169  272 QLLEELNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKERELEDAEERLA----KLEAEIDKLLAEIEELEREIEE 347
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  494 ATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEE 573
Cdd:TIGR02169  348 ERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELDRLQEELQRLSEELADLNA 427
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156435  574 ELTDLRAEKTSLE---KNLSERKKKSAQERCQAEAEMDEIRKSH---QEELDRLRQLLKKARVSTDQAAAEQLTLAQAE 646
Cdd:TIGR02169  428 AIAGIEAKINELEeekEDKALEIKKQEWKLEQLAADLSKYEQELydlKEEYDRVEKELSKLQRELAEAEAQARASEERV 506
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
418-717 3.17e-10

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 63.17  E-value: 3.17e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  418 QENERLKQELL---------EKSSRIE-------------EQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQA 475
Cdd:pfam15742   13 EEVQQLRQDLHrlqilcssaERELRYEreknldlkqhnslLQEENIKIKAELKQ--AQQKLLDSTKMCSSLTAEWEHCQQ 90
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  476 RILHAEQEKAKVTEELAAATA---QVSHLQLKMTAHQKKETELQLQLTD--NLKETDLLRGHVTRLQADLSELREASEQT 550
Cdd:pfam15742   91 KIRELELEVLKQAQSIKSQNSlqeKLAQEKSKVAEAEKKILELQQKLEHahKVCLTETCILEKKQLEEEIKEAQENEAKL 170
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  551 QTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKShqEELDRLRQLLKkarv 630
Cdd:pfam15742  171 KQQYQEEQQKRKLLDQNVNELQQQVRILQDKEAQLERTNSQQQLRIQQQEAQLKQLENEKRKS--DEHLKSNQELS---- 244
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  631 stdqaaaEQLTLAQAELQSQWEaKCEQLLASArDEHLQQYREVCAQRDAHQQKL-ALLQDECLALQAQIAAFTEQKEHMQ 709
Cdd:pfam15742  245 -------EKLSSLQQEKEALQE-ELQQFLKQL-DVHVRKYNEKHHHHKAKLRRAkDRLLHEVEQRDERIKQLENEIRILQ 315

                   ....*...
gi 1907156435  710 RLEKTKSQ 717
Cdd:pfam15742  316 SQIEKEKA 323
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
480-875 6.44e-10

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 63.39  E-value: 6.44e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  480 AEQEKaKVTEELAAATAQVSHLQLK-MTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-----EASEQTQTK 553
Cdd:NF033930    85 AKKEK-KASEEEQKANLAVQKAYVKyRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRakvvpEAEELAETK 163
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  554 FKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSaqERCQAEAEMDEIrkshQEELDRLRQLLKKARVSTD 633
Cdd:NF033930   164 KKAEEAKAEEPVAKKKVDEAKKKVEEAKKKVEAEEAEIEKLQN--EEVALEAKIAEL----ENQVDNLEKELAEIDESDS 237
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  634 QAAAEQ---------LTLAQAELqSQWEAKCEQLLASARDEHLQQyrevcaQRDAHQQKLALLQDECLALQAQIAAFTEQ 704
Cdd:NF033930   238 EDYIKEglrapleseLDAKQAKL-AKKQTELEKLLDSLDPEGKTQ------DELDKEAAEEELSKKIDELDNEVAKLEKE 310
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  705 KEHMQRLEKtkSQAPAGRAAADPSEKVKKImnqvfqslrgefELEEsydggtilrtimhTIKMVTlQLLNHQEEEEEEEE 784
Cdd:NF033930   311 VSDLENSDN--NVADYYKEALEKDLATKKA------------ELEK-------------TQKDLD-KALNELGPDGDEEE 362
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  785 EEEEEKKPLRPSlEQPGPA----TPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPEngaqtrkgEPAEAEVPS 860
Cdd:NF033930   363 TPAPAPQPEQPA-PAPAPApkpeQPAPAPKPEKPADQQAEEDYARRSEEEYNRLTQQQPPKAE--------KPAPAPAPK 433
                          410
                   ....*....|....*
gi 1907156435  861 eikdsslPPQPAGIP 875
Cdd:NF033930   434 -------PEQPAPAP 441
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
363-587 7.37e-10

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 63.54  E-value: 7.37e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  363 TEIRMAVNKVADKMDHLMTKVEELQKhssgnsmllpsmsvtmETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKIS 442
Cdd:TIGR02168  270 EELRLEVSELEEEIEELQKELYALAN----------------EISRLEQQKQILRERLANLERQLEELEAQLEELESKLD 333
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  443 DLIERNQRYVEQSNL--------------------MMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQ 502
Cdd:TIGR02168  334 ELAEELAELEEKLEElkeelesleaeleeleaeleELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEARLERLE 413
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  503 lkmtAHQKKETELQLQLTDNLKETDL--LRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRA 580
Cdd:TIGR02168  414 ----DRRERLQQEIEELLKKLEEAELkeLQAELEELEEELEELQEELERLEEALEELREELEEAEQALDAAERELAQLQA 489

                   ....*..
gi 1907156435  581 EKTSLEK 587
Cdd:TIGR02168  490 RLDSLER 496
PTZ00121 PTZ00121
MAEBL; Provisional
419-732 4.98e-09

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 60.93  E-value: 4.98e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  419 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKvTEELAAATAQV 498
Cdd:PTZ00121  1312 EEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKK-ADAAKKKAEEK 1390
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  499 shlqlKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEqtqTKFKSEkQSRRQLELKVTSlEEELTDL 578
Cdd:PTZ00121  1391 -----KKADEAKKKAEEDKKKADELKKAAAAKKKADEAKKKAEEKKKADE---AKKKAE-EAKKADEAKKKA-EEAKKAE 1460
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  579 RAEKTSLEKNLSERKKKSAQERCQAE--AEMDEIRKSHQEELDRLRQLLKKA---RVSTDQAAAEQLTLAQAELQSQWEA 653
Cdd:PTZ00121  1461 EAKKKAEEAKKADEAKKKAEEAKKADeaKKKAEEAKKKADEAKKAAEAKKKAdeaKKAEEAKKADEAKKAEEAKKADEAK 1540
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  654 KCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK--EHMQRLEKTKSQAPAGRAAADPSEKV 731
Cdd:PTZ00121  1541 KAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEAriEEVMKLYEEEKKMKAEEAKKAEEAKI 1620

                   .
gi 1907156435  732 K 732
Cdd:PTZ00121  1621 K 1621
DUF5401 pfam17380
Family of unknown function (DUF5401); This is a family of unknown function found in ...
414-677 7.33e-09

Family of unknown function (DUF5401); This is a family of unknown function found in Chromadorea.


Pssm-ID: 375164 [Multi-domain]  Cd Length: 722  Bit Score: 59.75  E-value: 7.33e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  414 QRIIQENERLKQELlEKSSRIEEQNDKISDLIERNQR-YVEQSNLMMEkRNNSLQTATENTQARilhaEQEKAKvTEELA 492
Cdd:pfam17380  299 ERLRQEKEEKAREV-ERRRKLEEAEKARQAEMDRQAAiYAEQERMAME-RERELERIRQEERKR----ELERIR-QEEIA 371
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  493 AATAQVSHLQ-LKMTAHQKK----------------ETELQLQLTDNLKETDLLRGHVTRL-QADLSELREASEQTQTKF 554
Cdd:pfam17380  372 MEISRMRELErLQMERQQKNervrqeleaarkvkilEEERQRKIQQQKVEMEQIRAEQEEArQREVRRLEEERAREMERV 451
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  555 KSEKQSRRQlelKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLKKARVSTDQ 634
Cdd:pfam17380  452 RLEEQERQQ---QVERLRQQEEERKRKKLELEKEKRDRKRAEEQRRKILEKELEERKQAMIEE-ERKRKLLEKEMEERQK 527
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|...
gi 1907156435  635 AAAEQLTLAQAELQSQWEAKCEQllasaRDEHLQQYREVCAQR 677
Cdd:pfam17380  528 AIYEEERRREAEEERRKQQEMEE-----RRRIQEQMRKATEER 565
Cast pfam10174
RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part ...
400-738 9.51e-09

RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion. The C-terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). The family also contains four coiled-coil domains.


Pssm-ID: 401982 [Multi-domain]  Cd Length: 765  Bit Score: 59.45  E-value: 9.51e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  400 MSVTMETSMIMSN-IQRIIQENERLKQELLEKSSRIEEQNDKISDlierNQRYVE---QSNLMMEKRNNSLQTATENTQA 475
Cdd:pfam10174  276 MEVYKSHSKFMKNkIDQLKQELSKKESELLALQTKLETLTNQNSD----CKQHIEvlkESLTAKEQRAAILQTEVDALRL 351
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  476 RILHAEQ---EKAK----VTEELAAATAQVSHLQ-------LKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADls 541
Cdd:pfam10174  352 RLEEKESflnKKTKqlqdLTEEKSTLAGEIRDLKdmldvkeRKINVLQKKIENLQEQLRDKDKQLAGLKERVKSLQTD-- 429
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  542 elreaSEQTQTkfksekqsrrqlelKVTSLEEELtdlrAEKTSLEKNLSERKKKSAQERcqaeaemdeirkshQEELDRL 621
Cdd:pfam10174  430 -----SSNTDT--------------ALTTLEEAL----SEKERIIERLKEQREREDRER--------------LEELESL 472
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  622 RQLLKKARvstdqaaaEQLTLAQAELQSQweakcEQLLASARdEHLQQYREVCAQRDAH--QQKLALLQ--DECLALQAQ 697
Cdd:pfam10174  473 KKENKDLK--------EKVSALQPELTEK-----ESSLIDLK-EHASSLASSGLKKDSKlkSLEIAIEQkkEECSKLENQ 538
                          330       340       350       360
                   ....*....|....*....|....*....|....*....|.
gi 1907156435  698 iaafteqkehmqrLEKTKSQAPAGRAAADPSEKVKKIMNQV 738
Cdd:pfam10174  539 -------------LKKAHNAEEAVRTNPEINDRIRLLEQEV 566
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
411-656 9.66e-09

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 59.69  E-value: 9.66e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  411 SNIQRIIQENErlkQELLEKSSRIEEQNDKISDLIERnqryVEqsnlMMEKRNNSLqtatENTQARILHAEQEKAKVTEE 490
Cdd:PRK03918   189 ENIEELIKEKE---KELEEVLREINEISSELPELREE----LE----KLEKEVKEL----EELKEEIEELEKELESLEGS 253
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  491 LAAATAQVSHLQlKMTAHQKKETElqlQLTDNLKETDLLRGHVTRLQAdLSELREaseqtqtKFKSEKqsrRQLELKVTS 570
Cdd:PRK03918   254 KRKLEEKIRELE-ERIEELKKEIE---ELEEKVKELKELKEKAEEYIK-LSEFYE-------EYLDEL---REIEKRLSR 318
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  571 LEEELTDLRAEKTSLEKnLSERKKKSAQERCQAEAEMDEIRKSHqEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQ 650
Cdd:PRK03918   319 LEEEINGIEERIKELEE-KEERLEELKKKLKELEKRLEELEERH-ELYEEAKAKKEELERLKKRLTGLTPEKLEKELEEL 396

                   ....*.
gi 1907156435  651 WEAKCE 656
Cdd:PRK03918   397 EKAKEE 402
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
411-746 1.18e-08

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 59.31  E-value: 1.18e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  411 SNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTA---TENTQARILHAEQEKAKV 487
Cdd:PRK03918   324 NGIEERIKELEEKEERLEELKKKLKELEKRLEELEERHELYEEAKAKKEELERLKKRLTgltPEKLEKELEELEKAKEEI 403
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  488 TEELAAATAQVSHL------------QLK------------MTAHQKKE-------------------TELQLQLTDNLK 524
Cdd:PRK03918   404 EEEISKITARIGELkkeikelkkaieELKkakgkcpvcgreLTEEHRKElleeytaelkriekelkeiEEKERKLRKELR 483
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  525 ETDLLRGHVTRLQA------------------DLSELREASEQTQT-------------KFKSEKQSRRQLELKVTSLEE 573
Cdd:PRK03918   484 ELEKVLKKESELIKlkelaeqlkeleeklkkyNLEELEKKAEEYEKlkekliklkgeikSLKKELEKLEELKKKLAELEK 563
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  574 ELTDLRAEKTSLEKNLSERKKKSAQErcqAEAEMDEIRKSHQE---------ELDRLRQLLKKARVSTDQAAAEqLTLAQ 644
Cdd:PRK03918   564 KLDELEEELAELLKELEELGFESVEE---LEERLKELEPFYNEylelkdaekELEREEKELKKLEEELDKAFEE-LAETE 639
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  645 AELQSQwEAKCEQLLASARDEhlqQYREVcaqrdahQQKLALLQDECLALQAQIAAFTEQKEHMQR-LEKTKSQAPAGRA 723
Cdd:PRK03918   640 KRLEEL-RKELEELEKKYSEE---EYEEL-------REEYLELSRELAGLRAELEELEKRREEIKKtLEKLKEELEEREK 708
                          410       420
                   ....*....|....*....|...
gi 1907156435  724 AADPSEKVKKIMNQVfQSLRGEF 746
Cdd:PRK03918   709 AKKELEKLEKALERV-EELREKV 730
MukB COG3096
Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 ...
384-686 3.49e-08

Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 substr. MG1655 [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 225638 [Multi-domain]  Cd Length: 1480  Bit Score: 57.97  E-value: 3.49e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  384 EELQKHSSGNSMLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIER---NQRYVEQSNLMME 460
Cdd:COG3096    314 RELAELNGAEGDLEADYQAASDHLNLVQTALRQQEKIERYQADLEELTIRLEEQNEVVEEANERqeeNEARAEAAELEVD 393
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  461 KRNNSL---QTATENTQARILHAEQ-----EKAKV---TEELAAATAQVSHLQLKmtAHQKKETELQLQLTDNLKETDL- 528
Cdd:COG3096    394 ELKSQLadyQQALDVQQTRAIQYQQaiaalERAKElchLPDLTADSAEEWLETFQ--AKEEEATEKLLSLEQKMSMAQAa 471
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  529 -------------LRGHVTRLQADLSE---LREASEQtqtkfKSEKQSRRQLELKVTSLEEELTDLRaEKTSLEKNLSER 592
Cdd:COG3096    472 hsqfeqayqlvvaIAGELARSEAWDVArelLREGPDQ-----RHLAEQVQPLRMRLSELEQRLRQQQ-SAERLLADFCKR 545
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  593 KKKSAQ------ERCQAEAEMDEIRKSHQEELDR---LRQLLK--KARVSTDQAAAEQLTLAQAELqSQWEAKCEQLLAS 661
Cdd:COG3096    546 QGKNLDaeeleaLHQELEALIESLSDSVSNAREQrmaLRQEQEqlQSRIQSLMQRAPVWLAAQNAL-EQLSEQSGEEFTD 624
                          330       340       350
                   ....*....|....*....|....*....|..
gi 1907156435  662 ARD--EHLQQY----REVCAQRDA-HQQKLAL 686
Cdd:COG3096    625 SQDvtEYMQQLlereREATVERDElGARKNAL 656
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
366-717 3.66e-08

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 57.67  E-value: 3.66e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  366 RMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMETSM--IMSNIQRIIQENERLKQELLEKSSRIEEQNDKisd 443
Cdd:TIGR00618  179 TQLALMEFAKKKSLHGKAELLTLRSQLLTLCTPCMPDTYHERKqvLEKELKHLREALQQTQQSHAYLTQKREAQEEQ--- 255
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  444 liERNQRYVEQSNLMMEKRNNsLQTATENTQARIlhaeqEKAKVTEELAAATAQVSHLQLKMtahQKKETELQLQLTDNL 523
Cdd:TIGR00618  256 --LKKQQLLKQLRARIEELRA-QEAVLEETQERI-----NRARKAAPLAAHIKAVTQIEQQA---QRIHTELQSKMRSRA 324
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  524 KEtdllRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQlelkvtslEEELTDLRAEKtSLEKNLSERKKKSAQERCQA 603
Cdd:TIGR00618  325 KL----LMKRAAHVKQQSSIEEQRRLLQTLHSQEIHIRDA--------HEVATSIREIS-CQQHTLTQHIHTLQQQKTTL 391
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  604 EaemdEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRevcaQRDAHQQK 683
Cdd:TIGR00618  392 T----QKLQSLCKELDILQREQATIDTRTSAFRDLQGQLAHAKKQQELQQRYAELCAAAITCTAQCEK----LEKIHLQE 463
                          330       340       350
                   ....*....|....*....|....*....|....*....
gi 1907156435  684 LALLQDECLALQAQIAAFTEQ-----KEHMQRLEKTKSQ 717
Cdd:TIGR00618  464 SAQSLKEREQQLQTKEQIHLQetrkkAVVLARLLELQEE 502
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
409-616 5.10e-08

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 56.95  E-value: 5.10e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  409 IMSNIQRIIQENERLKQELLEkssrIEEQNDKISD-LIERNQRYVEQSNLMMEKRNNSLQTATENT------QARILHAE 481
Cdd:TIGR04523  202 LLSNLKKKIQKNKSLESQISE----LKKQNNQLKDnIEKKQQEINEKTTEISNTQTQLNQLKDEQNkikkqlSEKQKELE 277
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  482 QEKAKVTE-------------ELAAATAQVSHLQLK--MTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREA 546
Cdd:TIGR04523  278 QNNKKIKElekqlnqlkseisDLNNQKEQDWNKELKseLKNQEKKLEEIQNQISQNNKIISQLNEQISQLKKELTNSESE 357
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1907156435  547 SEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQ---AEAEMDEIRKSHQE 616
Cdd:TIGR04523  358 NSEKQRELEEKQNEIEKLKKENQSYKQEIKNLESQINDLESKIQNQEKLNQQKDEQikkLQQEKELLEKEIER 430
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
471-751 5.89e-08

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 56.57  E-value: 5.89e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  471 ENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLtdnlketDLLRGHVTRLQADLSELREASEQT 550
Cdd:COG4372     77 DDIRPQLRALRTELGTAQGEKRAAETEREAARSELQKARQEREAVRQEL-------AAARQNLAKAQQELARLTKQAQDL 149
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  551 QTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKsaQERCQAEAEMDEIRKSHQEELDRLRQLLKKARV 630
Cdd:COG4372    150 QTRLKTLAEQRRQLEAQAQSLQASQKQLQASATQLKSQVLDLKLR--SAQIEQEAQNLATRANAAQARTEELARRAAAAQ 227
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  631 STDQAAAEQLTLAQAELQSqweakceqllASARDEHLQQyREVCAQRdaHQQKLALLQDECLALQAQIAAFTEQKEHMQR 710
Cdd:COG4372    228 QTAQAIQQRDAQISQKAQQ----------IAARAEQIRE-RERQLQR--LETAQARLEQEVAQLEAYYQAYVRLRQQAAA 294
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|...
gi 1907156435  711 LEKTKSQAPAGRAAADpSEKVKKIMNQVFQSLR--GEFELEES 751
Cdd:COG4372    295 TQRGQVLAGAAQRVAQ-AQAQAQAQAQLLSSANrpAALRLRRS 336
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
412-628 6.35e-08

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 57.08  E-value: 6.35e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  412 NIQRIIQENERLKQELLE-KSSRIEEQNDKISDLIERNQRYVEQSNLMmEKRNNSLQTATEntqaRILHAEQEKAKVTEE 490
Cdd:COG0419    534 KLEKLENLLEELEELKEKlQLQQLKEELRQLEDRLQELKELLEELRLL-RTRKEELEELRE----RLKELKKKLKELEER 608
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  491 LAAATAQVSHLQLkMTAHQKKETELQlQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQsRRQLELKVTS 570
Cdd:COG0419    609 LSQLEELLQSLEL-SEAENELEEAEE-ELESELEKLNLQAELEELLQAALEELEEKVEELEAEIRRELQ-RIENEEQLEE 685
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 1907156435  571 LEEELTDLRAEKTSLEKNLSERKKKsaQERCQAEAEMDEIRKshqEELDRLRQLLKKA 628
Cdd:COG0419    686 KLEELEQLEEELEQLREELEELLKK--LGEIEQLIEELESRK---AELEELKKELEKL 738
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
415-753 6.96e-08

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 56.72  E-value: 6.96e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  415 RIIQENERLKQELLEKSSRIEEQNDK--------------ISDLIERNQRYvEQSNLMMEK-------RNNSLQTATENT 473
Cdd:pfam01576  149 KLSKERKLLEERISEFTSNLAEEEEKvkslnklknkheamISDLEDRLKKE-EKGRQELEKakrkldgESTDLQEQIAEL 227
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  474 QARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTD---NLKETDLLRGHVTRLQADLSE----LREA 546
Cdd:pfam01576  228 QAQIEELRAQLAKKEEELQAALARLEEEGAQKNNALKKLRELQAQIAElqeDLESERAARAKAEKQRRDLGEeleaLKTE 307
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  547 SEQTQ--TKFKSEKQSRRQLELK---------------------------VTSLEEELTDLRAEKTSLEKN--------- 588
Cdd:pfam01576  308 LEDTLdsTAAQQELRSKREQEVTelkkaleeetrsheaqlqemrqkhtqaLEELSEQLEQAKRNKANLEKAkqalesenn 387
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  589 --------LSERKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLkkarvstdqaaAEQLTLAQAELQS------QWEAK 654
Cdd:pfam01576  388 elqaelktLQQAKQDSEHKRKKLEGQLQELQARLSES-ERQRAEL-----------AEKLSKLQSELESvsgllsEAEGK 455
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  655 CEQLL--ASARDEHLQQYREVCAQRDahQQKLAL------LQDECLALQAQIAAFTEQKEHMQR--------LEKTKSQA 718
Cdd:pfam01576  456 SIKLSkdVSSLESQLQDTQELLQEET--RQKLNLssrlrqLEDERNSLQEQLEEEEEAKRNVERqlstlqaqLSEMKKKL 533
                          410       420       430
                   ....*....|....*....|....*....|....*.
gi 1907156435  719 PAGRAAADPSEKVKKIMNQVFQSLRGEF-ELEESYD 753
Cdd:pfam01576  534 EEDAGAVEALEEAKKRLQRELEALTQRLeEKAAAYD 569
PTZ00121 PTZ00121
MAEBL; Provisional
421-646 6.99e-08

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 57.07  E-value: 6.99e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  421 ERLKQELLEKSSRIEEQNDKisdliernqRYVEQSNLMMEKRNNSLQTATENTQArilhaeqEKAKVTEELaaataQVSH 500
Cdd:PTZ00121  1544 EKKKADELKKAEELKKAEEK---------KKAEEAKKAEEDKNMALRKAEEAKKA-------EEARIEEVM-----KLYE 1602
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  501 LQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSE-------LREASEQT-----QTKFKSEKQSRRQLELKV 568
Cdd:PTZ00121  1603 EEKKMKAEEAKKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEekkkaeeLKKAEEENkikaaEEAKKAEEDKKKAEEAKK 1682
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156435  569 TSLEEELTDLRAEKTSLEKNLSER-KKKSAQERCQAEaemdEIRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAE 646
Cdd:PTZ00121  1683 AEEDEKKAAEALKKEAEEAKKAEElKKKEAEEKKKAE----ELKKAEEENKIKAEEAKKEAE--EDKKKAEEAKKDEEE 1755
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
414-710 1.38e-07

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 55.92  E-value: 1.38e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  414 QRIIQENERLKQELLEKSSRIEEQNDKISDL---------IERNQRYVEQSNLMMEKRNNSLQTAT-ENTQARILHAEQE 483
Cdd:pfam12128  425 HQLEQQKLEFNEEQYLLESRLGELKLQLNQAtatpellenIEQNDERLERAQEAQEQANASVEAAQsELRQLRKRRDEAD 504
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  484 KA-----KVTEELAAATAQVsHLQLKMTAHQK-----------KETELQLQLTDNLKETDL----------------LRG 531
Cdd:pfam12128  505 EAlrranRRLEQLKQALQQL-ELQLSPQAGSLlhflrneapdwEQSIGKLISTELLHRTDLdpelvesssqelnlygVTL 583
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  532 HVTRLQADLS-----ELREASEQTQTKFKSEKQsrrqlelKVTSLEEELTDLRAEKTSLEKNLSERKkksaQERCQAEAE 606
Cdd:pfam12128  584 DLQRIDAPDYaaleeALRERLDQAEKALQAARD-------KQKAAEEQLVQLNKELEKLKREETEAA----RALKQARLT 652
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  607 MDEIRKSHQEELDRLRQLLKKARvstdQAAAEQLTLAQAEL------QSQWEAKCEQLLASARDEHLQQYREVCAQRDAh 680
Cdd:pfam12128  653 LGRLQDEKQSLKDKLQKALKARK----QQAETQLQTLDAQLkqllkkQQAALEEQKEQLRELRTEKQEKWQVVVGDLDA- 727
                          330       340       350
                   ....*....|....*....|....*....|.
gi 1907156435  681 qqKLALLQDECLALQAQIAAFTEQ-KEHMQR 710
Cdd:pfam12128  728 --QLALLSAAIAALRTQAKAQLKAlEEQYKR 756
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
364-629 1.42e-07

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 55.84  E-value: 1.42e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  364 EIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLlpsmsvTMETSMIMSNIQRI---IQENERLKQELLEKSSRIEEQNDK 440
Cdd:PRK03918   211 EISSELPELREELEKLEKEVKELEELKEEIEEL------EKELESLEGSKRKLeekIRELEERIEELKKEIEELEEKVKE 284
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  441 ISDLIERNQRYVEQSNLM---------MEKRNNSLQTATENTQARILHAEQEKAKVtEELaaataqvshlqlkmtahQKK 511
Cdd:PRK03918   285 LKELKEKAEEYIKLSEFYeeyldelreIEKRLSRLEEEINGIEERIKELEEKEERL-EEL-----------------KKK 346
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  512 ETELQLQLTDnLKETDLLRGHVTRLQADLSELR-EASEQTQTKFKSEKQSrrqLELKVTSLEEELTDLRAEKTSLEKNLS 590
Cdd:PRK03918   347 LKELEKRLEE-LEERHELYEEAKAKKEELERLKkRLTGLTPEKLEKELEE---LEKAKEEIEEEISKITARIGELKKEIK 422
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1907156435  591 ERKK-----KSAQERC-----------------QAEAEMDEIRKSHQEELDRLRQLLKKAR 629
Cdd:PRK03918   423 ELKKaieelKKAKGKCpvcgrelteehrkelleEYTAELKRIEKELKEIEEKERKLRKELR 483
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
481-717 2.13e-07

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 55.46  E-value: 2.13e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  481 EQEKAKVTEELAAATAQVSHLQLKmtahqkkETELQLQLtDNLKETdllRGHVTRLQADLSELR--EASEQTQTKFKSEK 558
Cdd:TIGR02169  169 DRKKEKALEELEEVEENIERLDLI-------IDEKRQQL-ERLRRE---REKAERYQALLKEKReyEGYELLKEKEALER 237
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  559 QsRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRL----RQLLKKARVSTDQ 634
Cdd:TIGR02169  238 Q-KEAIERQLASLEEELEKLTEEISELEKRLEEIEQLLEELNKKIKDLGEEEQLRVKEKIGELeaeiASLERSIAEKERE 316
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  635 A--AAEQLTLAQAELQSQwEAKCEQLlasarDEHLQQYRevcAQRDAHQQKLALLQDECLALQAQI--------AAFTEQ 704
Cdd:TIGR02169  317 LedAEERLAKLEAEIDKL-LAEIEEL-----EREIEEER---KRRDKLTEEYAELKEELEDLRAELeevdkefaETRDEL 387
                          250
                   ....*....|...
gi 1907156435  705 KEHMQRLEKTKSQ 717
Cdd:TIGR02169  388 KDYREKLEKLKRE 400
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
407-665 2.98e-07

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 54.64  E-value: 2.98e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  407 SMIMSNIQRIIQENER---LKQEL-------LEKSSRIEEQNDKISDLIERNQRYVEQS-NLMMEKR--NNSLQTATENT 473
Cdd:TIGR04523  328 NQISQNNKIISQLNEQisqLKKELtnsesenSEKQRELEEKQNEIEKLKKENQSYKQEIkNLESQINdlESKIQNQEKLN 407
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  474 Q---ARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQT 550
Cdd:TIGR04523  408 QqkdEQIKKLQQEKELLEKEIERLKETIIKNNSEIKDLTNQDSVKELIIKNLDNTRESLETQLKVLSRSINKIKQNLEQK 487
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  551 QTKFKSE-------KQSRRQLELKV-------TSLEEELTDLRAEKTSLEKNLSERKKK-----SAQERCQAEAEMDEIr 611
Cdd:TIGR04523  488 QKELKSKekelkklNEEKKELEEKVkdltkkiSSLKEKIEKLESEKKEKESKISDLEDElnkddFELKKENLEKEIDEK- 566
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 1907156435  612 kshQEELDRLRQLLKKARVSTDQAA--AEQLTLAQAELQSQWEAKcEQLLASARDE 665
Cdd:TIGR04523  567 ---NKEIEELKQTQKSLKKKQEEKQelIDQKEKEKKDLIKEIEEK-EKKISSLEKE 618
MscS_porin pfam12795
Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part ...
483-700 2.99e-07

Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part of the turgor-driven solute efflux system that protects bacteria from lysis in the event of osmotic shock. The MscS protein alone is sufficient to form a functional mechanosensitive channel gated directly by tension in the lipid bilayer. The MscS proteins are heptamers of three transmembrane subunits with seven converging M3 domains, and this MscS_porin is towards the N-terminal of the molecules. The high concentration of negative charges at the extracellular entrance of the pore helps select the cations for efflux.


Pssm-ID: 403869 [Multi-domain]  Cd Length: 235  Bit Score: 52.67  E-value: 2.99e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  483 EKAKVTEELAAATAQV--SHLQL--KMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSElreaseqtQTKFKSEK 558
Cdd:pfam12795    6 EKRKLDEAAQKALLQDlqQALNLldKIDKSKQRAAQYQKALDDAPAELRELRQELAALQAKAEA--------APKEILAS 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  559 QSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQercqAEAEMDEIRkshqEELDRLRQLLKKARVSTDQAAAE 638
Cdd:pfam12795   78 LSLEELEQRLLQTSSQLQELQEQLAQLNSQLIELQTRPER----AQQQLSEAR----QRLQQIRNQLNGLAAAGEPLSEA 149
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907156435  639 QLTLAQAELQSQW----EAKCEQLLASARDEHLQqyrevcAQRDAHQQKLALLQDECLALQAQIAA 700
Cdd:pfam12795  150 QRWLLQAELAALKaqidMLEQELLSNNNRQDLLQ------AQRDLLTLRIARLEQQLQALQELLNE 209
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
422-718 3.70e-07

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 54.28  E-value: 3.70e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  422 RLKQELLEKSSRIEEQNDKIsdliERNQRYVEQSNLMM----EKRN--NSLQTATENTQARILHAEQEKAKVTEELAAAT 495
Cdd:PRK02224   210 GLESELAELDEEIERYEEQR----EQARETRDEADEVLeeheERREelETLEAEIEDLRETIAETEREREELAEEVRDLR 285
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  496 AQVSHLQ---------------------LKMTAHQKKETELQ-------LQLTDNLKETDLLRGHVTRLQADLSELREAS 547
Cdd:PRK02224   286 ERLEELEeerddllaeaglddadaeaveARREELEDRDEELRdrleecrVAAQAHNEEAESLREDADDLEERAEELREEA 365
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  548 EQTQTKFKSEKQSRRQLELKVTSLEEELTDLRaektsleknlsERKKKSAQERCQAEAEMDEIRkshqEELDRLRQLLKK 627
Cdd:PRK02224   366 AELESELEEAREAVEDRREEIEELEEEIEELR-----------ERFGDAPVDLGNAEDFLEELR----EERDELREREAE 430
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  628 ARVSTdQAAAEQLTLAQAELQSQWEAKCEQLLA-SARDEHLQQYREvcaQRDAHQQKLALLQDECLALQAQIAAFTEQKE 706
Cdd:PRK02224   431 LEATL-RTARERVEEAEALLEAGKCPECGQPVEgSPHVETIEEDRE---RVEELEAELEDLEEEVEEVEERLERAEDLVE 506
                          330
                   ....*....|..
gi 1907156435  707 HMQRLEKTKSQA 718
Cdd:PRK02224   507 AEDRIERLEERR 518
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
405-651 5.30e-07

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 53.19  E-value: 5.30e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  405 ETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDL-----------IERNQRYVEQSN-LMMEKRNNSLQT---- 468
Cdd:COG4942     60 QRAKLEKQLKSLETEIASLEAQLIETADDLKKLRKQIADLnarlnalevqeREQRRRLAEQLAaLQRSGRNPPPALlvsp 139
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  469 --ATENTQARILHAE--QEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNlketdllrghvtrlQADLSELR 544
Cdd:COG4942    140 edAQRSVRLAIYYGAlnPARAERIDALKATLKQLAAVRAEIAAEQAELTTLLSEQRAQ--------------QAKLAQLL 205
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  545 EASEQTQTKFKSEKQSRRQlelkvtSLEEeltdLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQl 624
Cdd:COG4942    206 EERKKTLAQLNSELSADQK------KLEE----LRANESRLKNEIASAEAAAAKAREAAAAAEAAAARARAAEAKRTGE- 274
                          250       260
                   ....*....|....*....|....*..
gi 1907156435  625 LKKARVSTDQAAAEQLTLAQAELQSQW 651
Cdd:COG4942    275 TYKPTAPEKMLISSTGGFGALRGQLAW 301
PRK11281 PRK11281
mechanosensitive channel MscK;
480-727 6.66e-07

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 53.76  E-value: 6.66e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  480 AEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETE-LQLQLTDNLKETdllrghvTRLQADLSELReASEQTQTKFKSEK 558
Cdd:PRK11281    49 NKQKLLEAEDKLVQQDLEQTLALLDKIDRQKEETEqLKQQLAQAPAKL-------RQAQAELEALK-DDNDEETRETLST 120
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  559 QSRRQLELKVTSLEEELTDLRAEKTSLEKNLSerKKKSAQERCQAEaeMDEirksHQEELDRLRQLLKKARVSTDQAAAE 638
Cdd:PRK11281   121 LSLRQLESRLAQTLDQLQNAQNDLAEYNSQLV--SLQTQPERAQAA--LYA----NSQRLQQIRNLLKGGKVGGKALRPS 192
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  639 QLTLAQAELQSqWEAKCE---QLLASArdEHLQQYREvcAQRDAHQQKLALLQDECLALQAQIAA--FTEQKEHMQRLEk 713
Cdd:PRK11281   193 QRVLLQAEQAL-LNAQNDlqrKSLEGN--TQLQDLLQ--KQRDYLTARIQRLEHQLQLLQEAINSkrLTLSEKTVQEAQ- 266
                          250
                   ....*....|....
gi 1907156435  714 tkSQAPAGRAAADP 727
Cdd:PRK11281   267 --SQDEAARIQANP 278
SlpA COG1047
FKBP-type peptidyl-prolyl cis-trans isomerase 2 [Posttranslational modification, protein ...
40-101 9.33e-07

FKBP-type peptidyl-prolyl cis-trans isomerase 2 [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223976  Cd Length: 174  Bit Score: 49.95  E-value: 9.33e-07
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1907156435   40 AVETGDSLEVAYTGWLLQnhvlGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKR 101
Cdd:COG1047      2 KIEKGDVVSLHYTLKVED----GEVVDTTDENYGPLTFIVGAGQLIPGLEEALLGKEVGEEF 59
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
376-718 1.50e-06

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 52.43  E-value: 1.50e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  376 MDHLMTKVEELQKHSSGNSMLLPSMSVTMETSM--IMSNIQRiiqenerlKQELLEKSSRIEEQNDKISDLIERNQRYVE 453
Cdd:pfam15921  414 IDHLRRELDDRNMEVQRLEALLKAMKSECQGQMerQMAAIQG--------KNESLEKVSSLTAQLESTKEMLRKVVEELT 485
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  454 QSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTE---ELAAATAQVSHLQLKMTAHQKKETE---LQLQLTDNLKETD 527
Cdd:pfam15921  486 AKKMTLESSERTVSDLTASLQEKERAIEATNAEITKlrsRVDLKLQELQHLKNEGDHLRNVQTEceaLKLQMAEKDKVIE 565
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  528 LLRGHVTRLQADLSEL-REASEQTQTKFKSEKQ-SRRQLEL------------KVTSLEEELTDLRAEKTSLEKNLSER- 592
Cdd:pfam15921  566 ILRQQIENMTQLVGQHgRTAGAMQVEKAQLEKEiNDRRLELqefkilkdkkdaKIRELEARVSDLELEKVKLVNAGSERl 645
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  593 --KKKSAQERCQAeaeMDEIRKSHQE--ELDRLRQLLKKarvsTDQAAAEQLTLAQAELQSQweakceqlLASARDEhLQ 668
Cdd:pfam15921  646 raVKDIKQERDQL---LNEVKTSRNElnSLSEDYEVLKR----NFRNKSEEMETTTNKLKMQ--------LKSAQSE-LE 709
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....
gi 1907156435  669 QYREVCAQ---RDAHQQKLAL-LQDECLALQAQIAAFTEQkehMQRLEKTKSQA 718
Cdd:pfam15921  710 QTRNTLKSmegSDGHAMKVAMgMQKQITAKRGQIDALQSK---IQFLEEAMTNA 760
PTZ00121 PTZ00121
MAEBL; Provisional
418-733 1.91e-06

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 52.45  E-value: 1.91e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  418 QENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRN--NSLQTATENTQARILHAEQEKAKVTEELA--A 493
Cdd:PTZ00121  1413 AAAAKKKADEAKKKAEEKKKADEAKKKAEEAKKADEAKKKAEEAKKaeEAKKKAEEAKKADEAKKKAEEAKKADEAKkkA 1492
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  494 ATAQVSHLQLKMTAHQKKETElQLQLTDNLKETDLLRGHVTRLQAD----------------LSELREASEQTQTKFKSE 557
Cdd:PTZ00121  1493 EEAKKKADEAKKAAEAKKKAD-EAKKAEEAKKADEAKKAEEAKKADeakkaeekkkadelkkAEELKKAEEKKKAEEAKK 1571
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  558 KQSRRQLELK---------------VTSLEEELTDLRAEKT-----------SLEKNLSERKKKSAQERCQAEA--EMDE 609
Cdd:PTZ00121  1572 AEEDKNMALRkaeeakkaeearieeVMKLYEEEKKMKAEEAkkaeeakikaeELKKAEEEKKKVEQLKKKEAEEkkKAEE 1651
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  610 IRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYREVcAQRDAHQQKLAllqD 689
Cdd:PTZ00121  1652 LKKAEEENKIKAAEEAKKAE--EDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKAEELKKKEAE-EKKKAEELKKA---E 1725
                          330       340       350       360
                   ....*....|....*....|....*....|....*....|....
gi 1907156435  690 ECLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADPSEKVKK 733
Cdd:PTZ00121  1726 EENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKK 1769
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
509-799 1.94e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 51.99  E-value: 1.94e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  509 QKKETELQLQLTDNLKETDLLRGHVTRLQadlSELREASEQTqtkfkSEKQSRRQ-LELKVTSLEEELTDL--------- 578
Cdd:TIGR02169  680 RERLEGLKRELSSLQSELRRIENRLDELS---QELSDASRKI-----GEIEKEIEqLEQEEEKLKERLEELeedlssleq 751
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  579 -----RAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEqltlAQAELQSqwEA 653
Cdd:TIGR02169  752 eienvKSELKELEARIEELEEDLHKLEEALNDLEARLSHSRIPEIQAELSKLEEEVSRIEARLRE----IEQKLNR--LT 825
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  654 KCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAaftEQKEHMQRLEKTKSqapagraaaDPSEKVKK 733
Cdd:TIGR02169  826 LEKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELE---ELEAALRDLESRLG---------DLKKERDE 893
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907156435  734 IMNQVFQSLRGEFELEESYDggtILRTIMHTIKmVTLQLLNHQEEEEEEEEEEEEEKKPLRPSLEQ 799
Cdd:TIGR02169  894 LEAQLRELERKIEELEAQIE---KKRKRLSELK-AKLEALEEELSEIEDPKGEDEEIPEEELSLED 955
COG1579 COG1579
Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function ...
481-627 2.47e-06

Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function prediction only];


Pssm-ID: 224495 [Multi-domain]  Cd Length: 239  Bit Score: 50.06  E-value: 2.47e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  481 EQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTK--FKSEK 558
Cdd:COG1579     23 EPRIKEIRKALKKAKAELEALNKALEALEIELEDLENQVSQLESEIQEIRERIKRAEEKLSAVKDERELRALNieIQIAK 102
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156435  559 QSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKK 627
Cdd:COG1579    103 ERINSLEDELAELMEEIEKLEKEIEDLKERLERLEKNLAEAEARLEEEVAEIREEGQELSSKREELKEK 171
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
355-640 3.44e-06

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 51.25  E-value: 3.44e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  355 MTEARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLpsMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRI 434
Cdd:COG1196    760 LEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEEL--EEAERRLDALERELESLEQRRERLEQEIEELEEEI 837
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  435 EEQNDKISDLiernqryveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETE 514
Cdd:COG1196    838 EELEEKLDEL---------------EEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAE 902
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  515 LQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTsLEKNLSERKK 594
Cdd:COG1196    903 LKEEIEKLRERLEELEAKLERLEVELPELEEELEEEYEDTLETELEREIERLEEEIEALGPVNLRAIEE-YEEVEERYEE 981
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*.
gi 1907156435  595 KSAQercqaEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQL 640
Cdd:COG1196    982 LKSQ-----REDLEEAKEKLLEVIEELDKEKRERFKETFDKINENF 1022
YhaN COG4717
Uncharacterized protein YhaN, contains AAA domain [Function unknown];
416-688 3.77e-06

Uncharacterized protein YhaN, contains AAA domain [Function unknown];


Pssm-ID: 227061 [Multi-domain]  Cd Length: 984  Bit Score: 51.00  E-value: 3.77e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  416 IIQENERLKQELLEkSSRIEEQNDKIS---DLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELA 492
Cdd:COG4717    538 ITDELPELAVDLLV-QSRIRQHWQQLRkalDQLEAAYEALEGRFAAAEAAMAEWQSEWEEALDELGLSRELSPEQQLDIL 616
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  493 AATAQVSHLQlkmtahqKKETELQLQLTDNLKETDLLRGHVTRL----QADLSELREASEQTQTKFKSEKQS---RRQLE 565
Cdd:COG4717    617 STMKDLKKLM-------QKKAELTHQVARLREEQAAFEERVEGLlavlEAQFIDLSTLFCVQRLRVAAELQKeeaRLALE 689
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  566 LKVTSLEEELTDLRAEktsLEKNlseRKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLKKARVSTDQ---AAAEQLTL 642
Cdd:COG4717    690 GNIERTKELNDELRAE---LELH---RKEILDLFDCGTADTEDAFREAAREE-QQLTQRESRLESLEAQlegVAAEAYEL 762
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*.
gi 1907156435  643 AQAELQSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQ 688
Cdd:COG4717    763 SASLDQRELKEEELALLEEAIDALDEEVEELHAQVAALSRQIAQLE 808
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
437-688 4.33e-06

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 50.41  E-value: 4.33e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  437 QNDKISDLIERNQRYVEQSnlmmEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQ 516
Cdd:COG4372     75 QLDDIRPQLRALRTELGTA----QGEKRAAETEREAARSELQKARQEREAVRQELAAARQNLAKAQQELARLTKQAQDLQ 150
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  517 LQLTDNLKETDLLRGHVTRLQADLSELREASEQTQT-----KFKSEKQSRRQLELK-----VTSLEEELTDLRAEKTSLE 586
Cdd:COG4372    151 TRLKTLAEQRRQLEAQAQSLQASQKQLQASATQLKSqvldlKLRSAQIEQEAQNLAtranaAQARTEELARRAAAAQQTA 230
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  587 KNLSERKKKsAQERCQAEAEMDEIRKSHQEELDRLRQllKKARVSTDQAAAEQLTLAQAELQSQWEAKCE-QLLASA--R 663
Cdd:COG4372    231 QAIQQRDAQ-ISQKAQQIAARAEQIRERERQLQRLET--AQARLEQEVAQLEAYYQAYVRLRQQAAATQRgQVLAGAaqR 307
                          250       260
                   ....*....|....*....|....*
gi 1907156435  664 DEHLQQYREVCAQRDAHQQKLALLQ 688
Cdd:COG4372    308 VAQAQAQAQAQAQLLSSANRPAALR 332
DUF812 pfam05667
Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of ...
419-710 4.90e-06

Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of unknown function.


Pssm-ID: 398992 [Multi-domain]  Cd Length: 590  Bit Score: 50.40  E-value: 4.90e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  419 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLmmekrnnslqtATENTQARILHAEQEKAKVTEEL-AAATAQ 497
Cdd:pfam05667  223 EEEWNSQGLASRLTPEEYRKRKRTKLLKRIAEQLRSAAL-----------ASTEATSGASRSAQDLAELLSSFgGSSTTD 291
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  498 VSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTD 577
Cdd:pfam05667  292 TNLTKGSRFTHTEKLQFTNEAAASPPSKAETEEELQQQREEELEELQEQLEDLESSIEELEKEIKKLESSIKQVEEELEE 371
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  578 LRAEKTSLEKNLsERKKKSAQERCQAEAEMDEirkshqeeldrlrqlLKKARvstdQAAAEQLtlaqAELQSQWEAKCEQ 657
Cdd:pfam05667  372 LKEQNEELEKQY-KVKKKTLDLLPDAEENIAK---------------LQAVV----EASAQRL----VELAGQWEKHRVP 427
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 1907156435  658 LLasardEHLQQYREVCAQR-DAHQQKLA---LLQDECLalqaQIAAFTEQKEHMQR 710
Cdd:pfam05667  428 LI-----EEYRALKEAKSNKeSESQRKLEeikELREKIK----EVAEEARSKEELYK 475
COG5022 COG5022
Myosin heavy chain [General function prediction only];
369-582 5.20e-06

Myosin heavy chain [General function prediction only];


Pssm-ID: 227355 [Multi-domain]  Cd Length: 1463  Bit Score: 50.85  E-value: 5.20e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  369 VNKVADKMDHLMTKVEELQKHSSGNSML---LPSMSVTMETSM---IMSNIQRIIQ-ENERLKQELLEKSSRIEEQNDKI 441
Cdd:COG5022    894 ISSLKLVNLELESEIIELKKSLSSDLIEnleFKTELIARLKKLlnnIDLEEGPSIEyVKLPELNKLHEVESKLKETSEEY 973
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  442 SDLIERNQRYVEQSNLMMEKRNNSLQTATE-NTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLT 520
Cdd:COG5022    974 EDLLKKSTILVREGNKANSELKNFKKELAElSKQYGALQESTKQLKELPVEVAELQSASKIISSESTELSILKPLQKLKG 1053
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1907156435  521 DNLKEtdllrghVTRLQADLSELREASEQTQTKFKSEKQSRRQ--LELKVTSLEEELTDLRAEK 582
Cdd:COG5022   1054 LLLLE-------NNQLQARYKALKLRRENSLLDDKQLYQLESTenLLKTINVKDLEVTNRNLVK 1110
EzrA COG4477
Septation ring formation regulator EzrA [Cell cycle control, cell division, chromosome ...
434-630 5.22e-06

Septation ring formation regulator EzrA [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 226883 [Multi-domain]  Cd Length: 570  Bit Score: 50.45  E-value: 5.22e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  434 IEEQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQA--RILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKK 511
Cdd:COG4477    253 IDSRLERLKEQLVENS--ELLTQLELDEAEEELGLIQEKIESlyDLLEREVEAKNVVEENLPILPDYLEKAKENNEHLKE 330
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  512 ETELqLQLTDNLKETDLlrGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSE 591
Cdd:COG4477    331 EIER-VKESYRLAETEL--GSVRKFEKELKELESVLDEILENIEAQEVAYSELQDNLEEIEKALTDIEDEQEKVQEHLTS 407
                          170       180       190
                   ....*....|....*....|....*....|....*....
gi 1907156435  592 RKKKSAQERcqaeaemdEIRKSHQEELDRLRQLLKKARV 630
Cdd:COG4477    408 LRKDELEAR--------ENLERLKSKLHEIKRYMEKSNL 438
PRK04778 PRK04778
septation ring formation regulator EzrA; Provisional
425-718 7.14e-06

septation ring formation regulator EzrA; Provisional


Pssm-ID: 179877 [Multi-domain]  Cd Length: 569  Bit Score: 49.83  E-value: 7.14e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  425 QELLEkssRIEEQNDKIsdliernqRYVEQSNLMmeKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQV----SH 500
Cdd:PRK04778    85 EEQLF---EAEELNDKF--------RFRKAKHEI--NEIESLLDLIEEDIEQILEELQELLESEEKNREEVEQLkdlyRE 151
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  501 LQLKMTAH-------------QKKETELQLQLTDNLKET----------DLLRGHVTRLQADLSELREASEQTQTKFKSE 557
Cdd:PRK04778   152 LRKSLLANrfsfgpaldelekQLENLEEEFSQFVELTESgdyveareilDQLEEELAALEQIMEEIPELLKELQTELPDQ 231
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  558 ----KQSRRQLE-----LKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQA-EAEMDEI----------RKSHQEE 617
Cdd:PRK04778   232 lqelKAGYRELVeegyhLDHLDIEKEIQDLKEQIDENLALLEELDLDEAEEKNEEiQERIDQLydilerevkaRKYVEKN 311
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  618 LDRLRQLLKKARVSTDQAAAE--------QLTLAQAELQSQWEAKCEQLLAsardehlqQYREVCAQRDAHQQKLALLQD 689
Cdd:PRK04778   312 SDTLPDFLEHAKEQNKELKEEidrvkqsyTLNESELESVRQLEKQLESLEK--------QYDEITERIAEQEIAYSELQE 383
                          330       340       350
                   ....*....|....*....|....*....|...
gi 1907156435  690 ECLALQAQIAAFTEQ----KEHMQRLEKTKSQA 718
Cdd:PRK04778   384 ELEEILKQLEEIEKEqeklSEMLQGLRKDELEA 416
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
422-752 7.52e-06

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 50.35  E-value: 7.52e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  422 RLKQELLEKSsriEEQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATEntqarilhAEQEKAKVTEELAAATAQVSHl 501
Cdd:TIGR00618  153 EFAQFLKAKS---KEKKELLMNLFPLDQ--YTQLALMEFAKKKSLHGKAE--------LLTLRSQLLTLCTPCMPDTYH- 218
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  502 qlkmTAHQKKETELQlQLTDNLKETDllrghvtRLQADLSELREASEQTQTKFKSEKQSRRQLElKVTSLEEELtdlraE 581
Cdd:TIGR00618  219 ----ERKQVLEKELK-HLREALQQTQ-------QSHAYLTQKREAQEEQLKKQQLLKQLRARIE-ELRAQEAVL-----E 280
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  582 KTSLEKNLSERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTL-AQAELQSQWEAKCEQLla 660
Cdd:TIGR00618  281 ETQERINRARKAAPLAAHI-KAVTQIEQQAQRIHTELQSKMRSRAKLLMKRAAHVKQQSSIeEQRRLLQTLHSQEIHI-- 357
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  661 saRDEHLQQyrevCAQRDAHQQKLALLQdECLALQAQIAAFTEQkehMQRLEKTKSQAPAGRAAADPSEKVKKIMNQVFQ 740
Cdd:TIGR00618  358 --RDAHEVA----TSIREISCQQHTLTQ-HIHTLQQQKTTLTQK---LQSLCKELDILQREQATIDTRTSAFRDLQGQLA 427
                          330
                   ....*....|..
gi 1907156435  741 SLRGEFELEESY 752
Cdd:TIGR00618  428 HAKKQQELQQRY 439
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
418-626 1.19e-05

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 49.40  E-value: 1.19e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  418 QENERLKQELLEKSSRIEEQNDKISDLIERnqryVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQ 497
Cdd:pfam01576  422 SESERQRAELAEKLSKLQSELESVSGLLSE----AEGKSIKLSKDVSSLESQLQDTQELLQEETRQKLNLSSRLRQLEDE 497
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  498 VSHL--QLKMTAHQKKETE-----LQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTS 570
Cdd:pfam01576  498 RNSLqeQLEEEEEAKRNVErqlstLQAQLSEMKKKLEEDAGAVEALEEAKKRLQRELEALTQRLEEKAAAYDKLEKTKNR 577
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  571 LEEELTDL-------RAEKTSLEKN-------LSERKKKSAQ---ERCQAEAEMDEIR-------------KSHQEELDR 620
Cdd:pfam01576  578 LQQELDDLlvdldhqRQLVSNLEKKqkkfdqmLAEEKAISARyaeERDRAEAEAREKEtralslsraleeaLEAKEELER 657

                   ....*.
gi 1907156435  621 LRQLLK 626
Cdd:pfam01576  658 QNKQLR 663
HMMR_N pfam15905
Hyaluronan mediated motility receptor N-terminal; HMMR_N is the N-terminal region of ...
444-672 1.23e-05

Hyaluronan mediated motility receptor N-terminal; HMMR_N is the N-terminal region of eukaryotic hyaluronan-mediated motility receptor proteins. The protein is functionally associated with BRCA1 and thus predicted to be a common, low-penetrance breast cancer candidate.


Pssm-ID: 406356 [Multi-domain]  Cd Length: 331  Bit Score: 48.65  E-value: 1.23e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  444 LIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAataqvshlqlkmtahqkketeLQLQLTDNL 523
Cdd:pfam15905   79 ELEKEIRALVQERGEQDKRLQALEEELEKVEAKLNAAVREKTSLSASVAS---------------------LEKQLLELT 137
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  524 KETDLLR------GHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSA 597
Cdd:pfam15905  138 RVNELLKakfsedGTQKKMSSLSMELMKLRNKLEAKMKEVMAKQEGMEGKLQVTQKNLEHSKGKVAQLEEKLVSTEKEKI 217
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  598 QERCQAEAEMDEIRKSHQ--EELDRLRQLLKKARVSTDQAAAEQLTLAQA------ELQSQWE---AKCeQLLASARDEH 666
Cdd:pfam15905  218 EEKSETEKLLEYITELSCvsEQVEKYKLDIAQLEELLKEKNDEIESLKQSleekeqELSKQIKdlnEKC-KLLESEKEEL 296

                   ....*.
gi 1907156435  667 LQQYRE 672
Cdd:pfam15905  297 LREYEE 302
PRK11281 PRK11281
mechanosensitive channel MscK;
412-648 1.26e-05

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 49.52  E-value: 1.26e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  412 NIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERN-----QRYVEQSNLMMEKRNNSLQTATENTQarilhaeqekak 486
Cdd:PRK11281    74 KIDRQKEETEQLKQQLAQAPAKLRQAQAELEALKDDNdeetrETLSTLSLRQLESRLAQTLDQLQNAQ------------ 141
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  487 vtEELAAATAQVSHLQLK-------MTAHQKKETELQLQLTDNLKETDLLRG-HVTRLQADLS------ELREASEQTQT 552
Cdd:PRK11281   142 --NDLAEYNSQLVSLQTQperaqaaLYANSQRLQQIRNLLKGGKVGGKALRPsQRVLLQAEQAllnaqnDLQRKSLEGNT 219
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  553 KFKSEKQSRRQL-ELKVTSLEEELTDLRAEKTslEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVS 631
Cdd:PRK11281   220 QLQDLLQKQRDYlTARIQRLEHQLQLLQEAIN--SKRLTLSEKTVQEAQSQDEAARIQANPLVAQELEINLQLSQRLLKA 297
                          250
                   ....*....|....*..
gi 1907156435  632 TDQAAaeqlTLAQAELQ 648
Cdd:PRK11281   298 TEKLN----TLTQQNLR 310
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
428-626 1.27e-05

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 49.29  E-value: 1.27e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  428 LEKSSRIEEQNDKISDLIER--------NQRYVEQ--------SNLMMEK------RNNSLQTATENTQARILHAEQEKA 485
Cdd:PRK03918   100 LDGSEVLEEGDSSVREWVERlipyhvflNAIYIRQgeidaileSDESREKvvrqilGLDDYENAYKNLGEVIKEIKRRIE 179
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  486 KVtEELAAATAQVSHLqlkmTAHQKKETELQLQ----LTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSR 561
Cdd:PRK03918   180 RL-EKFIKRTENIEEL----IKEKEKELEEVLReineISSELPELREELEKLEKEVKELEELKEEIEELEKELESLEGSK 254
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  562 RQLELKVTSLEEELTDLRAEKTSLEKNLSERK--KKSAQERCQAEAEMDEIRKSHQE---ELDRLRQLLK 626
Cdd:PRK03918   255 RKLEEKIRELEERIEELKKEIEELEEKVKELKelKEKAEEYIKLSEFYEEYLDELREiekRLSRLEEEIN 324
Macoilin pfam09726
Macoilin family; The Macoilin proteins has an N-terminal portion that is composed of 5 ...
496-705 1.29e-05

Macoilin family; The Macoilin proteins has an N-terminal portion that is composed of 5 trasnmembrane helices, followed by a C-terminal coiled-coil region. Macoilin is a highly conserved protein present in eukaryotes. Macoilin appears to be found in the ER and be involved in the function of neurons.


Pssm-ID: 401607  Cd Length: 664  Bit Score: 49.07  E-value: 1.29e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  496 AQVSHLQLKMTAHQKKETELQLQLtdnlketDLLRGHVTRLQADLSELREASEQTQTKFKS-------EKQSRRQLELKv 568
Cdd:pfam09726  396 QDIKKLKAELQASRQTEQELRSQI-------SSLTSLERSLKSELGQLRQENDLLQTKLHNavsakqkDKQTVQQLEKR- 467
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  569 tsLEEEltdlRAEKTSLEKNLSERKK-------KSAQERCQAEA---EMDEIRKSHQEELD-RLRQLLKKARVSTDQAAa 637
Cdd:pfam09726  468 --LKAE----QEARASAEKQLAEEKKrkkeeeaTAARAVALAAAsrgECTESLKQRKRELEsEIKKLTHDIKLKEEQIR- 540
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1907156435  638 eqltlaqaelqsQWEAKCEQllasardehLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK 705
Cdd:pfam09726  541 ------------ELEIKVQE---------LRKYKESEKDTEVLMSALSAMQDKNQHLENSLSAETRIK 587
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
413-713 1.43e-05

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 49.20  E-value: 1.43e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  413 IQRIIQENERLKQ---ELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTE 489
Cdd:TIGR00618  565 MQEIQQSFSILTQcdnRSKEDIPNLQNITVRLQDLTEKLSEAEDMLACEQHALLRKLQPEQDLQDVRLHLQQCSQELALK 644
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  490 ELAAATAQVSHLQLKMTAHQKKETELQLQLTD-NLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 568
Cdd:TIGR00618  645 LTALHALQLTLTQERVREHALSIRVLPKELLAsRQLALQKMQSEKEQLTYWKEMLAQCQTLLRELETHIEEYDREFNEIE 724
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  569 TSLEEELTDLRAEKTSLEKNLSERKKKsAQERCQAEAEMDEiRKSHQE-----ELDRLRQLLKKARVSTDQAAAEQLTLA 643
Cdd:TIGR00618  725 NASSSLGSDLAAREDALNQSLKELMHQ-ARTVLKARTEAHF-NNNEEVtaalqTGAELSHLAAEIQFFNRLREEDTHLLK 802
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1907156435  644 QAELQSQWEAKCEQLLASARDEHLQQYREVCAQRDA------HQQKLALLQD-ECLALQAQiaAFTEQKEHMQRLEK 713
Cdd:TIGR00618  803 TLEAEIGQEIPSDEDILNLQCETLVQEEEQFLSRLEeksatlGEITHQLLKYeECSKQLAQ--LTQEQAKIIQLSDK 877
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
454-685 1.51e-05

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 48.56  E-value: 1.51e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  454 QSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHV 533
Cdd:COG4942     31 FSAAADDKQLKQIQKEIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADDLKKLRKQIADLNARLNALEVQE 110
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  534 TRLQADLSELREASEQTQTKFK-----SEKQSRRQLELKVtsLEEELTDLRAEKT-SLEKNLSE---RKKKSAQERCQAE 604
Cdd:COG4942    111 REQRRRLAEQLAALQRSGRNPPpallvSPEDAQRSVRLAI--YYGALNPARAERIdALKATLKQlaaVRAEIAAEQAELT 188
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  605 AEMDEiRKSHQEELDRLRQLLKKARVSTDQA-AAEQLTLAqaELQSQwEAKCEQLLASARDEHLQQYREVCAQRDAHQQK 683
Cdd:COG4942    189 TLLSE-QRAQQAKLAQLLEERKKTLAQLNSElSADQKKLE--ELRAN-ESRLKNEIASAEAAAAKAREAAAAAEAAAARA 264

                   ..
gi 1907156435  684 LA 685
Cdd:COG4942    265 RA 266
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
417-716 1.77e-05

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 48.88  E-value: 1.77e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  417 IQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQsnlmmEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATA 496
Cdd:PRK02224   470 IEEDRERVEELEAELEDLEEEVEEVEERLERAEDLVEA-----EDRIERLEERREDLEELIAERRETIEEKRERAEELRE 544
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  497 QVSHLQLKMTAHQKKETELQLqltdnlkETDLLRGHVTRLQADLSELreaseqtqtkfkseKQSRRQLElKVTSLEEELT 576
Cdd:PRK02224   545 RAAELEAEAEEKREAAAEAEE-------EAEEAREEVAELNSKLAEL--------------KERIESLE-RIRTLLAAIA 602
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  577 DLRAEKTSLeknlserkkksaQERCQAEAEMDEIRKSHQEEL-DRLRQL---LKKARVSTDQAAAEQLTLAQAELqsqwe 652
Cdd:PRK02224   603 DAEDEIERL------------REKREALAELNDERRERLAEKrERKRELeaeFDEARIEEAREDKERAEEYLEQV----- 665
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1907156435  653 akceqllasarDEHLQQYREvcaQRDAhqqklalLQDECLALQAQIAAFTEQKEHMQRLEKTKS 716
Cdd:PRK02224   666 -----------EEKLDELRE---ERDD-------LQAEIGAVENELEELEELRERREALENRVE 708
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
343-711 1.79e-05

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 48.96  E-value: 1.79e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  343 HFQGSGDMMSFLMteaRQHNTEIRMAVNKVADKMDHLmtkvEELQKHSSGNSMLLPSMSvtmetsmiMSNIQRIIQENER 422
Cdd:pfam15921  214 HFRSLGSAISKIL---RELDTEISYLKGRIFPVEDQL----EALKSESQNKIELLLQQH--------QDRIEQLISEHEV 278
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  423 LKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENtqariLHAEQEKAKVTEElaaatAQVSHLQ 502
Cdd:pfam15921  279 EITGLTEKASSARSQANSIQSQLEIIQEQARNQNSMYMRQLSDLESTVSQ-----LRSELREAKRMYE-----DKIEELE 348
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  503 LKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADL----SELREASEQTQTKFKSEKQS-------RRQLE---LKV 568
Cdd:pfam15921  349 KQLVLANSELTEARTERDQFSQESGNLDDQLQKLLADLhkreKELSLEKEQNKRLWDRDTGNsitidhlRRELDdrnMEV 428
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  569 TSLEEELTDLRAE-KTSLEKNLS--ERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQllKKARVSTDQAAAEQLTLAQA 645
Cdd:pfam15921  429 QRLEALLKAMKSEcQGQMERQMAaiQGKNESLEKVSSLTAQLESTKEMLRKVVEELTA--KKMTLESSERTVSDLTASLQ 506
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1907156435  646 ELQSQWEAKCEQL--LASARDEHLQQYREVCAQRDAHQQklalLQDECLALQAQIAA-------FTEQKEHMQRL 711
Cdd:pfam15921  507 EKERAIEATNAEItkLRSRVDLKLQELQHLKNEGDHLRN----VQTECEALKLQMAEkdkvieiLRQQIENMTQL 577
mukB PRK04863
chromosome partition protein MukB;
489-729 1.90e-05

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 48.80  E-value: 1.90e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  489 EELAAATAQVSHLQLKMTAHQKKETELQLQLtDNLKET-DLLRGHVTR--------LQADLSELREASEQTQTKFKSEKQ 559
Cdd:PRK04863   837 AELRQLNRRRVELERALADHESQEQQQRSQL-EQAKEGlSALNRLLPRlnlladetLADRVEEIREQLDEAEEAKRFVQQ 915
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  560 SRRQLELkvtsLEEELTDLRAEktsleknlserkkksaqercqaEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAA--- 636
Cdd:PRK04863   916 HGNALAQ----LEPIVSVLQSD----------------------PEQFEQLKQDYQQAQQTQRDAKQQAFALTEVVQrra 969
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  637 ------AEQLTLAQAELQSQWEAKCEQlLASARDEHLQQYREVCAQrdaHQQKLALLQDeclaLQAQIAAFTEQ-KEHMQ 709
Cdd:PRK04863   970 hfsyedAAEMLAKNSDLNEKLRQRLEQ-AEQERTRAREQLRQAQAQ---LAQYNQVLAS----LKSSYDAKRQMlQELKQ 1041
                          250       260
                   ....*....|....*....|...
gi 1907156435  710 RLEKTKSQAPAG---RAAADPSE 729
Cdd:PRK04863  1042 ELQDLGVPADSGaeeRARARRDE 1064
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
395-600 2.00e-05

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 48.47  E-value: 2.00e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  395 MLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDliernqryvEQSNLMMEKRNNSLQTATENTQ 474
Cdd:NF038025    23 DLLENMAKEKDEKQIKKAADEVTAEKDDLLDELENEQEEEPETFTEQKE---------EEDKEDLEAILDELATEANKAS 93
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  475 ARILHAEQEKAKVTEELAAataqvshlqlkmtahqKKETELQLqltdNLKEtdllrghvtrlqaDLSELREaseqtqtkf 554
Cdd:NF038025    94 AELDEVNAEIQGVKEEIKE----------------KQEQLMVL----DTKE-------------ELDELSE--------- 131
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*..
gi 1907156435  555 ksEKQSRRQ-LELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQER 600
Cdd:NF038025   132 --EELAERQeLEAEIKQLEAQLDELEEEKEELEEELKTIRKDQWSQT 176
COG1340 COG1340
Uncharacterized coiled-coil protein, contains DUF342 domain [Function unknown];
357-595 2.11e-05

Uncharacterized coiled-coil protein, contains DUF342 domain [Function unknown];


Pssm-ID: 224259 [Multi-domain]  Cd Length: 294  Bit Score: 47.75  E-value: 2.11e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  357 EARQHNTEIRMAVNKVADKMDHLMTKVEELqkhssgnsmllpsmsvtmeTSMIMSNIQR---IIQENERLKQELLEKSSR 433
Cdd:COG1340     24 ELKEKRDELRKEASELAEKRDELNAKVREL-------------------REKAQELREErdeINEEVQELKEKRDEINAK 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  434 IEEQNDKISDLIE-RNQRYVEQSNLM-MEKRNNSLQTATENTQARI----------------LHAEQEKAKVTEELAAAT 495
Cdd:COG1340     85 LQELRKEYRELKEkRNEFNLGGRSIKsLEREIERLEKKQQTSVLTPeeerelvqkikelrkeLEDAKKALEENEKLKELK 164
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  496 AQVSHLQLKMTAHQKKETEL-------QLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 568
Cdd:COG1340    165 AEIDELKKKAREIHEKIQELaneaqeyHEEMIKLFEEADELRKEADELHEEFVELSKKIDELHEEFRNLQNELRELEKKI 244
                          250       260
                   ....*....|....*....|....*....
gi 1907156435  569 TSLEEELTDL--RAEKTSLEKNLSERKKK 595
Cdd:COG1340    245 KALRAKEKAAkrREKREELKERAEEIYEK 273
TPH pfam13868
Trichohyalin-plectin-homology domain; This family is a mixtrue of two different families of ...
453-712 2.15e-05

Trichohyalin-plectin-homology domain; This family is a mixtrue of two different families of eukaryotic proteins. Trichoplein or mitostatin, was first defined as a meiosis-specific nuclear structural protein. It has since been linked with mitochondrial movement. It is associated with the mitochondrial outer membrane, and over-expression leads to reduction in mitochondrial motility whereas lack of it enhances mitochondrial movement. The activity appears to be mediated through binding the mitochondria to the actin intermediate filaments (IFs). The family is in the trichohyalin-plectin-homology domain.


Pssm-ID: 404709 [Multi-domain]  Cd Length: 352  Bit Score: 47.99  E-value: 2.15e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  453 EQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLqltdnLKETDLLRGH 532
Cdd:pfam13868   32 KRIKAEEKEEERRLDEMMEEEREKALEEEEEKEEERKEKRKEYRQELEQQIEEREKKRQEEYEEK-----LQEKEMIDEI 106
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  533 VTRLQADlselreasEQTQTKFKSEKQSRRQLELKVTSleEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMD---- 608
Cdd:pfam13868  107 VEKIQEE--------DEAEAEEKLEKQKELREEIDEFN--EEQAEWKELEKEEEKEEDERILEYLKEKEEREEEREaerr 176
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  609 EIRKSHQEELDRLRQLLKKARvsTDQAAAEQL--TLAQAELQSQWEAK----------CEQLLASARDEHL---QQYREV 673
Cdd:pfam13868  177 EIEEEKEREIARLRAQQEKAQ--DEKEERDELraDLYQEEQERKWRQKereeaekkarQRQELRQAREEQVelkERRLAE 254
                          250       260       270
                   ....*....|....*....|....*....|....*....
gi 1907156435  674 CAQRDAHQQKLALLQdecLALQAQIAAFTEQKEHMQRLE 712
Cdd:pfam13868  255 EAEREEEEFERMLRK---QAEDERIEQEEAEKRRMKRLE 290
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
469-726 2.47e-05

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 48.60  E-value: 2.47e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  469 ATENTQARILHAEQEkakvTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKE--------TDLLRGHVTRLQADL 540
Cdd:pfam12128  234 RIMKVAPEIEKLQED----FEQLESLELKLSLLHVELKADELRIATEQEERQELKNElksqlrtlEDELAEKIDELNGRL 309
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  541 SELREASEQTQTKFKS-EKQSRRQLELKVTSLEEELTDLRAEKTSLEkNLSERKKKSAQERCQAEAEMDEIRKSHQEELD 619
Cdd:pfam12128  310 SAADAALAAKRSELEAlDDQKGAFQDDDIETLAADQEQLPSIQSELE-EVEERLDALTGNHQDVTQKYERLKQKISEELN 388
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  620 RLRQLLKKARVSTDQAAAEQLTLAQAELQ---SQWEAKCEQLLASARDEhlQQYREVCAQRDAHQQKLALLQDEclaLQA 696
Cdd:pfam12128  389 RDLSGNKERLAKIREAKDRQLAAIEEVLQaleSQLRHQLEQQKLEFNEE--QYLLESRLGELKLQLNQATATPE---LLE 463
                          250       260       270
                   ....*....|....*....|....*....|....
gi 1907156435  697 QIAAFTEQKEHMQR----LEKTKSQAPAGRAAAD 726
Cdd:pfam12128  464 NIEQNDERLERAQEaqeqANASVEAAQSELRQLR 497
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
411-591 2.60e-05

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 48.22  E-value: 2.60e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  411 SNIQRIIQENERLKQELLEKSSRIEEQND--KISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAR----ILHAEQEK 484
Cdd:COG0419    562 RQLEDRLQELKELLEELRLLRTRKEELEElrERLKELKKKLKELEERLSQLEELLQSLELSEAENELEeaeeELESELEK 641
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  485 AKVTEELA-AATAQVSHLQLK--------MTAHQKKETELQLQltDNLKETDLLRGHVTRLQADLSELREaseqtqtKFK 555
Cdd:COG0419    642 LNLQAELEeLLQAALEELEEKveeleaeiRRELQRIENEEQLE--EKLEELEQLEEELEQLREELEELLK-------KLG 712
                          170       180       190
                   ....*....|....*....|....*....|....*.
gi 1907156435  556 SEKQSRRQLElkvtSLEEELTDLRAEKTSLEKNLSE 591
Cdd:COG0419    713 EIEQLIEELE----SRKAELEELKKELEKLEKALEL 744
46 PHA02562
endonuclease subunit; Provisional
357-595 3.27e-05

endonuclease subunit; Provisional


Pssm-ID: 222878 [Multi-domain]  Cd Length: 562  Bit Score: 47.70  E-value: 3.27e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  357 EARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMetsmiMSNIQRIIQENERLKQELLEKSSRIEE 436
Cdd:PHA02562   178 ELNQQIQTLDMKIDHIQQQIKTYNKNIEEQRKKNGENIARKQNKYDEL-----VEEAKTIKAEIEELTDELLNLVMDIED 252
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  437 QNDKISDLierNQRYVEQSNLM--------MEKRNNSLQTATENtqariLHAEQEK-AKVTEELAAATAQVShlqlKMTA 507
Cdd:PHA02562   253 PSAALNKL---NTAAAKIKSKIeqfqkvikMYEKGGVCPTCTQQ-----ISEGPDRiTKIKDKLKELQHSLE----KLDT 320
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  508 HQKKETELQLQLTDNLKEtdllrghVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEK 587
Cdd:PHA02562   321 AIDELEEIMDEFNEQSKK-------LLELKNKISTNKQSLITLVDKAKKVKAAIEELQAEFVDNAEELAKLQDELDKIVK 393

                   ....*...
gi 1907156435  588 NLSERKKK 595
Cdd:PHA02562   394 TKSELVKE 401
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
477-729 4.33e-05

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 47.02  E-value: 4.33e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  477 ILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-EASEQTQTKFK 555
Cdd:COG4942     26 VLAAAFSAAADDKQLKQIQKEIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADDLKKLRkQIADLNARLNA 105
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  556 SEKQSRRQLELkvtsLEEELTDLR--AEKTSLEKNLSErkkKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTD 633
Cdd:COG4942    106 LEVQEREQRRR----LAEQLAALQrsGRNPPPALLVSP---EDAQRSVRLAIYYGALNPARAERIDALKATLKQLAAVRA 178
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  634 QAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRevcAQRDAHQQKLALLQDECLALQAQIAafteqkehmqRLEK 713
Cdd:COG4942    179 EIAAEQAELTTLLSEQRAQQAKLAQLLEERKKTLAQLN---SELSADQKKLEELRANESRLKNEIA----------SAEA 245
                          250
                   ....*....|....*.
gi 1907156435  714 TKSQAPAGRAAADPSE 729
Cdd:COG4942    246 AAAKAREAAAAAEAAA 261
PspC_subgroup_1 NF033838
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ...
409-847 4.41e-05

pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.


Pssm-ID: 411407 [Multi-domain]  Cd Length: 684  Bit Score: 47.70  E-value: 4.41e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  409 IMSNIQRIIQEnerlKQELLEKSSRIEEQ--NDKISDLierNQRYVEQSNLMMEKRNNSLQTAT-ENTQARILHAEQEKA 485
Cdd:NF033838    63 VESHLEKILSE----IQKSLDKRKHTQNValNKKLSDI---KTEYLYELNVLKEKSEAELTSKTkKELDAAFEQFKKDTL 135
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  486 KVTEELAAATAQVSHLQLKmtAHQKKETELQLQLTDNLK--ETDLLRGHVTRLQADLSELREASEQTQtkfksEKQSRRQ 563
Cdd:NF033838   136 EPGKKVAEATKKVEEAEKK--AKDQKEEDRRNYPTNTYKtlELEIAESDVEVKKAELELVKEEAKEPR-----DEEKIKQ 208
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  564 LELKVTSLEEELTDLRAEKTSLEKnlSERKKKSAQERCQAEAEMDEIRKSHQEELDRL--RQLL----------KKARvS 631
Cdd:NF033838   209 AKAKVESKKAEATRLEKIKTDREK--AEEEAKRRADAKLKEAVEKNVATSEQDKPKRRakRGVLgepatpdkkeNDAK-S 285
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  632 TDQAAAEQlTLAQAELqsqweaKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAqiaAFTEQKEHMQRL 711
Cdd:NF033838   286 SDSSVGEE-TLPSPSL------KPEKKVAEAEKKVEEAKKKAKDQKEEDRRNYPTNTYKTLELEI---AESDVKVKEAEL 355
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  712 EKTKSQAPAGRAaadpSEKVKKIMNQVfQSLRGEfeleesydgGTILRTIMHTIKMVTLQLLNHQEEEEEEEEEEEEEKK 791
Cdd:NF033838   356 ELVKEEAKEPRN----EEKIKQAKAKV-ESKKAE---------ATRLEKIKTDRKKAEEEAKRKAAEEDKVKEKPAEQPQ 421
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156435  792 PL---RPSLEQPGPATPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPENGAQ 847
Cdd:NF033838   422 PApapQPEKPAPKPEKPAEQPKAEKPADQQAEEDYARRSEEEYNRLTQQQPPKTEKPAQ 480
TPR_MLP1_2 pfam07926
TPR/MLP1/MLP2-like protein; The sequences featured in this family are similar to a region of ...
480-587 4.57e-05

TPR/MLP1/MLP2-like protein; The sequences featured in this family are similar to a region of human TPR protein and to yeast myosin-like proteins 1 (MLP1) and 2 (MLP2). These proteins share a number of features; for example, they all have coiled-coil regions and all three are associated with nuclear pores. TPR is thought to be a component of nuclear pore complex- attached intra-nuclear filaments, and is implicated in nuclear protein import. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerization of kinase domains or by targeting these kinases to the nuclear pore complex. MLP1 and MLP2 are involved in the process of telomere length regulation, where they are thought to interact with proteins such as Tel1p and modulate their activity.


Pssm-ID: 400329 [Multi-domain]  Cd Length: 129  Bit Score: 44.14  E-value: 4.57e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  480 AEQEKAKVTEELAAATAQVSHLQLKM--------TAHQKKETELQLQLTDnLKETDLLRGHVTRLQADLSELREASEQTQ 551
Cdd:pfam07926    6 LESEIKRLKEEAEDAEAQLQKLQEDLekqaeiakEAQQNYERELVLHAED-IKALQALREELNELKAEIAELKAEAESAK 84
                           90       100       110
                   ....*....|....*....|....*....|....*.
gi 1907156435  552 TKFKSEKQSrrqLELKVTSLEEELTDLRAEKTSLEK 587
Cdd:pfam07926   85 AELEESEES---WEEQKERLEKELSELEKRIEDLNE 117
CAGE1 pfam15066
Cancer-associated gene protein 1 family; CAGE-1 is a family of proteins overexpressed in tumor ...
421-600 5.35e-05

Cancer-associated gene protein 1 family; CAGE-1 is a family of proteins overexpressed in tumor tissues compared with surrounding tissues. CAGE-1 gene showed testis-specific expression among normal tissues and displayed wide expression in a variety of cancer cell lines and cancer tissues. CAGE-1 is predominantly expressed during post-meiotic stages. It localizes to the acrosomal matrix and acrosomal granule showing it to be a component of the acrosome of mammalian spermatids and spermatozoa.


Pssm-ID: 405712  Cd Length: 528  Bit Score: 47.13  E-value: 5.35e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  421 ERLKQELLEKSSR-------IEEQNDKISDLIErnqryvEQSNLMMEKR--NNSLQTATE---NTQARILHAEQEKAKVT 488
Cdd:pfam15066  345 EKKVKELQMKITKqqvfvdiINKLKENVEELIE------DKYNVILEKNdiNKTLQNLQEilaNTQKHLQESRKEKETLQ 418
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  489 EELAAATAQVSHLQLK-MTAHQKKETE----LQLQLTDNLKEtdllrGHVTRLQADLSELREASEQTQTKFKSEKQSRRQ 563
Cdd:pfam15066  419 LELKKIKVNYVHLQERyITEMQQKNKSvsqcLEMDKTLSKKE-----EEVERLQQLKGELEKATTSALDLLKREKETREQ 493
                          170       180       190
                   ....*....|....*....|....*....|....*...
gi 1907156435  564 LELkvtSLEEELTdlRAEKtsleKNLSERKK-KSAQER 600
Cdd:pfam15066  494 EFL---SLQEEFQ--KHEK----ENLEERQKlKSRLEK 522
PspA COG1842
Phage shock protein A [Transcription, Signal transduction mechanisms];
459-663 6.30e-05

Phage shock protein A [Transcription, Signal transduction mechanisms];


Pssm-ID: 224755 [Multi-domain]  Cd Length: 225  Bit Score: 45.39  E-value: 6.30e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  459 MEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKeTELQLQLTDNlketDLLRGHVTRLQa 538
Cdd:COG1842     22 AEDPEKMLEQAIRDMESELAKARQALAQAIARQKQLERKLEEAQARAEKLEEK-AELALQAGNE----DLAREALEEKQ- 95
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  539 DLSELREASEQTQTKFKsekQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKkksAQERCQ----------AEAEMD 608
Cdd:COG1842     96 SLEDLAKALEAELQQAE---EQVEKLKKQLAALEQKIAELRAKKEALKARKAAAK---AQEKVNrslgggssssAMAAFE 169
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 1907156435  609 EIRKShQEELDRLRQLLKKARVSTDQAAAEQltLAQAELQSQWEAKCEQLLASAR 663
Cdd:COG1842    170 RMEEK-IEEREARAEAAAELAEGSGDDLDKE--FAQAGAQSAVDSRLAALKARMK 221
PTZ00121 PTZ00121
MAEBL; Provisional
357-750 8.68e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 47.06  E-value: 8.68e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  357 EARQHNTEIRM-AVNKV--ADKMDHLMTKVEELQKHSSGNSMLLPSMSVtmetsmiMSNIQRIIQENERLKQELLEKSsr 433
Cdd:PTZ00121  1216 EARKAEDAKKAeAVKKAeeAKKDAEEAKKAEEERNNEEIRKFEEARMAH-------FARRQAAIKAEEARKADELKKA-- 1286
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  434 ieEQNDKISDLIERNQ-RYVEQSNLMME--KRNNSLQTATENTQ--ARILHAEQEKAKVTEELAAATAQVSHLQLKMTAH 508
Cdd:PTZ00121  1287 --EEKKKADEAKKAEEkKKADEAKKKAEeaKKADEAKKKAEEAKkkADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEE 1364
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  509 QKKETELQlqltdnlKETDLLRGHVTRLQADlsELREASEqtqTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKN 588
Cdd:PTZ00121  1365 KAEAAEKK-------KEEAKKKADAAKKKAE--EKKKADE---AKKKAEEDKKKADELKKAAAAKKKADEAKKKAEEKKK 1432
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  589 LSERKKKSAQERCQAEA--EMDEIRKSHQ-----EELDRLRQLLKKA----RVSTDQAAAEQLTLAQAELQSQWEA--KC 655
Cdd:PTZ00121  1433 ADEAKKKAEEAKKADEAkkKAEEAKKAEEakkkaEEAKKADEAKKKAeeakKADEAKKKAEEAKKKADEAKKAAEAkkKA 1512
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  656 EQLLASARDEHLQQYREVCAQRDAHQQKLAllQDECLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADPSEKVKKIM 735
Cdd:PTZ00121  1513 DEAKKAEEAKKADEAKKAEEAKKADEAKKA--EEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAE 1590
                          410
                   ....*....|....*
gi 1907156435  736 NQVFQSLRGEFELEE 750
Cdd:PTZ00121  1591 EARIEEVMKLYEEEK 1605
SMC_N pfam02463
RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The ...
413-715 9.27e-05

RecF/RecN/SMC N terminal domain; This domain is found at the N-terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.


Pssm-ID: 308206 [Multi-domain]  Cd Length: 1162  Bit Score: 46.50  E-value: 9.27e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  413 IQRIIQENERLKQELLEKSSRIEEQNDK---ISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTE 489
Cdd:pfam02463  145 IEIIAMMKPERRLEIEEEAAGSRLKRKKkeaLKKLIEETENLAELIIDLEELKLQELKLKEQAKKALEYYQLKEKLELEE 224
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  490 ELAAATAQVSHlqlkmtaHQKKETELQLQLTDNLKETDLLRGhvtrlqadLSELREASEQTQTKFKSEkqsrrqlELKVT 569
Cdd:pfam02463  225 EYLLYLDYLKL-------NEERIDLLQELLRDEQEEIESSKQ--------EIEKEEEKLAQVLKENKE-------EEKEK 282
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  570 SLEEE---LTDLRAEKTSLEKNLSERKKKSAQErcQAEAEMDEIRKsHQEELDRLRQLLKKARVS-TDQAAAEQLTLAQA 645
Cdd:pfam02463  283 KLQEEelkLLAKEEEELKSELLKLERRKVDDEE--KLKESEKEKKK-AEKELKKEKEEIEELEKElKELEIKREAEEEEE 359
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  646 ELQSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFtEQKEHMQRLEKTK 715
Cdd:pfam02463  360 EELEKLQEKLEQLEEELLAKKKLESERLSSAAKLKEEELELKSEEEKEAQLLLELA-RQLEDLLKEEKKE 428
235kDa-fam TIGR01612
reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in ...
425-626 1.03e-04

reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in plasmodium species alternately annotated as reticulocyte binding protein, 235-kDa family protein and rhoptry protein. Rhoptry protein is localized on the cell surface and is extremely large (although apparently lacking in repeat structure) and is important for the process of invasion of the RBCs by the parasite. These proteins are found in P. falciparum, P. vivax and P. yoelii.


Pssm-ID: 130673 [Multi-domain]  Cd Length: 2757  Bit Score: 46.58  E-value: 1.03e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  425 QELLEKSSRIEEQNDKISDLIERNQRYVEQ-----------------SNLMMEKRNNSLQTATENTQAR---ILHAEQEK 484
Cdd:TIGR01612 1489 KEHIDKSKGCKDEADKNAKAIEKNKELFEQykkdvtellnkysalaiKNKFAKTKKDSEIIIKEIKDAHkkfILEAEKSE 1568
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  485 AKVTE--------ELAAATAQVSH-----LQLKMTAHQKKE---TELQLQLTDNLKETDLLRGHVTRLQAD-----LSEL 543
Cdd:TIGR01612 1569 QKIKEikkekfriEDDAAKNDKSNkaaidIQLSLENFENKFlkiSDIKKKINDCLKETESIEKKISSFSIDsqdteLKEN 1648
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  544 REASEQTQTKFKSEKQSRRQLELKVTsleeELTDLRAEKTSLEKNLSERKKKsaQERCQAEaEMDEIRKSHQEELDRLRQ 623
Cdd:TIGR01612 1649 GDNLNSLQEFLESLKDQKKNIEDKKK----ELDELDSEIEKIEIDVDQHKKN--YEIGIIE-KIKEIAIANKEEIESIKE 1721

                   ...
gi 1907156435  624 LLK 626
Cdd:TIGR01612 1722 LIE 1724
COG4913 COG4913
Uncharacterized protein, contains a C-terminal ATPase domain [Function unknown];
494-689 1.14e-04

Uncharacterized protein, contains a C-terminal ATPase domain [Function unknown];


Pssm-ID: 227250 [Multi-domain]  Cd Length: 1104  Bit Score: 46.55  E-value: 1.14e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  494 ATAQVSHLQLKMTAHQKKET-ELQLQLTDNLkeTDLLRGHVTRLQA--DLSELREASEQTQTKFKSEKQSRR-------- 562
Cdd:COG4913    234 AKTAVEQFQDLEGAYEQVEDiKRQIHTLDPL--VQLKNRREKAQQSkdHANALKKALPTVGNRIKKEEQETLvrqftveq 311
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  563 -QLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLT 641
Cdd:COG4913    312 tQAKSKVESAKIETDRAREMETLAHDNVKQIVGAQHGILSAKREGAVDKRRTISTARAGLDALVKGLGGAAPESAEELLE 391
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*...
gi 1907156435  642 LAQAELQSqweakCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQD 689
Cdd:COG4913    392 LNNAARLT-----VDEYPAAREALESAGQRNVEDRTRAVDEFKAADQE 434
mukB PRK04863
chromosome partition protein MukB;
421-704 1.18e-04

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 46.49  E-value: 1.18e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  421 ERLKQELLEKSSRIEEQN---DKISDLIERNQRYVEQSNLMMEKRNNSL---QTATENTQARIL---HAEQ--EKAKVTE 489
Cdd:PRK04863   351 ERYQADLEELEERLEEQNevvEEADEQQEENEARAEAAEEEVDELKSQLadyQQALDVQQTRAIqyqQAVQalERAKQLC 430
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  490 ELAAATA-QVSHLQLKMTAHQKKETELQLQLTDNLKETD-----------LLR---GHVTR------------------- 535
Cdd:PRK04863   431 GLPDLTAdNAEDWLEEFQAKEQEATEELLSLEQKLSVAQaahsqfeqayqLVRkiaGEVSRseawdvarellrrlreqrh 510
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  536 -------LQADLSELREASEQTQTKFKSEKQSRRQLELKVTSlEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAemd 608
Cdd:PRK04863   511 laeqlqqLRMRLSELEQRLRQQQRAERLLAEFCKRLGKNLDD-EDELEQLQEELEARLESLSESVSEARERRMALRQ--- 586
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  609 eirksHQEELD-RLRQLLKKARV-STDQAAAEQLtlaqaELQSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLAL 686
Cdd:PRK04863   587 -----QLEQLQaRIQRLAARAPAwLAAQDALARL-----REQSGEEFEDSQDVTEYMQQLLERERELTVERDELAARKQA 656
                          330
                   ....*....|....*...
gi 1907156435  687 LQDECLALQAQIAAFTEQ 704
Cdd:PRK04863   657 LDEEIERLSQPGGSEDPR 674
ATG16 pfam08614
Autophagy protein 16 (ATG16); Autophagy is a ubiquitous intracellular degradation system for ...
443-621 1.32e-04

Autophagy protein 16 (ATG16); Autophagy is a ubiquitous intracellular degradation system for eukaryotic cells. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. ATG16 (also known as Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate in the yeast autophagy pathway.


Pssm-ID: 400781 [Multi-domain]  Cd Length: 176  Bit Score: 43.77  E-value: 1.32e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  443 DLIERNQRYVEQSNLMmEKRNNSLQTATENTQARILHAEQEKAKVTEE-LAAATAQVSHLQLKMTAHQKKETELQLQLTD 521
Cdd:pfam08614    4 ELIDAYNRLLDRTALL-EAENAKLQSEPESVPPSTSSSLASASPVQSAsIQSLEQKLAQLREELAELYRSRGELAQQLVD 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  522 nlketdllrghvtrLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEEL-------TDLRAEKTSLEKNLSerkk 594
Cdd:pfam08614   83 --------------LNEELQELESELREDERRLAELEAERAQLEEKLRDREEELrekrklnQDLQDELVALQLQLN---- 144
                          170       180
                   ....*....|....*....|....*..
gi 1907156435  595 ksaqercQAEAEMDEIRKSHQEELDRL 621
Cdd:pfam08614  145 -------MAEEKLRKLEKENRELVERW 164
WEMBL pfam05701
Weak chloroplast movement under blue light; WEMBL consists of several plant proteins required ...
480-705 1.34e-04

Weak chloroplast movement under blue light; WEMBL consists of several plant proteins required for the chloroplast avoidance response under high intensity blue light. This avoidance response consists in the relocation of chloroplasts on the anticlinal side of exposed cells. Acts in association with PMI2 to maintain the velocity of chloroplast photo-relocation movement via the regulation of cp-actin filaments. Thus several member-sequences are described as "myosin heavy chain-like".


Pssm-ID: 399015 [Multi-domain]  Cd Length: 562  Bit Score: 45.78  E-value: 1.34e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  480 AEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQlqltdnlKETDLLRGHVTRLQADLSElrEASEQTQTKFKSEKQ 559
Cdd:pfam05701   61 AEAAKSQVLEELESTKRLIEELKLNLEKAQTEEAQAK-------QDSELAKLRVEEMEQGIAD--EASVAAKAQLEVAKA 131
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  560 SRRQLELKVTSLEEELTDLRAEKTSL--EKNLSERKkksAQErcqAEAEMDEIRKSHQE---ELDRLRQLLKKARVSTDQ 634
Cdd:pfam05701  132 RHAAAVAELKSVKEELESLQKEYASLvsERDIAIKR---AEE---AVSASKEIEKTVEEltiELIATKESLESAHAAHLE 205
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1907156435  635 AAAEQLTLAQAELQ--SQWEAKCEQLlasarDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK 705
Cdd:pfam05701  206 AEEHRIGAALAREQdkLNWEKELKQA-----EEELQRLNQQLLSAKDLKSKLETASALLLDLKAELAAYMESK 273
PHA03247 PHA03247
large tegument protein UL36; Provisional
792-977 1.57e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.08  E-value: 1.57e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  792 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 871
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  872 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 949
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1907156435  950 PalDPESQGGEAQPPECKQAEDVSSS-GP 977
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
GAS pfam13851
Growth-arrest specific micro-tubule binding; This family is the highly conserved central ...
504-649 1.95e-04

Growth-arrest specific micro-tubule binding; This family is the highly conserved central region of a number of metazoan proteins referred to as growth-arrest proteins. In mouse, Gas8 is predominantly a testicular protein, whose expression is developmentally regulated during puberty and spermatogenesis. In humans, it is absent in infertile males who lack the ability to generate gametes. The localization of Gas8 in the motility apparatus of post-meiotic gametocytes and mature spermatozoa, together with the detection of Gas8 also in cilia at the apical surfaces of epithelial cells lining the pulmonary bronchi and Fallopian tubes suggests that the Gas8 protein may have a role in the functioning of motile cellular appendages. Gas8 is a microtubule-binding protein localized to regions of dynein regulation in mammalian cells.


Pssm-ID: 404693 [Multi-domain]  Cd Length: 200  Bit Score: 43.75  E-value: 1.95e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  504 KMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQtqtkFKSEKQSRRQLELKVTSLEEELTDLRAEKt 583
Cdd:pfam13851   34 EIAELKKKEERNEKLMSEIQQENKRLTEPLQKAQEEVEELRKQLEN----YEKDKQSLKNLKARLKVLEKELKDLKWEH- 108
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907156435  584 sleKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKaRVstdQAAAEQLTLAQAELQS 649
Cdd:pfam13851  109 ---EVLEQRFEKVERERDELYDKFEAAIQDVQQKTGLKNLLLEK-KL---QALGETLEKKEAQLNE 167
PTZ00121 PTZ00121
MAEBL; Provisional
418-620 1.99e-04

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 45.52  E-value: 1.99e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156435  418 QENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQsnlmmekrnnsLQTATENTQARilhAEQEKAKVTEELAAATaq 497
Cdd:PTZ00121  1615 AEEAKIKAEELKKAEEEKKKVEQLKKKEAEEKKKAEE-----------L