NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1907156437|ref|XP_036020099|]
View 

FK506-binding protein 15 isoform X3 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Smc super family cl34174
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
122-430 5.04e-17

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


The actual alignment was detected with superfamily member COG1196:

Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 85.92  E-value: 5.04e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  122 IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVT 201
Cdd:COG1196    679 LEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEEL--------KRELAALEEELEQLQSRLEELEEELEELE 750
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  202 EELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 281
Cdd:COG1196    751 EELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEI 830
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  282 TSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIR------KSHQEELDRLRQLLKKARVSTDQaaAEQLTL 355
Cdd:COG1196    831 EELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEeledelKELEEEKEELEEELRELESELAE--LKEEIE 908
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1907156437  356 AQAELQSQWEAKCEQLLASARDEHLQQYRE-VCAQRDAHQQKLALLQDECLALQA-QIAAFTEQKEHMQRLEKTKSQ 430
Cdd:COG1196    909 KLRERLEELEAKLERLEVELPELEEELEEEyEDTLETELEREIERLEEEIEALGPvNLRAIEEYEEVEERYEELKSQ 985
PHA03247 super family cl33720
large tegument protein UL36; Provisional
505-690 1.07e-04

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.08  E-value: 1.07e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  505 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 584
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  585 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 662
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1907156437  663 PalDPESQGGEAQPPECKQAEDVSSS-GP 690
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
 
Name Accession Description Interval E-value
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
122-430 5.04e-17

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 85.92  E-value: 5.04e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  122 IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVT 201
Cdd:COG1196    679 LEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEEL--------KRELAALEEELEQLQSRLEELEEELEELE 750
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  202 EELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 281
Cdd:COG1196    751 EELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEI 830
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  282 TSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIR------KSHQEELDRLRQLLKKARVSTDQaaAEQLTL 355
Cdd:COG1196    831 EELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEeledelKELEEEKEELEEELRELESELAE--LKEEIE 908
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1907156437  356 AQAELQSQWEAKCEQLLASARDEHLQQYRE-VCAQRDAHQQKLALLQDECLALQA-QIAAFTEQKEHMQRLEKTKSQ 430
Cdd:COG1196    909 KLRERLEELEAKLERLEVELPELEEELEEEyEDTLETELEREIERLEEEIEALGPvNLRAIEEYEEVEERYEELKSQ 985
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
134-402 4.26e-13

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 73.17  E-value: 4.26e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  134 ERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLM------MEKRNNSLQTATENTQARILHAEQEKAKVTEELAAA 207
Cdd:TIGR02168  235 EELREELEELQEELKEAEEELEELTAELQELEEKLEELrlevseLEEEIEELQKELYALANEISRLEQQKQILRERLANL 314
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  208 TAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEE 287
Cdd:TIGR02168  315 ERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQ 394
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  288 LTDLRAEKTSLEKNLS---ERKKKSAQERCQAEAEMDEIRKS-HQEELDRLRQLLKKArVSTDQAAAEQLTLAQAELqsq 363
Cdd:TIGR02168  395 IASLNNEIERLEARLErleDRRERLQQEIEELLKKLEEAELKeLQAELEELEEELEEL-QEELERLEEALEELREEL--- 470
                          250       260       270
                   ....*....|....*....|....*....|....*....
gi 1907156437  364 weAKCEQLLASARDEHLQqyrevcaqrdaHQQKLALLQD 402
Cdd:TIGR02168  471 --EEAEQALDAAERELAQ-----------LQARLDSLER 496
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
193-588 1.58e-08

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 58.00  E-value: 1.58e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 193 AEQEKaKVTEELAAATAQVSHLQLK-MTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-----EASEQTQTK 266
Cdd:NF033930   85 AKKEK-KASEEEQKANLAVQKAYVKyRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRakvvpEAEELAETK 163
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 267 FKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSaqERCQAEAEMDEIrkshQEELDRLRQLLKKARVSTD 346
Cdd:NF033930  164 KKAEEAKAEEPVAKKKVDEAKKKVEEAKKKVEAEEAEIEKLQN--EEVALEAKIAEL----ENQVDNLEKELAEIDESDS 237
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 347 QAAAEQ---------LTLAQAELqSQWEAKCEQLLASARDEHLQQyrevcaQRDAHQQKLALLQDECLALQAQIAAFTEQ 417
Cdd:NF033930  238 EDYIKEglrapleseLDAKQAKL-AKKQTELEKLLDSLDPEGKTQ------DELDKEAAEEELSKKIDELDNEVAKLEKE 310
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 418 KEHMQRLEKtkSQAPAGRAAADPSEKVKKImnqvfqslrgefELEEsydggtilrtimhTIKMVTlQLLNHQEEEEEEEE 497
Cdd:NF033930  311 VSDLENSDN--NVADYYKEALEKDLATKKA------------ELEK-------------TQKDLD-KALNELGPDGDEEE 362
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 498 EEEEEKKPLRPSlEQPGPA----TPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPEngaqtrkgEPAEAEVPS 573
Cdd:NF033930  363 TPAPAPQPEQPA-PAPAPApkpeQPAPAPKPEKPADQQAEEDYARRSEEEYNRLTQQQPPKAE--------KPAPAPAPK 433
                         410
                  ....*....|....*
gi 1907156437 574 eikdsslPPQPAGIP 588
Cdd:NF033930  434 -------PEQPAPAP 441
PTZ00121 PTZ00121
MAEBL; Provisional
132-445 4.25e-07

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 53.99  E-value: 4.25e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  132 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATaqv 211
Cdd:PTZ00121  1312 EEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKKADAAKKKAE--- 1388
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  212 shlQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEqtqTKFKSEkQSRRQLELKVTSlEEELTDL 291
Cdd:PTZ00121  1389 ---EKKKADEAKKKAEEDKKKADELKKAAAAKKKADEAKKKAEEKKKADE---AKKKAE-EAKKADEAKKKA-EEAKKAE 1460
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  292 RAEKTSLEKNLSERKKKSAQERCQAE--AEMDEIRKSHQEELDRLRQLLKKA---RVSTDQAAAEQLTLAQAELQSQWEA 366
Cdd:PTZ00121  1461 EAKKKAEEAKKADEAKKKAEEAKKADeaKKKAEEAKKKADEAKKAAEAKKKAdeaKKAEEAKKADEAKKAEEAKKADEAK 1540
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  367 KCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK--EHMQRLEKTKSQAPAGRAAADPSEKV 444
Cdd:PTZ00121  1541 KAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEAriEEVMKLYEEEKKMKAEEAKKAEEAKI 1620

                   .
gi 1907156437  445 K 445
Cdd:PTZ00121  1621 K 1621
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
149-430 6.90e-07

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 52.38  E-value: 6.90e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 149 EQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATA---QVSHLQLKMTAHQKKE 225
Cdd:pfam15742  53 LQEENIKIKAELKQ--AQQKLLDSTKMCSSLTAEWEHCQQKIRELELEVLKQAQSIKSQNSlqeKLAQEKSKVAEAEKKI 130
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 226 TELQLQLTD--NLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLS 303
Cdd:pfam15742 131 LELQQKLEHahKVCLTETCILEKKQLEEEIKEAQENEAKLKQQYQEEQQKRKLLDQNVNELQQQVRILQDKEAQLERTNS 210
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 304 ERKKKSAQERCQAEAEMDEIRKShqEELDRLRQLLKkarvstdqaaaEQLTLAQAELQSQWEaKCEQLLASArDEHLQQY 383
Cdd:pfam15742 211 QQQLRIQQQEAQLKQLENEKRKS--DEHLKSNQELS-----------EKLSSLQQEKEALQE-ELQQFLKQL-DVHVRKY 275
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*...
gi 1907156437 384 REVCAQRDAHQQKL-ALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQ 430
Cdd:pfam15742 276 NEKHHHHKAKLRRAkDRLLHEVEQRDERIKQLENEIRILQSQIEKEKA 323
PHA03247 PHA03247
large tegument protein UL36; Provisional
505-690 1.07e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.08  E-value: 1.07e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  505 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 584
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  585 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 662
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1907156437  663 PalDPESQGGEAQPPECKQAEDVSSS-GP 690
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
148-313 1.37e-04

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 45.00  E-value: 1.37e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 148 EEQNDKISDLIERNQRyvEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETE 227
Cdd:NF038025   42 DEVTAEKDDLLDELEN--EQEEEPETFTEQKEEEDKEDLEAILDELATEANKASAELDEVNAEIQGVKEEIKEKQEQLMV 119
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 228 LqlqltdNLKEtdllrghvtrlqaDLSELREaseqtqtkfksEKQSRRQ-LELKVTSLEEELTDLRAEKTSLEKNLSERK 306
Cdd:NF038025  120 L------DTKE-------------ELDELSE-----------EELAERQeLEAEIKQLEAQLDELEEEKEELEEELKTIR 169

                  ....*..
gi 1907156437 307 KKSAQER 313
Cdd:NF038025  170 KDQWSQT 176
PspC_subgroup_1 NF033838
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ...
122-560 9.68e-04

pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.


Pssm-ID: 411407 [Multi-domain]  Cd Length: 684  Bit Score: 42.69  E-value: 9.68e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 122 IMSNIQRIIQEnerlKQELLEKSSRIEEQ--NDKISDLierNQRYVEQSNLMMEKRNNSLQTAT-ENTQARILHAEQEKA 198
Cdd:NF033838   63 VESHLEKILSE----IQKSLDKRKHTQNValNKKLSDI---KTEYLYELNVLKEKSEAELTSKTkKELDAAFEQFKKDTL 135
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 199 KVTEELAAATAQVSHLQLKmtAHQKKETELQLQLTDNLK--ETDLLRGHVTRLQADLSELREASEQTQtkfksEKQSRRQ 276
Cdd:NF033838  136 EPGKKVAEATKKVEEAEKK--AKDQKEEDRRNYPTNTYKtlELEIAESDVEVKKAELELVKEEAKEPR-----DEEKIKQ 208
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 277 LELKVTSLEEELTDLRAEKTSLEKnlSERKKKSAQERCQAEAEMDEIRKSHQE------------ELDRLRQLLKKARvS 344
Cdd:NF033838  209 AKAKVESKKAEATRLEKIKTDREK--AEEEAKRRADAKLKEAVEKNVATSEQDkpkrrakrgvlgEPATPDKKENDAK-S 285
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 345 TDQAAAEQlTLAQAELqsqweaKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAqiaAFTEQKEHMQRL 424
Cdd:NF033838  286 SDSSVGEE-TLPSPSL------KPEKKVAEAEKKVEEAKKKAKDQKEEDRRNYPTNTYKTLELEI---AESDVKVKEAEL 355
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 425 EKTKSQAPAGRAaadpSEKVKKIMNQVfQSLRGEfeleesydgGTILRTIMHTIKMVTLQLLNHQEEEEEEEEEEEEEKK 504
Cdd:NF033838  356 ELVKEEAKEPRN----EEKIKQAKAKV-ESKKAE---------ATRLEKIKTDRKKAEEEAKRKAAEEDKVKEKPAEQPQ 421
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156437 505 PL---RPSLEQPGPATPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPENGAQ 560
Cdd:NF033838  422 PApapQPEKPAPKPEKPAEQPKAEKPADQQAEEDYARRSEEEYNRLTQQQPPKTEKPAQ 480
BREX_BrxC NF033441
BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, ...
246-447 6.77e-03

BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, from BREX (bacteriophage exclusion) systems of type 1.


Pssm-ID: 380283  Cd Length: 1173  Bit Score: 39.87  E-value: 6.77e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  246 VTRLQADLSELREAS--EQTQTKFKSEKQSRRQLELKVTSLEEELT--------DLRAEKTSLEKNLSERKKKSAQErcq 315
Cdd:NF033441   928 LEPALALLEEILSIKdnEEFLKALNKKEDDLLDLIEDWEDVKSFFEgdqlpiwdRALRLLKEYEDNLDYELDEEAEE--- 1004
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  316 AEAEMDEIRKSH---------QEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSqwEAKCEQLLASARDEHLQQYREv 386
Cdd:NF033441  1005 AIEELRSILADPdpysripdlPPLLEALREALREALEELREAALEAIEEAKAELEA--DLEWQELSDEQQNRLLAPFDE- 1081
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1907156437  387 CAQRDAHQQKLALLQDecLALQAQIAAFTEQKEHMQRL--EKTKSQAPAGRAAADPSEKVKKI 447
Cdd:NF033441  1082 LKERIEPEVSIASLRA--LLDQLADALLDRLLDRIEALiqRFQEEKAEPEVKEAAAEPPEPKV 1142
 
Name Accession Description Interval E-value
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
122-430 5.04e-17

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 85.92  E-value: 5.04e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  122 IMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVT 201
Cdd:COG1196    679 LEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEEL--------KRELAALEEELEQLQSRLEELEEELEELE 750
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  202 EELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 281
Cdd:COG1196    751 EELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEI 830
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  282 TSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIR------KSHQEELDRLRQLLKKARVSTDQaaAEQLTL 355
Cdd:COG1196    831 EELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEeledelKELEEEKEELEEELRELESELAE--LKEEIE 908
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1907156437  356 AQAELQSQWEAKCEQLLASARDEHLQQYRE-VCAQRDAHQQKLALLQDECLALQA-QIAAFTEQKEHMQRLEKTKSQ 430
Cdd:COG1196    909 KLRERLEELEAKLERLEVELPELEEELEEEyEDTLETELEREIERLEEEIEALGPvNLRAIEEYEEVEERYEELKSQ 985
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
134-430 2.23e-13

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 73.98  E-value: 2.23e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  134 ERLKQELLEKSSRIEEQNDKISDLIE---------RNQRYVEQSNLMMEKRNNSLQTATenTQARILHAEQEKAKVTEEL 204
Cdd:COG1196    171 KERKEEAERKLERTEENLERLEDLLEelekqleklERQAEKAERYQELKAELRELELAL--LLAKLKELRKELEELEEEL 248
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  205 AAATAQVSHLQLKMtahQKKETELQlQLTDNLKEtdlLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSL 284
Cdd:COG1196    249 SRLEEELEELQEEL---EEAEKEIE-ELKSELEE---LREELEELQEELLELKEEIEELEGEISLLRERLEELENELEEL 321
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  285 EEELTDLRAEKTSLEKNLSERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLLkKARVSTDQAAAEQLTLAQAELQSQW 364
Cdd:COG1196    322 EERLEELKEKIEALKEELEERETLLEELE-QLLAELEEAKEELEEKLSALLEEL-EELFEALREELAELEAELAEIRNEL 399
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156437  365 EAKCEQL--LASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQ-RLEKTKSQ 430
Cdd:COG1196    400 EELKREIesLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRdRLKELERE 468
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
134-402 4.26e-13

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 73.17  E-value: 4.26e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  134 ERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLM------MEKRNNSLQTATENTQARILHAEQEKAKVTEELAAA 207
Cdd:TIGR02168  235 EELREELEELQEELKEAEEELEELTAELQELEEKLEELrlevseLEEEIEELQKELYALANEISRLEQQKQILRERLANL 314
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  208 TAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEE 287
Cdd:TIGR02168  315 ERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQ 394
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  288 LTDLRAEKTSLEKNLS---ERKKKSAQERCQAEAEMDEIRKS-HQEELDRLRQLLKKArVSTDQAAAEQLTLAQAELqsq 363
Cdd:TIGR02168  395 IASLNNEIERLEARLErleDRRERLQQEIEELLKKLEEAELKeLQAELEELEEELEEL-QEELERLEEALEELREEL--- 470
                          250       260       270
                   ....*....|....*....|....*....|....*....
gi 1907156437  364 weAKCEQLLASARDEHLQqyrevcaqrdaHQQKLALLQD 402
Cdd:TIGR02168  471 --EEAEQALDAAERELAQ-----------LQARLDSLER 496
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
92-418 2.48e-12

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 70.87  E-value: 2.48e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437   92 LMTKVEELQKHSSgnsMLLPSMSV-TMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNL 170
Cdd:TIGR02169  693 LQSELRRIENRLD---ELSQELSDaSRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQEIENVKSELKELEARIEE 769
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  171 MMEKRNNsLQTATENTQARILHA-----EQEKAKVTEELAAATAQVSHLQLKMtahqkKETELQLQLTDNLKETdlLRGH 245
Cdd:TIGR02169  770 LEEDLHK-LEEALNDLEARLSHSripeiQAELSKLEEEVSRIEARLREIEQKL-----NRLTLEKEYLEKEIQE--LQEQ 841
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  246 VTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKsaqeRCQAEAEMDEIRK 325
Cdd:TIGR02169  842 RIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERK----IEELEAQIEKKRK 917
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  326 sHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQ-SQWEAKCEQLLASARD------EHLQQYREVCAQRDAHQQKLA 398
Cdd:TIGR02169  918 -RLSELKAKLEALEEELSEIEDPKGEDEEIPEEELSlEDVQAELQRVEEEIRAlepvnmLAIQEYEEVLKRLDELKEKRA 996
                          330       340
                   ....*....|....*....|
gi 1907156437  399 LLQDECLALQAQIAAFTEQK 418
Cdd:TIGR02169  997 KLEEERKAILERIEEYEKKK 1016
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
123-466 1.09e-11

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 68.59  E-value: 1.09e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  123 MSNIQRIiQENERLKQELLEkssRIEEQNDKISDLIERNQRYVEQSN-------LMMEKRNNSLQTATENTQARILHAEQ 195
Cdd:COG1196    178 ERKLERT-EENLERLEDLLE---ELEKQLEKLERQAEKAERYQELKAelrelelALLLAKLKELRKELEELEEELSRLEE 253
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  196 EKAKVTEELAAATAQVSHLQLKMTAHQKKETELQ---LQLTDNLKETD----LLRGHVTRLQADLSELREASEQTQTKFK 268
Cdd:COG1196    254 ELEELQEELEEAEKEIEELKSELEELREELEELQeelLELKEEIEELEgeisLLRERLEELENELEELEERLEELKEKIE 333
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  269 SEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRK----------SHQEELDRLRQLL 338
Cdd:COG1196    334 ALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFEALREELAELEAelaeirneleELKREIESLEERL 413
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  339 KKARVSTDQAAAEQLTLAQ--AELQSQWEAKCEQLlasarDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIaafte 416
Cdd:COG1196    414 ERLSERLEDLKEELKELEAelEELQTELEELNEEL-----EELEEQLEELRDRLKELERELAELQEELQRLEKEL----- 483
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|
gi 1907156437  417 qKEHMQRLEKTKSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFELEESYD 466
Cdd:COG1196    484 -SSLEARLDRLEAEQRASQGVRAVLEALESGLPGVYGPVAELIKVKEKYE 532
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
182-411 2.98e-11

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 67.39  E-value: 2.98e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  182 ATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASE 261
Cdd:TIGR02168  664 GSAKTNSSILERRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVE 743
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  262 QTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKN---LSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLL 338
Cdd:TIGR02168  744 QLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEieeLEAQIEQLKEELKALREALDELRAELTLLNEEAANLR 823
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  339 KKARVSTDQAAAEQLTLaqAELQSQWEAKCEQL---------LASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQA 409
Cdd:TIGR02168  824 ERLESLERRIAATERRL--EDLEEQIEELSEDIeslaaeieeLEELIEELESELEALLNERASLEEALALLRSELEELSE 901

                   ..
gi 1907156437  410 QI 411
Cdd:TIGR02168  902 EL 903
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
68-339 6.24e-10

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 62.77  E-value: 6.24e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437   68 MTEARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSvtMETSMIMSNIQRIIQENERLKQELLEKSSRI 147
Cdd:TIGR02168  686 IEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALR--KDLARLEAEVEQLEERIAQLSKELTELEAEI 763
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  148 EEQNDKISDL----------IERNQRYVEQSNLMMEK------------------------RNNSLQTATENTQARILHA 193
Cdd:TIGR02168  764 EELEERLEEAeeelaeaeaeIEELEAQIEQLKEELKAlrealdelraeltllneeaanlreRLESLERRIAATERRLEDL 843
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  194 EQEKAKVTEELAAATAQVSHLQLKMTahqkketELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQS 273
Cdd:TIGR02168  844 EEQIEELSEDIESLAAEIEELEELIE-------ELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRE 916
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907156437  274 RRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLK 339
Cdd:TIGR02168  917 LEELREKLAQLELRLEGLEVRIDNLQERLSEEYSLTLEEAEALENKIEDDEEEARRRLKRLENKIK 982
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
187-431 1.39e-09

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 61.65  E-value: 1.39e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  187 QARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTK 266
Cdd:COG1196    659 KRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSR 738
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  267 FKSEKQSRRQLELKVTSL-------EEELTDLRAEKTSLEknlsERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLK 339
Cdd:COG1196    739 LEELEEELEELEEELEELqerleelEEELESLEEALAKLK----EEIEELEEKRQALQEELEELEEELEEAERRLDALER 814
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  340 KARVSTDQAAAEQLTLAQAELQ-SQWEAKCEQL------LASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIa 412
Cdd:COG1196    815 ELESLEQRRERLEQEIEELEEEiEELEEKLDELeeeleeLEKELEELKEELEELEAEKEELEDELKELEEEKEELEEEL- 893
                          250
                   ....*....|....*....
gi 1907156437  413 afTEQKEHMQRLEKTKSQA 431
Cdd:COG1196    894 --RELESELAELKEEIEKL 910
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
120-430 1.81e-09

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 61.31  E-value: 1.81e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 120 SMIMSNIQRIIQENERLKQELLEKSSRIEEQndkISDLIERNQRYVEQSNLMME----KRNNSLQTATENTQARILHAEQ 195
Cdd:COG0419   170 EKLSELLKEVIKEAKAKIEELEGQLSELLED---IEDLLEALEEELKELKKLEEiqeeQEEEELEQEIEALEERLAELEE 246
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 196 EKaKVTEELAAATAQVSHLQLKMTAHQKKE----TELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQ---TKFK 268
Cdd:COG0419   247 EK-ERLEELKARLLEIESLELEALKIREEElrelERLLEELEEKIERLEELEREIEELEEELEGLRALLEELEellEKLK 325
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 269 SEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMD---EIRKSHQEELDRLRQLL--KKARV 343
Cdd:COG0419   326 SLEERLEKLEEKLEKLESELEELAEEKNELAKLLEERLKELEERLEELEKELEkalERLKQLEEAIQELKEELaeLSAAL 405
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 344 STDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRE--------------VCAQ--RDAHQQKLALLQDECL-A 406
Cdd:COG0419   406 EEIQEELEELEKELEELERELEELEEEIKKLEEQINQLESKElmiaelagagekcpVCGQelPEEHEKELLELYELELeE 485
                         330       340
                  ....*....|....*....|....
gi 1907156437 407 LQAQIAAFTEQKEHMQRLEKTKSQ 430
Cdd:COG0419   486 LEEELSREKEEAELREEIEELEKE 509
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
184-466 3.20e-09

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 60.46  E-value: 3.20e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  184 ENTQARILHAEQEKAKVTEELAAATAQVSHLQLkmtahQKKETELQLQLTDNLKETDLlrghvTRLQADLSELREASEQT 263
Cdd:TIGR02168  175 KETERKLERTRENLDRLEDILNELERQLKSLER-----QAEKAERYKELKAELRELEL-----ALLVLRLEELREELEEL 244
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  264 QTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKK-----SAQERCQAEAEMDEIRKSH----QEELDRL 334
Cdd:TIGR02168  245 QEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKElyalaNEISRLEQQKQILRERLANlerqLEELEAQ 324
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  335 RQLLKKARVsTDQAAAEQLTLAQAELQSQWEAKCEQL--LASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIA 412
Cdd:TIGR02168  325 LEELESKLD-ELAEELAELEEKLEELKEELESLEAELeeLEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIE 403
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 1907156437  413 AFTEQKEHMQ-RLEKTKSQAPAGRAAADPSEKvKKIMNQVFQSLRGEFELEESYD 466
Cdd:TIGR02168  404 RLEARLERLEdRRERLQQEIEELLKKLEEAEL-KELQAELEELEEELEELQEELE 457
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
127-359 6.32e-09

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 59.70  E-value: 6.32e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  127 QRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQtateNTQARILHAEQEKAKVTEELAA 206
Cdd:TIGR02169  272 QLLEELNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKERELEDAEERLA----KLEAEIDKLLAEIEELEREIEE 347
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  207 ATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEE 286
Cdd:TIGR02169  348 ERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELDRLQEELQRLSEELADLNA 427
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156437  287 ELTDLRAEKTSLE---KNLSERKKKSAQERCQAEAEMDEIRKSH---QEELDRLRQLLKKARVSTDQAAAEQLTLAQAE 359
Cdd:TIGR02169  428 AIAGIEAKINELEeekEDKALEIKKQEWKLEQLAADLSKYEQELydlKEEYDRVEKELSKLQRELAEAEAQARASEERV 506
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
193-588 1.58e-08

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 58.00  E-value: 1.58e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 193 AEQEKaKVTEELAAATAQVSHLQLK-MTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-----EASEQTQTK 266
Cdd:NF033930   85 AKKEK-KASEEEQKANLAVQKAYVKyRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRakvvpEAEELAETK 163
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 267 FKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSaqERCQAEAEMDEIrkshQEELDRLRQLLKKARVSTD 346
Cdd:NF033930  164 KKAEEAKAEEPVAKKKVDEAKKKVEEAKKKVEAEEAEIEKLQN--EEVALEAKIAEL----ENQVDNLEKELAEIDESDS 237
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 347 QAAAEQ---------LTLAQAELqSQWEAKCEQLLASARDEHLQQyrevcaQRDAHQQKLALLQDECLALQAQIAAFTEQ 417
Cdd:NF033930  238 EDYIKEglrapleseLDAKQAKL-AKKQTELEKLLDSLDPEGKTQ------DELDKEAAEEELSKKIDELDNEVAKLEKE 310
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 418 KEHMQRLEKtkSQAPAGRAAADPSEKVKKImnqvfqslrgefELEEsydggtilrtimhTIKMVTlQLLNHQEEEEEEEE 497
Cdd:NF033930  311 VSDLENSDN--NVADYYKEALEKDLATKKA------------ELEK-------------TQKDLD-KALNELGPDGDEEE 362
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 498 EEEEEKKPLRPSlEQPGPA----TPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPEngaqtrkgEPAEAEVPS 573
Cdd:NF033930  363 TPAPAPQPEQPA-PAPAPApkpeQPAPAPKPEKPADQQAEEDYARRSEEEYNRLTQQQPPKAE--------KPAPAPAPK 433
                         410
                  ....*....|....*
gi 1907156437 574 eikdsslPPQPAGIP 588
Cdd:NF033930  434 -------PEQPAPAP 441
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
76-300 4.49e-08

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 56.99  E-value: 4.49e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437   76 TEIRMAVNKVADKMDHLMTKVEELQKhssgnsmllpsmsvtmETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKIS 155
Cdd:TIGR02168  270 EELRLEVSELEEEIEELQKELYALAN----------------EISRLEQQKQILRERLANLERQLEELEAQLEELESKLD 333
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  156 DLIERNQRYVEQSNL--------------------MMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQ 215
Cdd:TIGR02168  334 ELAEELAELEEKLEElkeelesleaeleeleaeleELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEARLERLE 413
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  216 lkmtAHQKKETELQLQLTDNLKETDL--LRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRA 293
Cdd:TIGR02168  414 ----DRRERLQQEIEELLKKLEEAELkeLQAELEELEEELEELQEELERLEEALEELREELEEAEQALDAAERELAQLQA 489

                   ....*..
gi 1907156437  294 EKTSLEK 300
Cdd:TIGR02168  490 RLDSLER 496
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
121-450 7.44e-08

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 55.92  E-value: 7.44e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 121 MIMSNIQRIIQENERLKQeLLEKSSRIEEQNDKISDLIE-----RNQRYVEQSNLMMEKRNN--SLQTATENTQARILHA 193
Cdd:COG0419   309 GLRALLEELEELLEKLKS-LEERLEKLEEKLEKLESELEelaeeKNELAKLLEERLKELEERleELEKELEKALERLKQL 387
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 194 EQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQ---LQLTDNLKETDLLRGHVTRLQADLSELREASEQ-----TQT 265
Cdd:COG0419   388 EEAIQELKEELAELSAALEEIQEELEELEKELEELErelEELEEEIKKLEEQINQLESKELMIAELAGAGEKcpvcgQEL 467
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 266 KFKSEKQSRRQLELKVTSLEEELTdLRAEKTSLEKNLSERKKK---SAQERCQAEAEMDEIRKSHQEELDRLRQLLKKAR 342
Cdd:COG0419   468 PEEHEKELLELYELELEELEEELS-REKEEAELREEIEELEKElreLEEELIELLELEEALKEELEEKLEKLENLLEELE 546
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 343 VSTDQAAAEQLtlaQAELQSqweakCEQLLASARDEhLQQYREVCAQrdahQQKLALLQDECLALQAQIAAFTEQKEHMQ 422
Cdd:COG0419   547 ELKEKLQLQQL---KEELRQ-----LEDRLQELKEL-LEELRLLRTR----KEELEELRERLKELKKKLKELEERLSQLE 613
                         330       340
                  ....*....|....*....|....*...
gi 1907156437 423 RLEKTKSQAPAGRAAADPSEKVKKIMNQ 450
Cdd:COG0419   614 ELLQSLELSEAENELEEAEEELESELEK 641
PTZ00121 PTZ00121
MAEBL; Provisional
132-445 4.25e-07

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 53.99  E-value: 4.25e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  132 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATaqv 211
Cdd:PTZ00121  1312 EEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKKADAAKKKAE--- 1388
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  212 shlQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEqtqTKFKSEkQSRRQLELKVTSlEEELTDL 291
Cdd:PTZ00121  1389 ---EKKKADEAKKKAEEDKKKADELKKAAAAKKKADEAKKKAEEKKKADE---AKKKAE-EAKKADEAKKKA-EEAKKAE 1460
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  292 RAEKTSLEKNLSERKKKSAQERCQAE--AEMDEIRKSHQEELDRLRQLLKKA---RVSTDQAAAEQLTLAQAELQSQWEA 366
Cdd:PTZ00121  1461 EAKKKAEEAKKADEAKKKAEEAKKADeaKKKAEEAKKKADEAKKAAEAKKKAdeaKKAEEAKKADEAKKAEEAKKADEAK 1540
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  367 KCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK--EHMQRLEKTKSQAPAGRAAADPSEKV 444
Cdd:PTZ00121  1541 KAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEAriEEVMKLYEEEKKMKAEEAKKAEEAKI 1620

                   .
gi 1907156437  445 K 445
Cdd:PTZ00121  1621 K 1621
DUF4686 pfam15742
Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins ...
149-430 6.90e-07

Domain of unknown function (DUF4686); This family of proteins is found in eukaryotes. Proteins in this family are typically between 498 and 775 amino acids in length. There is a conserved DLK sequence motif.


Pssm-ID: 406229 [Multi-domain]  Cd Length: 384  Bit Score: 52.38  E-value: 6.90e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 149 EQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATA---QVSHLQLKMTAHQKKE 225
Cdd:pfam15742  53 LQEENIKIKAELKQ--AQQKLLDSTKMCSSLTAEWEHCQQKIRELELEVLKQAQSIKSQNSlqeKLAQEKSKVAEAEKKI 130
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 226 TELQLQLTD--NLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLS 303
Cdd:pfam15742 131 LELQQKLEHahKVCLTETCILEKKQLEEEIKEAQENEAKLKQQYQEEQQKRKLLDQNVNELQQQVRILQDKEAQLERTNS 210
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 304 ERKKKSAQERCQAEAEMDEIRKShqEELDRLRQLLKkarvstdqaaaEQLTLAQAELQSQWEaKCEQLLASArDEHLQQY 383
Cdd:pfam15742 211 QQQLRIQQQEAQLKQLENEKRKS--DEHLKSNQELS-----------EKLSSLQQEKEALQE-ELQQFLKQL-DVHVRKY 275
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*...
gi 1907156437 384 REVCAQRDAHQQKL-ALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQ 430
Cdd:pfam15742 276 NEKHHHHKAKLRRAkDRLLHEVEQRDERIKQLENEIRILQSQIEKEKA 323
PRK11281 PRK11281
mechanosensitive channel MscK;
193-440 1.20e-06

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 52.22  E-value: 1.20e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  193 AEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETE-LQLQLTDNLKETdllrghvTRLQADLSELReASEQTQTKFKSEK 271
Cdd:PRK11281    49 NKQKLLEAEDKLVQQDLEQTLALLDKIDRQKEETEqLKQQLAQAPAKL-------RQAQAELEALK-DDNDEETRETLST 120
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  272 QSRRQLELKVTSLEEELTDLRAEKTSLEKNLSerKKKSAQERCQAEaeMDEirksHQEELDRLRQLLKKARVSTDQAAAE 351
Cdd:PRK11281   121 LSLRQLESRLAQTLDQLQNAQNDLAEYNSQLV--SLQTQPERAQAA--LYA----NSQRLQQIRNLLKGGKVGGKALRPS 192
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  352 QLTLAQAELQSqWEAKCE---QLLASArdEHLQQYREvcAQRDAHQQKLALLQDECLALQAQIAA--FTEQKEHMQRLEk 426
Cdd:PRK11281   193 QRVLLQAEQAL-LNAQNDlqrKSLEGN--TQLQDLLQ--KQRDYLTARIQRLEHQLQLLQEAINSkrLTLSEKTVQEAQ- 266
                          250
                   ....*....|....
gi 1907156437  427 tkSQAPAGRAAADP 440
Cdd:PRK11281   267 --SQDEAARIQANP 278
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
184-464 2.49e-06

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 50.79  E-value: 2.49e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 184 ENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLtdnlketDLLRGHVTRLQADLSELREASEQT 263
Cdd:COG4372    77 DDIRPQLRALRTELGTAQGEKRAAETEREAARSELQKARQEREAVRQEL-------AAARQNLAKAQQELARLTKQAQDL 149
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 264 QTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKsaQERCQAEAEMDEIRKSHQEELDRLRQLLKKARV 343
Cdd:COG4372   150 QTRLKTLAEQRRQLEAQAQSLQASQKQLQASATQLKSQVLDLKLR--SAQIEQEAQNLATRANAAQARTEELARRAAAAQ 227
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 344 STDQAAAEQLTLAQAELQSqweakceqllASARDEHLQQyREVCAQRdaHQQKLALLQDECLALQAQIAAFTEQKEHMQR 423
Cdd:COG4372   228 QTAQAIQQRDAQISQKAQQ----------IAARAEQIRE-RERQLQR--LETAQARLEQEVAQLEAYYQAYVRLRQQAAA 294
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|...
gi 1907156437 424 LEKTKSQAPAGRAAADpSEKVKKIMNQVFQSLR--GEFELEES 464
Cdd:COG4372   295 TQRGQVLAGAAQRVAQ-AQAQAQAQAQLLSSANrpAALRLRRS 336
DUF5401 pfam17380
Family of unknown function (DUF5401); This is a family of unknown function found in ...
127-390 5.77e-06

Family of unknown function (DUF5401); This is a family of unknown function found in Chromadorea.


Pssm-ID: 375164 [Multi-domain]  Cd Length: 722  Bit Score: 49.74  E-value: 5.77e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 127 QRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEkRNNSLQTATENTQARilhaEQEKAKvTEELAA 206
Cdd:pfam17380 299 ERLRQEKEEKAREVERRRKLEEAEKARQAEMDRQAAIYAEQERMAME-RERELERIRQEERKR----ELERIR-QEEIAM 372
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 207 ATAQVSHLQ-LKMTAHQKK----------------ETELQLQLTDNLKETDLLRGHVTRL-QADLSELREASEQTQTKFK 268
Cdd:pfam17380 373 EISRMRELErLQMERQQKNervrqeleaarkvkilEEERQRKIQQQKVEMEQIRAEQEEArQREVRRLEEERAREMERVR 452
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 269 SEKQSRRQlelKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLKKARVSTDQA 348
Cdd:pfam17380 453 LEEQERQQ---QVERLRQQEEERKRKKLELEKEKRDRKRAEEQRRKILEKELEERKQAMIEE-ERKRKLLEKEMEERQKA 528
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|..
gi 1907156437 349 AAEQLTLAQAELQSQWEAKCEQllasaRDEHLQQYREVCAQR 390
Cdd:pfam17380 529 IYEEERRREAEEERRKQQEMEE-----RRRIQEQMRKATEER 565
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
124-369 6.36e-06

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 49.68  E-value: 6.36e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 124 SNIQRIIQENErlkQELLEKSSRIEEQNDKISDLIERnqryVEqsnlMMEKRNNSLqtatENTQARILHAEQEKAKVTEE 203
Cdd:PRK03918  189 ENIEELIKEKE---KELEEVLREINEISSELPELREE----LE----KLEKEVKEL----EELKEEIEELEKELESLEGS 253
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 204 LAAATAQVSHLQlKMTAHQKKETElqlQLTDNLKETDLLRGHVTRLQAdLSELREaseqtqtKFKSEKqsrRQLELKVTS 283
Cdd:PRK03918  254 KRKLEEKIRELE-ERIEELKKEIE---ELEEKVKELKELKEKAEEYIK-LSEFYE-------EYLDEL---REIEKRLSR 318
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 284 LEEELTDLRAEKTSLEKnLSERKKKSAQERCQAEAEMDEIRKSHqEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQ 363
Cdd:PRK03918  319 LEEEINGIEERIKELEE-KEERLEELKKKLKELEKRLEELEERH-ELYEEAKAKKEELERLKKRLTGLTPEKLEKELEEL 396

                  ....*.
gi 1907156437 364 WEAKCE 369
Cdd:PRK03918  397 EKAKEE 402
MukB COG3096
Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 ...
97-403 6.40e-06

Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 substr. MG1655 [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 225638 [Multi-domain]  Cd Length: 1480  Bit Score: 49.88  E-value: 6.40e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437   97 EELQKHSSGNSMLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIER---NQRYVEQSNLMME 173
Cdd:COG3096    314 RELAELNGAEGDLEADYQAASDHLNLVQTALRQQEKIERYQADLEELTIRLEEQNEVVEEANERqeeNEARAEAAELEVD 393
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  174 KRNNSL---QTATENTQARILHAEQ-----EKAKV---TEELAAATAQVSHLQLKmtAHQKKETELQLQLTDNLKETDL- 241
Cdd:COG3096    394 ELKSQLadyQQALDVQQTRAIQYQQaiaalERAKElchLPDLTADSAEEWLETFQ--AKEEEATEKLLSLEQKMSMAQAa 471
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  242 -------------LRGHVTRLQADLSE---LREASEQtqtkfKSEKQSRRQLELKVTSLEEELTDLRaEKTSLEKNLSER 305
Cdd:COG3096    472 hsqfeqayqlvvaIAGELARSEAWDVArelLREGPDQ-----RHLAEQVQPLRMRLSELEQRLRQQQ-SAERLLADFCKR 545
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  306 KKKSAQ------ERCQAEAEMDEIRKSHQEELDR---LRQLLK--KARVSTDQAAAEQLTLAQAELqSQWEAKCEQLLAS 374
Cdd:COG3096    546 QGKNLDaeeleaLHQELEALIESLSDSVSNAREQrmaLRQEQEqlQSRIQSLMQRAPVWLAAQNAL-EQLSEQSGEEFTD 624
                          330       340       350
                   ....*....|....*....|....*....|....*
gi 1907156437  375 ARD--EHLQQY----REVCAQRDAHQQKLALLQDE 403
Cdd:COG3096    625 SQDvtEYMQQLlereREATVERDELGARKNALDEE 659
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
122-329 8.32e-06

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 49.25  E-value: 8.32e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 122 IMSNIQRIIQENERLKQELLEkssrIEEQNDKISD-LIERNQRYVEQSNLMMEKRNNSLQTATENT------QARILHAE 194
Cdd:TIGR04523 202 LLSNLKKKIQKNKSLESQISE----LKKQNNQLKDnIEKKQQEINEKTTEISNTQTQLNQLKDEQNkikkqlSEKQKELE 277
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 195 QEKAKVTE-------------ELAAATAQVSHLQLK--MTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREA 259
Cdd:TIGR04523 278 QNNKKIKElekqlnqlkseisDLNNQKEQDWNKELKseLKNQEKKLEEIQNQISQNNKIISQLNEQISQLKKELTNSESE 357
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1907156437 260 SEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQ---AEAEMDEIRKSHQE 329
Cdd:TIGR04523 358 NSEKQRELEEKQNEIEKLKKENQSYKQEIKNLESQINDLESKIQNQEKLNQQKDEQikkLQQEKELLEKEIER 430
PTZ00121 PTZ00121
MAEBL; Provisional
134-359 8.70e-06

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 49.37  E-value: 8.70e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  134 ERLKQELLEKSSRIEEQNDKisdliernqRYVEQSNLMMEKRNNSLQTATENTQArilhaeqEKAKVTEELaaataQVSH 213
Cdd:PTZ00121  1544 EKKKADELKKAEELKKAEEK---------KKAEEAKKAEEDKNMALRKAEEAKKA-------EEARIEEVM-----KLYE 1602
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  214 LQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSE-------LREASEQT-----QTKFKSEKQSRRQLELKV 281
Cdd:PTZ00121  1603 EEKKMKAEEAKKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEekkkaeeLKKAEEENkikaaEEAKKAEEDKKKAEEAKK 1682
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156437  282 TSLEEELTDLRAEKTSLEKNLSER-KKKSAQERCQAEaemdEIRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAE 359
Cdd:PTZ00121  1683 AEEDEKKAAEALKKEAEEAKKAEElKKKEAEEKKKAE----ELKKAEEENKIKAEEAKKEAE--EDKKKAEEAKKDEEE 1755
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
118-333 1.30e-05

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 48.18  E-value: 1.30e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 118 ETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDL-----------IERNQRYVEQSN-LMMEKRNNSLQ----- 180
Cdd:COG4942    60 QRAKLEKQLKSLETEIASLEAQLIETADDLKKLRKQIADLnarlnalevqeREQRRRLAEQLAaLQRSGRNPPPAllvsp 139
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 181 ---TATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNlketdllrghvtrlQADLSELR 257
Cdd:COG4942   140 edaQRSVRLAIYYGALNPARAERIDALKATLKQLAAVRAEIAAEQAELTTLLSEQRAQ--------------QAKLAQLL 205
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907156437 258 EASEQTQTKFKSEKQSRRQlelkvtSLEEeltdLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDR 333
Cdd:COG4942   206 EERKKTLAQLNSELSADQK------KLEE----LRANESRLKNEIASAEAAAAKAREAAAAAEAAAARARAAEAKR 271
COG5022 COG5022
Myosin heavy chain [General function prediction only];
82-295 2.09e-05

Myosin heavy chain [General function prediction only];


Pssm-ID: 227355 [Multi-domain]  Cd Length: 1463  Bit Score: 48.15  E-value: 2.09e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437   82 VNKVADKMDHLMTKVEELQKHSSGNSML---LPSMSVTMETSM---IMSNIQRIIQ-ENERLKQELLEKSSRIEEQNDKI 154
Cdd:COG5022    894 ISSLKLVNLELESEIIELKKSLSSDLIEnleFKTELIARLKKLlnnIDLEEGPSIEyVKLPELNKLHEVESKLKETSEEY 973
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  155 SDLIERNQRYVEQSNLMMEKRNNSLQTATE-NTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLT 233
Cdd:COG5022    974 EDLLKKSTILVREGNKANSELKNFKKELAElSKQYGALQESTKQLKELPVEVAELQSASKIISSESTELSILKPLQKLKG 1053
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1907156437  234 DNLKEtdllrghVTRLQADLSELREASEQTQTKFKSEKQSRRQ--LELKVTSLEEELTDLRAEK 295
Cdd:COG5022   1054 LLLLE-------NNQLQARYKALKLRRENSLLDDKQLYQLESTenLLKTINVKDLEVTNRNLVK 1110
PRK11281 PRK11281
mechanosensitive channel MscK;
125-361 2.13e-05

mechanosensitive channel MscK;


Pssm-ID: 236892 [Multi-domain]  Cd Length: 1113  Bit Score: 47.98  E-value: 2.13e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  125 NIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERN-----QRYVEQSNLMMEKRNNSLQTATENTQarilhaeqekak 199
Cdd:PRK11281    74 KIDRQKEETEQLKQQLAQAPAKLRQAQAELEALKDDNdeetrETLSTLSLRQLESRLAQTLDQLQNAQ------------ 141
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  200 vtEELAAATAQVSHLQLK-------MTAHQKKETELQLQLTDNLKETDLLRG-HVTRLQADLS------ELREASEQTQT 265
Cdd:PRK11281   142 --NDLAEYNSQLVSLQTQperaqaaLYANSQRLQQIRNLLKGGKVGGKALRPsQRVLLQAEQAllnaqnDLQRKSLEGNT 219
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  266 KFKSEKQSRRQL-ELKVTSLEEELTDLRAEKTslEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVS 344
Cdd:PRK11281   220 QLQDLLQKQRDYlTARIQRLEHQLQLLQEAIN--SKRLTLSEKTVQEAQSQDEAARIQANPLVAQELEINLQLSQRLLKA 297
                          250
                   ....*....|....*..
gi 1907156437  345 TDQAAaeqlTLAQAELQ 361
Cdd:PRK11281   298 TEKLN----TLTQQNLR 310
Cast pfam10174
RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part ...
113-431 2.70e-05

RIM-binding protein of the cytomatrix active zone; This is a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion. The C-terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). The family also contains four coiled-coil domains.


Pssm-ID: 401982 [Multi-domain]  Cd Length: 765  Bit Score: 47.51  E-value: 2.70e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 113 MSVTMETSMIMSN-IQRIIQENERLKQELLEKSSRIEEQNDKISDlierNQRYVE---QSNLMMEKRNNSLQTATENTQA 188
Cdd:pfam10174 276 MEVYKSHSKFMKNkIDQLKQELSKKESELLALQTKLETLTNQNSD----CKQHIEvlkESLTAKEQRAAILQTEVDALRL 351
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 189 RILHAEQ---EKAK----VTEELAAATAQVSHLQ-------LKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQAD-- 252
Cdd:pfam10174 352 RLEEKESflnKKTKqlqdLTEEKSTLAGEIRDLKdmldvkeRKINVLQKKIENLQEQLRDKDKQLAGLKERVKSLQTDss 431
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 253 ------------LSE-------LREASEQTQTKFKSEKQSRRQlELKVtsLEEELTDLRAEKTSLEKNLSERKKKsAQER 313
Cdd:pfam10174 432 ntdtalttleeaLSEkeriierLKEQREREDRERLEELESLKK-ENKD--LKEKVSALQPELTEKESSLIDLKEH-ASSL 507
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 314 CQAEAEMDEIRKS-------HQEELDRLRQLLKKARVSTDQAAA-----EQLTLAQAELQSQWE--AKCEqllaSARDEH 379
Cdd:pfam10174 508 ASSGLKKDSKLKSleiaieqKKEECSKLENQLKKAHNAEEAVRTnpeinDRIRLLEQEVARYKEesGKAQ----AEVERL 583
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1907156437 380 LQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQA 431
Cdd:pfam10174 584 LGILREVENEKNDKDKKIAELESLTLRQMKEQNKKVANIKHKQQEEKKKGAQ 635
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
127-419 2.72e-05

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 47.83  E-value: 2.72e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  127 QRIIQENERLKQELLEKSSRIEEQNDKISDL---------IERNQRYVEQSNLMMEKRNNSLQTAT-ENTQARILHAEQE 196
Cdd:pfam12128  425 HQLEQQKLEFNEEQYLLESRLGELKLQLNQAtatpellenIEQNDERLERAQEAQEQANASVEAAQsELRQLRKRRDEAD 504
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  197 KA-----KVTEELAAATAQVsHLQLKMTAHQK-----------KETELQLQLTDNLKETDL----------------LRG 244
Cdd:pfam12128  505 EAlrranRRLEQLKQALQQL-ELQLSPQAGSLlhflrneapdwEQSIGKLISTELLHRTDLdpelvesssqelnlygVTL 583
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  245 HVTRLQADLS-----ELREASEQTQTKFKSEKQsrrqlelKVTSLEEELTDLRAEKTSLEKNLSERKkksaQERCQAEAE 319
Cdd:pfam12128  584 DLQRIDAPDYaaleeALRERLDQAEKALQAARD-------KQKAAEEQLVQLNKELEKLKREETEAA----RALKQARLT 652
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  320 MDEIRKSHQEELDRLRQLLKKARvstdQAAAEQLTLAQAEL------QSQWEAKCEQLLASARDEHLQQYREVCAQRDAh 393
Cdd:pfam12128  653 LGRLQDEKQSLKDKLQKALKARK----QQAETQLQTLDAQLkqllkkQQAALEEQKEQLRELRTEKQEKWQVVVGDLDA- 727
                          330       340
                   ....*....|....*....|....*.
gi 1907156437  394 qqKLALLQDECLALQAQIAAFTEQKE 419
Cdd:pfam12128  728 --QLALLSAAIAALRTQAKAQLKALE 751
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
125-341 3.12e-05

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 47.45  E-value: 3.12e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 125 NIQRIIQENERLKQELLE-KSSRIEEQNDKISDLIERNQRYVEQSNLMmEKRNNSLQTATEntqaRILHAEQEKAKVTEE 203
Cdd:COG0419   534 KLEKLENLLEELEELKEKlQLQQLKEELRQLEDRLQELKELLEELRLL-RTRKEELEELRE----RLKELKKKLKELEER 608
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 204 LAAATAQVSHLQLKMTAHQKKETELQLqlTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQsRRQLELKVTS 283
Cdd:COG0419   609 LSQLEELLQSLELSEAENELEEAEEEL--ESELEKLNLQAELEELLQAALEELEEKVEELEAEIRRELQ-RIENEEQLEE 685
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 1907156437 284 LEEELTDLRAEKTSLEKNLSERKKKsaQERCQAEAEMDEIRKSHQEELDRLRQLLKKA 341
Cdd:COG0419   686 KLEELEQLEEELEQLREELEELLKK--LGEIEQLIEELESRKAELEELKKELEKLEKA 741
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
194-430 3.68e-05

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 47.37  E-value: 3.68e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  194 EQEKAKVTEELAAATAQVSHLQLKmtahqkkETELQLQLtDNLKETdllRGHVTRLQADLSELR--EASEQTQTKFKSEK 271
Cdd:TIGR02169  169 DRKKEKALEELEEVEENIERLDLI-------IDEKRQQL-ERLRRE---REKAERYQALLKEKReyEGYELLKEKEALER 237
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  272 QsRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAE 351
Cdd:TIGR02169  238 Q-KEAIERQLASLEEELEKLTEEISELEKRLEEIEQLLEELNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKERE 316
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  352 QLTLA--QAELQSQWEAKCEQLLASARDehLQQYRevcAQRDAHQQKLALLQDECLALQAQI--------AAFTEQKEHM 421
Cdd:TIGR02169  317 LEDAEerLAKLEAEIDKLLAEIEELERE--IEEER---KRRDKLTEEYAELKEELEDLRAELeevdkefaETRDELKDYR 391

                   ....*....
gi 1907156437  422 QRLEKTKSQ 430
Cdd:TIGR02169  392 EKLEKLKRE 400
COG1579 COG1579
Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function ...
194-340 5.41e-05

Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function prediction only];


Pssm-ID: 224495 [Multi-domain]  Cd Length: 239  Bit Score: 45.43  E-value: 5.41e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 194 EQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTK--FKSEK 271
Cdd:COG1579    23 EPRIKEIRKALKKAKAELEALNKALEALEIELEDLENQVSQLESEIQEIRERIKRAEEKLSAVKDERELRALNieIQIAK 102
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156437 272 QSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKK 340
Cdd:COG1579   103 ERINSLEDELAELMEEIEKLEKEIEDLKERLERLEKNLAEAEARLEEEVAEIREEGQELSSKREELKEK 171
Macoilin pfam09726
Macoilin family; The Macoilin proteins has an N-terminal portion that is composed of 5 ...
209-418 7.15e-05

Macoilin family; The Macoilin proteins has an N-terminal portion that is composed of 5 trasnmembrane helices, followed by a C-terminal coiled-coil region. Macoilin is a highly conserved protein present in eukaryotes. Macoilin appears to be found in the ER and be involved in the function of neurons.


Pssm-ID: 401607  Cd Length: 664  Bit Score: 46.38  E-value: 7.15e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 209 AQVSHLQLKMTAHQKKETELQLQLtdnlketDLLRGHVTRLQADLSELREASEQTQTKFKS-------EKQSRRQLELKv 281
Cdd:pfam09726 396 QDIKKLKAELQASRQTEQELRSQI-------SSLTSLERSLKSELGQLRQENDLLQTKLHNavsakqkDKQTVQQLEKR- 467
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 282 tsLEEEltdlRAEKTSLEKNLSERKK-------KSAQERCQAEA---EMDEIRKSHQEELD-RLRQLLKKARVSTDQAAa 350
Cdd:pfam09726 468 --LKAE----QEARASAEKQLAEEKKrkkeeeaTAARAVALAAAsrgECTESLKQRKRELEsEIKKLTHDIKLKEEQIR- 540
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1907156437 351 eqltlaqaelqsQWEAKCEQllasardehLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK 418
Cdd:pfam09726 541 ------------ELEIKVQE---------LRKYKESEKDTEVLMSALSAMQDKNQHLENSLSAETRIK 587
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
79-430 7.22e-05

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 46.50  E-value: 7.22e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437   79 RMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMETSMimSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLI 158
Cdd:TIGR00618  179 TQLALMEFAKKKSLHGKAELLTLRSQLLTLCTPCMPDTYHERK--QVLEKELKHLREALQQTQQSHAYLTQKREAQEEQL 256
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  159 ERNQRYVEQSNLMMEKRNnsLQTATENTQARIlhaeqEKAKVTEELAAATAQVSHLQLKMtahQKKETELQLQLTDNLKE 238
Cdd:TIGR00618  257 KKQQLLKQLRARIEELRA--QEAVLEETQERI-----NRARKAAPLAAHIKAVTQIEQQA---QRIHTELQSKMRSRAKL 326
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  239 tdllRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVtsleeeltdLRAEKTSLEKNLSERKKKSAQERCQAEa 318
Cdd:TIGR00618  327 ----LMKRAAHVKQQSSIEEQRRLLQTLHSQEIHIRDAHEVAT---------SIREISCQQHTLTQHIHTLQQQKTTLT- 392
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  319 emdEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRevcaQRDAHQQKLA 398
Cdd:TIGR00618  393 ---QKLQSLCKELDILQREQATIDTRTSAFRDLQGQLAHAKKQQELQQRYAELCAAAITCTAQCEK----LEKIHLQESA 465
                          330       340       350
                   ....*....|....*....|....*....|....*..
gi 1907156437  399 LLQDECLALQAQIAAFTEQ-----KEHMQRLEKTKSQ 430
Cdd:TIGR00618  466 QSLKEREQQLQTKEQIHLQetrkkAVVLARLLELQEE 502
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
124-459 7.48e-05

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 46.21  E-value: 7.48e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 124 SNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTA---TENTQARILHAEQEKAKV 200
Cdd:PRK03918  324 NGIEERIKELEEKEERLEELKKKLKELEKRLEELEERHELYEEAKAKKEELERLKKRLTgltPEKLEKELEELEKAKEEI 403
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 201 TEELAAATAQVS------------------------------------------HLQLKMTAHQKKETELQL-QLTDNLK 237
Cdd:PRK03918  404 EEEISKITARIGelkkeikelkkaieelkkakgkcpvcgrelteehrkelleeyTAELKRIEKELKEIEEKErKLRKELR 483
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 238 ETDLLRGHVTRLQA------------------DLSELREASEQTQT-------------KFKSEKQSRRQLELKVTSLEE 286
Cdd:PRK03918  484 ELEKVLKKESELIKlkelaeqlkeleeklkkyNLEELEKKAEEYEKlkekliklkgeikSLKKELEKLEELKKKLAELEK 563
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 287 ELTDLRAEKTSLEKNLSERKKKSAQErcqAEAEMDEIRKSHQE---------ELDRLRQLLKKARVSTDQAAAEqLTLAQ 357
Cdd:PRK03918  564 KLDELEEELAELLKELEELGFESVEE---LEERLKELEPFYNEylelkdaekELEREEKELKKLEEELDKAFEE-LAETE 639
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 358 AELQSQwEAKCEQLLASARDEhlqQYREVcaqrdahQQKLALLQDECLALQAQIAAFTEQKEHMQR-LEKTKSQAPAGRA 436
Cdd:PRK03918  640 KRLEEL-RKELEELEKKYSEE---EYEEL-------REEYLELSRELAGLRAELEELEKRREEIKKtLEKLKEELEEREK 708
                         410       420
                  ....*....|....*....|...
gi 1907156437 437 AADPSEKVKKIMNQVfQSLRGEF 459
Cdd:PRK03918  709 AKKELEKLEKALERV-EELREKV 730
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
130-341 8.94e-05

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 46.21  E-value: 8.94e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 130 IQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLM---------MEKRNNSLQTATENTQARILHAEQEKAKV 200
Cdd:PRK03918  261 IRELEERIEELKKEIEELEEKVKELKELKEKAEEYIKLSEFYeeyldelreIEKRLSRLEEEINGIEERIKELEEKEERL 340
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 201 tEELaaataqvshlqlkmtahQKKETELQLQLTDnLKETDLLRGHVTRLQADLSELR-EASEQTQTKFKSEKQSrrqLEL 279
Cdd:PRK03918  341 -EEL-----------------KKKLKELEKRLEE-LEERHELYEEAKAKKEELERLKkRLTGLTPEKLEKELEE---LEK 398
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1907156437 280 KVTSLEEELTDLRAEKTSLEKNLSERKK-----KSAQERCQ------AEAEMDEIRKSHQEELDRLRQLLKKA 341
Cdd:PRK03918  399 AKEEIEEEISKITARIGELKKEIKELKKaieelKKAKGKCPvcgrelTEEHRKELLEEYTAELKRIEKELKEI 471
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
173-401 9.40e-05

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 45.79  E-value: 9.40e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 173 EKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQAD 252
Cdd:COG4372    94 QGEKRAAETEREAARSELQKARQEREAVRQELAAARQNLAKAQQELARLTKQAQDLQTRLKTLAEQRRQLEAQAQSLQAS 173
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 253 LSELREASEQTQT-----KFKSEKQSRRQLELK-----VTSLEEELTDLRAEKTSLEKNLSERKKKsAQERCQAEAEMDE 322
Cdd:COG4372   174 QKQLQASATQLKSqvldlKLRSAQIEQEAQNLAtranaAQARTEELARRAAAAQQTAQAIQQRDAQ-ISQKAQQIAARAE 252
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 323 IRKSHQEELDRLRQllKKARVSTDQAAAEQLTLAQAELQSQWEAKCE-QLLASA--RDEHLQQYREVCAQRDAHQQKLAL 399
Cdd:COG4372   253 QIRERERQLQRLET--AQARLEQEVAQLEAYYQAYVRLRQQAAATQRgQVLAGAaqRVAQAQAQAQAQAQLLSSANRPAA 330

                  ..
gi 1907156437 400 LQ 401
Cdd:COG4372   331 LR 332
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
135-431 1.03e-04

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 45.80  E-value: 1.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 135 RLKQELLEKSSRIEEQNDKIsdliERNQRYVEQSNLMM----EKRN--NSLQTATENTQARILHAEQEKAKVTEELAAAT 208
Cdd:PRK02224  210 GLESELAELDEEIERYEEQR----EQARETRDEADEVLeeheERREelETLEAEIEDLRETIAETEREREELAEEVRDLR 285
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 209 AQVSHLQ---------------------LKMTAHQKKETELQ-------LQLTDNLKETDLLRGHVTRLQADLSELREAS 260
Cdd:PRK02224  286 ERLEELEeerddllaeaglddadaeaveARREELEDRDEELRdrleecrVAAQAHNEEAESLREDADDLEERAEELREEA 365
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 261 EQTQTKFKSEKQSRRQLELKVTSLEEELTDLRaektsleknlsERKKKSAQERCQAEAEMDEIRkshqEELDRLRQLLKK 340
Cdd:PRK02224  366 AELESELEEAREAVEDRREEIEELEEEIEELR-----------ERFGDAPVDLGNAEDFLEELR----EERDELREREAE 430
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 341 ARVSTdQAAAEQLTLAQAELQSQWEAKCEQLLA-SARDEHLQQYREvcaQRDAHQQKLALLQDECLALQAQIAAFTEQKE 419
Cdd:PRK02224  431 LEATL-RTARERVEEAEALLEAGKCPECGQPVEgSPHVETIEEDRE---RVEELEAELEDLEEEVEEVEERLERAEDLVE 506
                         330
                  ....*....|..
gi 1907156437 420 HMQRLEKTKSQA 431
Cdd:PRK02224  507 AEDRIERLEERR 518
PHA03247 PHA03247
large tegument protein UL36; Provisional
505-690 1.07e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.08  E-value: 1.07e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  505 PLRPSLEQPGPATPGMPPAPPSGETQEAPEvlpeqvvgettPLPLQALPTPENGAQTrkgePAEAEVPSEIKDSSLPPQP 584
Cdd:PHA03247  2923 PPPPPQPQPPPPPPPRPQPPLAPTTDPAGA-----------GEPSGAVPQPWLGALV----PGRVAVPRFRVPQPAPSRE 2987
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  585 AGIPA-HRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNgllgeEHVREVATDGLLQGNSRRLSL-TPDPEKGEP 662
Cdd:PHA03247  2988 APASStPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPP-----DDTEDSDADSLFDSDSERSDLeALDPLPPEP 3062
                          170       180
                   ....*....|....*....|....*....
gi 1907156437  663 PalDPESQGGEAQPPECKQAEDVSSS-GP 690
Cdd:PHA03247  3063 H--DPFAHEPDPATPEAGARESPSSQfGP 3089
46 PHA02562
endonuclease subunit; Provisional
70-308 1.15e-04

endonuclease subunit; Provisional


Pssm-ID: 222878 [Multi-domain]  Cd Length: 562  Bit Score: 45.39  E-value: 1.15e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  70 EARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMetsmiMSNIQRIIQENERLKQELLEKSSRIEE 149
Cdd:PHA02562  178 ELNQQIQTLDMKIDHIQQQIKTYNKNIEEQRKKNGENIARKQNKYDEL-----VEEAKTIKAEIEELTDELLNLVMDIED 252
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 150 QNDKISDLierNQRYVEQSNLM--------MEKRNNSLQTATENtqariLHAEQEK-AKVTEELAAATAQVShlqlKMTA 220
Cdd:PHA02562  253 PSAALNKL---NTAAAKIKSKIeqfqkvikMYEKGGVCPTCTQQ-----ISEGPDRiTKIKDKLKELQHSLE----KLDT 320
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 221 HQKKETELQLQLTDNLKEtdllrghVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEK 300
Cdd:PHA02562  321 AIDELEEIMDEFNEQSKK-------LLELKNKISTNKQSLITLVDKAKKVKAAIEELQAEFVDNAEELAKLQDELDKIVK 393

                  ....*...
gi 1907156437 301 NLSERKKK 308
Cdd:PHA02562  394 TKSELVKE 401
DUF812 pfam05667
Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of ...
132-423 1.35e-04

Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of unknown function.


Pssm-ID: 398992 [Multi-domain]  Cd Length: 590  Bit Score: 45.39  E-value: 1.35e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 132 ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLmmekrnnslqtATENTQARILHAEQEKAKVTEEL-AAATAQ 210
Cdd:pfam05667 223 EEEWNSQGLASRLTPEEYRKRKRTKLLKRIAEQLRSAAL-----------ASTEATSGASRSAQDLAELLSSFgGSSTTD 291
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 211 VSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTD 290
Cdd:pfam05667 292 TNLTKGSRFTHTEKLQFTNEAAASPPSKAETEEELQQQREEELEELQEQLEDLESSIEELEKEIKKLESSIKQVEEELEE 371
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 291 LRAEKTSLEKNLsERKKKSAQERCQAEAEMDEirkshqeeldrlrqlLKKARvstdQAAAEQLtlaqAELQSQWEAKCEQ 370
Cdd:pfam05667 372 LKEQNEELEKQY-KVKKKTLDLLPDAEENIAK---------------LQAVV----EASAQRL----VELAGQWEKHRVP 427
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 1907156437 371 LLasardEHLQQYREVCAQR-DAHQQKLA---LLQDECLalqaQIAAFTEQKEHMQR 423
Cdd:pfam05667 428 LI-----EEYRALKEAKSNKeSESQRKLEeikELREKIK----EVAEEARSKEELYK 475
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
148-313 1.37e-04

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 45.00  E-value: 1.37e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 148 EEQNDKISDLIERNQRyvEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETE 227
Cdd:NF038025   42 DEVTAEKDDLLDELEN--EQEEEPETFTEQKEEEDKEDLEAILDELATEANKASAELDEVNAEIQGVKEEIKEKQEQLMV 119
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 228 LqlqltdNLKEtdllrghvtrlqaDLSELREaseqtqtkfksEKQSRRQ-LELKVTSLEEELTDLRAEKTSLEKNLSERK 306
Cdd:NF038025  120 L------DTKE-------------ELDELSE-----------EELAERQeLEAEIKQLEAQLDELEEEKEELEEELKTIR 169

                  ....*..
gi 1907156437 307 KKSAQER 313
Cdd:NF038025  170 KDQWSQT 176
EzrA COG4477
Septation ring formation regulator EzrA [Cell cycle control, cell division, chromosome ...
147-343 1.74e-04

Septation ring formation regulator EzrA [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 226883 [Multi-domain]  Cd Length: 570  Bit Score: 45.06  E-value: 1.74e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 147 IEEQNDKISDLIERNQryVEQSNLMMEKRNNSLQTATENTQA--RILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKK 224
Cdd:COG4477   253 IDSRLERLKEQLVENS--ELLTQLELDEAEEELGLIQEKIESlyDLLEREVEAKNVVEENLPILPDYLEKAKENNEHLKE 330
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 225 ETELqLQLTDNLKETDLlrGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSE 304
Cdd:COG4477   331 EIER-VKESYRLAETEL--GSVRKFEKELKELESVLDEILENIEAQEVAYSELQDNLEEIEKALTDIEDEQEKVQEHLTS 407
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1907156437 305 RKKKSAQERcqaeaemdEIRKSHQEELDRLRQLLKKARV 343
Cdd:COG4477   408 LRKDELEAR--------ENLERLKSKLHEIKRYMEKSNL 438
PTZ00121 PTZ00121
MAEBL; Provisional
134-446 1.78e-04

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 45.13  E-value: 1.78e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  134 ERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMME--KRNNSLQTATENTQARILHAEQEKAKvTEELAAATAQV 211
Cdd:PTZ00121  1468 EAKKADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEakKKADEAKKAEEAKKADEAKKAEEAKK-ADEAKKAEEKK 1546
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  212 SHLQLKMTAHQKKETELQLQLTDNLKETDllRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKvtslEEELTDL 291
Cdd:PTZ00121  1547 KADELKKAEELKKAEEKKKAEEAKKAEED--KNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAK----KAEEAKI 1620
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  292 RAEKtsLEKNLSERKKKSAQERCQAEA--EMDEIRKSHQEELDRLRQLLKKARvsTDQAAAEQLTLAQAELQSQWEAKCE 369
Cdd:PTZ00121  1621 KAEE--LKKAEEEKKKVEQLKKKEAEEkkKAEELKKAEEENKIKAAEEAKKAE--EDKKKAEEAKKAEEDEKKAAEALKK 1696
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1907156437  370 QLLASARDEHLQQYREVcAQRDAHQQKLAllqDECLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADPSEKVKK 446
Cdd:PTZ00121  1697 EAEEAKKAEELKKKEAE-EKKKAEELKKA---EEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKK 1769
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
68-353 1.78e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 45.09  E-value: 1.78e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437   68 MTEARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLpsMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRI 147
Cdd:COG1196    760 LEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEEL--EEAERRLDALERELESLEQRRERLEQEIEELEEEI 837
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  148 EEQNDKISDLiernqryveqsnlmmEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETE 227
Cdd:COG1196    838 EELEEKLDEL---------------EEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAE 902
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  228 LQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTsLEKNLSERKK 307
Cdd:COG1196    903 LKEEIEKLRERLEELEAKLERLEVELPELEEELEEEYEDTLETELEREIERLEEEIEALGPVNLRAIEE-YEEVEERYEE 981
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*.
gi 1907156437  308 KSAQercqaEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQL 353
Cdd:COG1196    982 LKSQ-----REDLEEAKEKLLEVIEELDKEKRERFKETFDKINENF 1022
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
120-372 1.80e-04

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316 [Multi-domain]  Cd Length: 745  Bit Score: 45.01  E-value: 1.80e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 120 SMIMSNIQRIIQENER---LKQEL-------LEKSSRIEEQNDKISDLIERNQRYVEQS-NLMMEKR--NNSLQTATE-- 184
Cdd:TIGR04523 328 NQISQNNKIISQLNEQisqLKKELtnsesenSEKQRELEEKQNEIEKLKKENQSYKQEIkNLESQINdlESKIQNQEKln 407
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 185 -NTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQT 263
Cdd:TIGR04523 408 qQKDEQIKKLQQEKELLEKEIERLKETIIKNNSEIKDLTNQDSVKELIIKNLDNTRESLETQLKVLSRSINKIKQNLEQK 487
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 264 QTKFKSE-------KQSRRQLELKV-------TSLEEELTDLRAEKTSLEKNLSERKKK-----SAQERCQAEAEMDEIr 324
Cdd:TIGR04523 488 QKELKSKekelkklNEEKKELEEKVkdltkkiSSLKEKIEKLESEKKEKESKISDLEDElnkddFELKKENLEKEIDEK- 566
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|
gi 1907156437 325 kshQEELDRLRQLLKKARVSTDQAA--AEQLTLAQAELQSQWEAKCEQLL 372
Cdd:TIGR04523 567 ---NKEIEELKQTQKSLKKKQEEKQelIDQKEKEKKDLIKEIEEKEKKIS 613
MscS_porin pfam12795
Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part ...
220-413 2.24e-04

Mechanosensitive ion channel porin domain; The small mechanosensitive channel, MscS, is a part of the turgor-driven solute efflux system that protects bacteria from lysis in the event of osmotic shock. The MscS protein alone is sufficient to form a functional mechanosensitive channel gated directly by tension in the lipid bilayer. The MscS proteins are heptamers of three transmembrane subunits with seven converging M3 domains, and this MscS_porin is towards the N-terminal of the molecules. The high concentration of negative charges at the extracellular entrance of the pore helps select the cations for efflux.


Pssm-ID: 403869 [Multi-domain]  Cd Length: 235  Bit Score: 43.43  E-value: 2.24e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 220 AHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSElreaseqtQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLE 299
Cdd:pfam12795  34 KSKQRAAQYQKALDDAPAELRELRQELAALQAKAEA--------APKEILASLSLEELEQRLLQTSSQLQELQEQLAQLN 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 300 KNLSERKKKSAQercqAEAEMDEIRkshqEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQW----EAKCEQLLASA 375
Cdd:pfam12795 106 SQLIELQTRPER----AQQQLSEAR----QRLQQIRNQLNGLAAAGEPLSEAQRWLLQAELAALKaqidMLEQELLSNNN 177
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 1907156437 376 RDEHLQqyrevcAQRDAHQQKLALLQDECLALQAQIAA 413
Cdd:pfam12795 178 RQDLLQ------AQRDLLTLRIARLEQQLQALQELLNE 209
EmrA COG1566
Multidrug resistance efflux pump [Defense mechanisms];
315-434 2.37e-04

Multidrug resistance efflux pump [Defense mechanisms];


Pssm-ID: 224482 [Multi-domain]  Cd Length: 352  Bit Score: 43.86  E-value: 2.37e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 315 QAEAEMDEIRKshqeELDRLRQLLKKARVSTDQAAAEQLTLAQAELQ-----SQWEAKCEQLLASARDEHLQQYREVCAQ 389
Cdd:COG1566    95 QAEAALAAAEA----QLRNLRAQLASAQALIAQAEAQDLDQAQNELErraelAQRGVVSREELDRARAALQAAEAALAAA 170
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 1907156437 390 RDAHQQKLALLQDECLALQAQIAAFTEQKEHMQR-LEKTKSQAPAG 434
Cdd:COG1566   171 QAAQKQNLALLESEVSGAQAQVASAEAALDQAKLdLERTVIRAPVD 216
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
154-369 2.51e-04

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 44.78  E-value: 2.51e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  154 ISDLIERNQRYvEQSNLMMEK-------RNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKET 226
Cdd:pfam01576  189 ISDLEDRLKKE-EKGRQELEKakrkldgESTDLQEQIAELQAQIEELRAQLAKKEEELQAALARLEEEGAQKNNALKKLR 267
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  227 ELQLQLTDnlketdllrghvtrLQADLSELREASEqtqtkfKSEKQSR---RQLELKVTSLEEELTDLRAE---KTSLEK 300
Cdd:pfam01576  268 ELQAQIAE--------------LQEDLESERAARA------KAEKQRRdlgEELEALKTELEDTLDSTAAQqelRSKREQ 327
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1907156437  301 NLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVS------TDQAAAEQLTLAQAELQSQWEAKCE 369
Cdd:pfam01576  328 EVTELKKALEEETRSHEAQLQEMRQKHTQALEELSEQLEQAKRNkanlekAKQALESENNELQAELKTLQQAKQD 402
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
167-398 2.53e-04

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 44.33  E-value: 2.53e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 167 QSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHV 246
Cdd:COG4942    31 FSAAADDKQLKQIQKEIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADDLKKLRKQIADLNARLNALEVQE 110
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 247 TRLQADLSELREASEQTQTKFK-----SEKQSRRQLELKVtsLEEELTDLRAEKT-SLEKNLSE---RKKKSAQERCQAE 317
Cdd:COG4942   111 REQRRRLAEQLAALQRSGRNPPpallvSPEDAQRSVRLAI--YYGALNPARAERIdALKATLKQlaaVRAEIAAEQAELT 188
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 318 AEMDEiRKSHQEELDRLRQLLKKARVSTDQA-AAEQLTLAqaELQSQwEAKCEQLLASARDEHLQQYREVCAQRDAHQQK 396
Cdd:COG4942   189 TLLSE-QRAQQAKLAQLLEERKKTLAQLNSElSADQKKLE--ELRAN-ESRLKNEIASAEAAAAKAREAAAAAEAAAARA 264

                  ..
gi 1907156437 397 LA 398
Cdd:COG4942   265 RA 266
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
222-512 2.86e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 44.29  E-value: 2.86e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  222 QKKETELQLQLTDNLKETDLLRGHVTRLQadlSELREASEQTqtkfkSEKQSRRQ-LELKVTSLEEELTDL--------- 291
Cdd:TIGR02169  680 RERLEGLKRELSSLQSELRRIENRLDELS---QELSDASRKI-----GEIEKEIEqLEQEEEKLKERLEELeedlssleq 751
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  292 -----RAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEqltlAQAELQSqwEA 366
Cdd:TIGR02169  752 eienvKSELKELEARIEELEEDLHKLEEALNDLEARLSHSRIPEIQAELSKLEEEVSRIEARLRE----IEQKLNR--LT 825
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  367 KCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAaftEQKEHMQRLEKTKSqapagraaaDPSEKVKK 446
Cdd:TIGR02169  826 LEKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELE---ELEAALRDLESRLG---------DLKKERDE 893
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907156437  447 IMNQVFQSLRGEFELEESYDggtILRTIMHTIKmVTLQLLNHQEEEEEEEEEEEEEKKPLRPSLEQ 512
Cdd:TIGR02169  894 LEAQLRELERKIEELEAQIE---KKRKRLSELK-AKLEALEEELSEIEDPKGEDEEIPEEELSLED 955
YhaN COG4717
Uncharacterized protein YhaN, contains AAA domain [Function unknown];
129-401 3.69e-04

Uncharacterized protein YhaN, contains AAA domain [Function unknown];


Pssm-ID: 227061 [Multi-domain]  Cd Length: 984  Bit Score: 44.06  E-value: 3.69e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 129 IIQENERLKQELLEkSSRIEEQNDKIS---DLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELA 205
Cdd:COG4717   538 ITDELPELAVDLLV-QSRIRQHWQQLRkalDQLEAAYEALEGRFAAAEAAMAEWQSEWEEALDELGLSRELSPEQQLDIL 616
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 206 AATAQVSHLQlkmtahqKKETELQLQLTDNLKETDLLRGHVTRL----QADLSELREASEQTQTKFKSEKQS---RRQLE 278
Cdd:COG4717   617 STMKDLKKLM-------QKKAELTHQVARLREEQAAFEERVEGLlavlEAQFIDLSTLFCVQRLRVAAELQKeeaRLALE 689
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 279 LKVTSLEEELTDLRAEktsLEKNlseRKKKSAQERCQAEAEMDEIRKSHQEElDRLRQLLKKARVSTDQ---AAAEQLTL 355
Cdd:COG4717   690 GNIERTKELNDELRAE---LELH---RKEILDLFDCGTADTEDAFREAAREE-QQLTQRESRLESLEAQlegVAAEAYEL 762
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 1907156437 356 AQAELQSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQ 401
Cdd:COG4717   763 SASLDQRELKEEELALLEEAIDALDEEVEELHAQVAALSRQIAQLE 808
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
190-442 5.28e-04

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 43.17  E-value: 5.28e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 190 ILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELR-EASEQTQTKFK 268
Cdd:COG4942    26 VLAAAFSAAADDKQLKQIQKEIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADDLKKLRkQIADLNARLNA 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 269 SEKQSRRQLELkvtsLEEELTDLR--AEKTSLEKNLSErkkKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTD 346
Cdd:COG4942   106 LEVQEREQRRR----LAEQLAALQrsGRNPPPALLVSP---EDAQRSVRLAIYYGALNPARAERIDALKATLKQLAAVRA 178
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 347 QAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYRevcAQRDAHQQKLALLQDECLALQAQIAafteqkehmqRLEK 426
Cdd:COG4942   179 EIAAEQAELTTLLSEQRAQQAKLAQLLEERKKTLAQLN---SELSADQKKLEELRANESRLKNEIA----------SAEA 245
                         250
                  ....*....|....*.
gi 1907156437 427 TKSQAPAGRAAADPSE 442
Cdd:COG4942   246 AAAKAREAAAAAEAAA 261
mukB PRK04863
chromosome partition protein MukB;
202-442 5.45e-04

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 43.41  E-value: 5.45e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  202 EELAAATAQVSHLQLKMTAHQKKETELQLQLtDNLKET-DLLRGHVTR--------LQADLSELREASEQTQTKFKSEKQ 272
Cdd:PRK04863   837 AELRQLNRRRVELERALADHESQEQQQRSQL-EQAKEGlSALNRLLPRlnlladetLADRVEEIREQLDEAEEAKRFVQQ 915
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  273 SRRQLELkvtsLEEELTDLRAEktsleknlserkkksaqercqaEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAA--- 349
Cdd:PRK04863   916 HGNALAQ----LEPIVSVLQSD----------------------PEQFEQLKQDYQQAQQTQRDAKQQAFALTEVVQrra 969
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  350 ------AEQLTLAQAELQSQWEAKCEQlLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFteqkehMQR 423
Cdd:PRK04863   970 hfsyedAAEMLAKNSDLNEKLRQRLEQ-AEQERTRAREQLRQAQAQLAQYNQVLASLKSSYDAKRQMLQEL------KQE 1042
                          250       260
                   ....*....|....*....|..
gi 1907156437  424 LEKTKSQAPAG---RAAADPSE 442
Cdd:PRK04863  1043 LQDLGVPADSGaeeRARARRDE 1064
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
137-431 5.71e-04

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 43.57  E-value: 5.71e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  137 KQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTE---ELAAATAQVSH 213
Cdd:pfam15921  456 KNESLEKVSSLTAQLESTKEMLRKVVEELTAKKMTLESSERTVSDLTASLQEKERAIEATNAEITKlrsRVDLKLQELQH 535
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  214 LQLKMTAHQKKETE---LQLQLTDNLKETDLLRGHVTRLQADLSEL-REASEQTQTKFKSEKQ-SRRQLEL--------- 279
Cdd:pfam15921  536 LKNEGDHLRNVQTEceaLKLQMAEKDKVIEILRQQIENMTQLVGQHgRTAGAMQVEKAQLEKEiNDRRLELqefkilkdk 615
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  280 ---KVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQE--ELDRLRQLLKKarvsTDQAAAEQLT 354
Cdd:pfam15921  616 kdaKIRELEARVSDLELEKVKLVNAGSERLRAVKDIKQERDQLLNEVKTSRNElnSLSEDYEVLKR----NFRNKSEEME 691
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  355 LAQAELQSQweakceqlLASARDEhLQQYREVCAQ---RDAHQQKLAL-LQDECLALQAQIAAFTEQkehMQRLEKTKSQ 430
Cdd:pfam15921  692 TTTNKLKMQ--------LKSAQSE-LEQTRNTLKSmegSDGHAMKVAMgMQKQITAKRGQIDALQSK---IQFLEEAMTN 759

                   .
gi 1907156437  431 A 431
Cdd:pfam15921  760 A 760
COG4913 COG4913
Uncharacterized protein, contains a C-terminal ATPase domain [Function unknown];
207-402 6.37e-04

Uncharacterized protein, contains a C-terminal ATPase domain [Function unknown];


Pssm-ID: 227250 [Multi-domain]  Cd Length: 1104  Bit Score: 43.47  E-value: 6.37e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  207 ATAQVSHLQLKMTAHQKKET-ELQLQLTDNLkeTDLLRGHVTRLQA--DLSELREASEQTQTKFKSEKQSRR-------- 275
Cdd:COG4913    234 AKTAVEQFQDLEGAYEQVEDiKRQIHTLDPL--VQLKNRREKAQQSkdHANALKKALPTVGNRIKKEEQETLvrqftveq 311
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  276 -QLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLT 354
Cdd:COG4913    312 tQAKSKVESAKIETDRAREMETLAHDNVKQIVGAQHGILSAKREGAVDKRRTISTARAGLDALVKGLGGAAPESAEELLE 391
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*...
gi 1907156437  355 LAQAELQSqweakCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQD 402
Cdd:COG4913    392 LNNAARLT-----VDEYPAAREALESAGQRNVEDRTRAVDEFKAADQE 434
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
201-439 6.98e-04

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 43.21  E-value: 6.98e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  201 TEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKE--------TDLLRGHVTRLQADLSELREASEQTQTKFKS-EK 271
Cdd:pfam12128  249 FEQLESLELKLSLLHVELKADELRIATEQEERQELKNElksqlrtlEDELAEKIDELNGRLSAADAALAAKRSELEAlDD 328
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  272 QSRRQLELKVTSLEEELTDLRAEKTSLEkNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAE 351
Cdd:pfam12128  329 QKGAFQDDDIETLAADQEQLPSIQSELE-EVEERLDALTGNHQDVTQKYERLKQKISEELNRDLSGNKERLAKIREAKDR 407
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  352 QLTLAQAELQ---SQWEAKCEQLLASARDEhlQQYREVCAQRDAHQQKLALLQDEclaLQAQIAAFTEQKEHMQR----L 424
Cdd:pfam12128  408 QLAAIEEVLQaleSQLRHQLEQQKLEFNEE--QYLLESRLGELKLQLNQATATPE---LLENIEQNDERLERAQEaqeqA 482
                          250
                   ....*....|....*
gi 1907156437  425 EKTKSQAPAGRAAAD 439
Cdd:pfam12128  483 NASVEAAQSELRQLR 497
PspC_subgroup_1 NF033838
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ...
122-560 9.68e-04

pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.


Pssm-ID: 411407 [Multi-domain]  Cd Length: 684  Bit Score: 42.69  E-value: 9.68e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 122 IMSNIQRIIQEnerlKQELLEKSSRIEEQ--NDKISDLierNQRYVEQSNLMMEKRNNSLQTAT-ENTQARILHAEQEKA 198
Cdd:NF033838   63 VESHLEKILSE----IQKSLDKRKHTQNValNKKLSDI---KTEYLYELNVLKEKSEAELTSKTkKELDAAFEQFKKDTL 135
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 199 KVTEELAAATAQVSHLQLKmtAHQKKETELQLQLTDNLK--ETDLLRGHVTRLQADLSELREASEQTQtkfksEKQSRRQ 276
Cdd:NF033838  136 EPGKKVAEATKKVEEAEKK--AKDQKEEDRRNYPTNTYKtlELEIAESDVEVKKAELELVKEEAKEPR-----DEEKIKQ 208
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 277 LELKVTSLEEELTDLRAEKTSLEKnlSERKKKSAQERCQAEAEMDEIRKSHQE------------ELDRLRQLLKKARvS 344
Cdd:NF033838  209 AKAKVESKKAEATRLEKIKTDREK--AEEEAKRRADAKLKEAVEKNVATSEQDkpkrrakrgvlgEPATPDKKENDAK-S 285
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 345 TDQAAAEQlTLAQAELqsqweaKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAqiaAFTEQKEHMQRL 424
Cdd:NF033838  286 SDSSVGEE-TLPSPSL------KPEKKVAEAEKKVEEAKKKAKDQKEEDRRNYPTNTYKTLELEI---AESDVKVKEAEL 355
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 425 EKTKSQAPAGRAaadpSEKVKKIMNQVfQSLRGEfeleesydgGTILRTIMHTIKMVTLQLLNHQEEEEEEEEEEEEEKK 504
Cdd:NF033838  356 ELVKEEAKEPRN----EEKIKQAKAKV-ESKKAE---------ATRLEKIKTDRKKAEEEAKRKAAEEDKVKEKPAEQPQ 421
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156437 505 PL---RPSLEQPGPATPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPENGAQ 560
Cdd:NF033838  422 PApapQPEKPAPKPEKPAEQPKAEKPADQQAEEDYARRSEEEYNRLTQQQPPKTEKPAQ 480
CAGE1 pfam15066
Cancer-associated gene protein 1 family; CAGE-1 is a family of proteins overexpressed in tumor ...
147-313 1.26e-03

Cancer-associated gene protein 1 family; CAGE-1 is a family of proteins overexpressed in tumor tissues compared with surrounding tissues. CAGE-1 gene showed testis-specific expression among normal tissues and displayed wide expression in a variety of cancer cell lines and cancer tissues. CAGE-1 is predominantly expressed during post-meiotic stages. It localizes to the acrosomal matrix and acrosomal granule showing it to be a component of the acrosome of mammalian spermatids and spermatozoa.


Pssm-ID: 405712  Cd Length: 528  Bit Score: 42.12  E-value: 1.26e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 147 IEEQNDKISDLIErnqryvEQSNLMMEKR--NNSLQTATE---NTQARILHAEQEKAKVTEELAAATAQVSHLQLK-MTA 220
Cdd:pfam15066 365 INKLKENVEELIE------DKYNVILEKNdiNKTLQNLQEilaNTQKHLQESRKEKETLQLELKKIKVNYVHLQERyITE 438
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 221 HQKKETE----LQLQLTDNLKEtdllrGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELkvtSLEEELTdlRAEKt 296
Cdd:pfam15066 439 MQQKNKSvsqcLEMDKTLSKKE-----EEVERLQQLKGELEKATTSALDLLKREKETREQEFL---SLQEEFQ--KHEK- 507
                         170
                  ....*....|....*...
gi 1907156437 297 sleKNLSERKK-KSAQER 313
Cdd:pfam15066 508 ---ENLEERQKlKSRLEK 522
HMMR_N pfam15905
Hyaluronan mediated motility receptor N-terminal; HMMR_N is the N-terminal region of ...
157-385 1.39e-03

Hyaluronan mediated motility receptor N-terminal; HMMR_N is the N-terminal region of eukaryotic hyaluronan-mediated motility receptor proteins. The protein is functionally associated with BRCA1 and thus predicted to be a common, low-penetrance breast cancer candidate.


Pssm-ID: 406356 [Multi-domain]  Cd Length: 331  Bit Score: 41.71  E-value: 1.39e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 157 LIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAataqvshlqlkmtahqkketeLQLQLTDNL 236
Cdd:pfam15905  79 ELEKEIRALVQERGEQDKRLQALEEELEKVEAKLNAAVREKTSLSASVAS---------------------LEKQLLELT 137
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 237 KETDLLR------GHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSA 310
Cdd:pfam15905 138 RVNELLKakfsedGTQKKMSSLSMELMKLRNKLEAKMKEVMAKQEGMEGKLQVTQKNLEHSKGKVAQLEEKLVSTEKEKI 217
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 311 QERCQAEAEMDEIRKSHQ--EELDRLRQLLKKARVSTDQAAAEQLTLAQA------ELQSQWE---AKCeQLLASARDEH 379
Cdd:pfam15905 218 EEKSETEKLLEYITELSCvsEQVEKYKLDIAQLEELLKEKNDEIESLKQSleekeqELSKQIKdlnEKC-KLLESEKEEL 296

                  ....*.
gi 1907156437 380 LQQYRE 385
Cdd:pfam15905 297 LREYEE 302
PRK04778 PRK04778
septation ring formation regulator EzrA; Provisional
240-431 1.79e-03

septation ring formation regulator EzrA; Provisional


Pssm-ID: 179877 [Multi-domain]  Cd Length: 569  Bit Score: 41.75  E-value: 1.79e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 240 DLLRGHVTRLQADLSELREASEQTQTKFKSE----KQSRRQLE-----LKVTSLEEELTDLRAEKTSLEKNLSERKKKSA 310
Cdd:PRK04778  201 DQLEEELAALEQIMEEIPELLKELQTELPDQlqelKAGYRELVeegyhLDHLDIEKEIQDLKEQIDENLALLEELDLDEA 280
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 311 QERCQA-EAEMDEI----------RKSHQEELDRLRQLLKKARVSTDQAAAE--------QLTLAQAELQSQWEAKCEQL 371
Cdd:PRK04778  281 EEKNEEiQERIDQLydilerevkaRKYVEKNSDTLPDFLEHAKEQNKELKEEidrvkqsyTLNESELESVRQLEKQLESL 360
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1907156437 372 LAsardehlqQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQ----KEHMQRLEKTKSQA 431
Cdd:PRK04778  361 EK--------QYDEITERIAEQEIAYSELQEELEEILKQLEEIEKEqeklSEMLQGLRKDELEA 416
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
182-339 2.20e-03

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 41.59  E-value: 2.20e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 182 ATENTQARILHAEQEKAKVTEELAaataqvshlqlkmtahqkketelqlQLTDNLKETDLLRGHVTRLQADLSELREASE 261
Cdd:PRK03918  187 RTENIEELIKEKEKELEEVLREIN-------------------------EISSELPELREELEKLEKEVKELEELKEEIE 241
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 262 QTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERK--KKSAQERCQAEAEMDEIRKSHQE---ELDRLRQ 336
Cdd:PRK03918  242 ELEKELESLEGSKRKLEEKIRELEERIEELKKEIEELEEKVKELKelKEKAEEYIKLSEFYEEYLDELREiekRLSRLEE 321

                  ...
gi 1907156437 337 LLK 339
Cdd:PRK03918  322 EIN 324
COG5281 COG5281
Phage-related minor tail protein [Mobilome: prophages, transposons];
130-418 2.86e-03

Phage-related minor tail protein [Mobilome: prophages, transposons];


Pssm-ID: 227606 [Multi-domain]  Cd Length: 833  Bit Score: 41.16  E-value: 2.86e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 130 IQENERLKQELLEKSSRIEEQNDKISDLIERNQRyVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAK---VTEELAA 206
Cdd:COG5281   285 QLEQIAALQRAGDTAAAAAAAAEAAAAMDDRTAR-VKENMGTLETAWDALADAAKKMWDAVLGIGREDKQaalLAAKLAA 363
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 207 ATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQtQTKFKSEKQSRRQLELKVTSLEE 286
Cdd:COG5281   364 EKLARVTAQGALNARLKLAQDDLTQAELNYAAADQAANQEGALNAREDEAEVLSTQ-EERRDILKNLLADAEKRTARQEE 442
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 287 ELTDLRAEKTSLEKNLSERK-KKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTlaqaELQSQWE 365
Cdd:COG5281   443 LNKALAKAKILQADKAAKAYqEDILQREAQSRGKTAAAERSQEQMTAALKALLAFQQQIADLSGAKEKA----SDQKSLL 518
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|...
gi 1907156437 366 AKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK 418
Cdd:COG5281   519 WKAEEQYALLKEEAKQRQLQEQKALLEHKKETLEYTSQLAELLDQQADRFELS 571
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
130-409 3.02e-03

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 41.18  E-value: 3.02e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 130 IQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQsnlmmEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATA 209
Cdd:PRK02224  470 IEEDRERVEELEAELEDLEEEVEEVEERLERAEDLVEA-----EDRIERLEERREDLEELIAERRETIEEKRERAEELRE 544
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 210 QVSHLQLKMTAHQKKETELQLqltdnlkETDLLRGHVTRLQADLSELreaseqtqtkfkseKQSRRQLElKVTSLEEELT 289
Cdd:PRK02224  545 RAAELEAEAEEKREAAAEAEE-------EAEEAREEVAELNSKLAEL--------------KERIESLE-RIRTLLAAIA 602
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 290 DLRAEKTSLeknlserkkksaQERCQAEAEMDEIRKSHQEEL-DRLRQL---LKKARVSTDQAAAEQLTLAQAELQSQWE 365
Cdd:PRK02224  603 DAEDEIERL------------REKREALAELNDERRERLAEKrERKRELeaeFDEARIEEAREDKERAEEYLEQVEEKLD 670
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1907156437 366 AKCEQ---LLAS-----ARDEHLQQYREVCAQRDAHQQKLALLQDECLALQA 409
Cdd:PRK02224  671 ELREErddLQAEigaveNELEELEELRERREALENRVEALEALYDEAEELES 722
PRK10929 PRK10929
putative mechanosensitive channel protein; Provisional
127-364 3.34e-03

putative mechanosensitive channel protein; Provisional


Pssm-ID: 236798 [Multi-domain]  Cd Length: 1109  Bit Score: 40.81  E-value: 3.34e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  127 QRIIQENERLKQELLEKssrIEEQNDKISDL------IERNQRYVEQSNLMMEKRN-------------NSL-QTATENT 186
Cdd:PRK10929    71 QQVIDNFPKLSAELRQQ---LNNERDEPRSVppnmstDALEQEILQVSSQLLEKSRqaqqeqdrareisDSLsQLPQQQT 147
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  187 QARILHAEQE---KAKVTEELAAATAQVSHLQLKMTAHQKKETELQL-QLTDNLKE------TDLLRGHVTRLQADLSEL 256
Cdd:PRK10929   148 EARRQLNEIErrlQTLGTPNTPLAQAQLTALQAESAALKALVDELELaQLSANNRQelarlrSELAKKRSQQLDAYLQAL 227
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  257 ReaseqTQTKFKSEKQSRRQLElKVTSLEEELTDLRAEKTS-LEKN--LSERKKKSAQercqaeaEMDEIrKSHQEeldr 333
Cdd:PRK10929   228 R-----NQLNSQRQREAERALE-STELLAEQSGDLPKSIVAqFKINreLSQALNQQAQ-------RMDLI-ASQQR---- 289
                          250       260       270
                   ....*....|....*....|....*....|....*
gi 1907156437  334 lrqllkkarvstdQAAAEQLTLAQA----ELQSQW 364
Cdd:PRK10929   290 -------------QAASQTLQVRQAlntlREQSQW 311
YqiK COG2268
Uncharacterized membrane protein YqiK, contains Band7/PHB/SPFH domain [Function unknown];
275-478 4.51e-03

Uncharacterized membrane protein YqiK, contains Band7/PHB/SPFH domain [Function unknown];


Pssm-ID: 225177 [Multi-domain]  Cd Length: 548  Bit Score: 40.20  E-value: 4.51e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 275 RQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLK-----KARVSTDQAA 349
Cdd:COG2268   248 VELEVEQQPAGKTAEQTREVKIILAETEAEVAAWKAETRREAEQAEILAEQAIQEEKAQAEQEVQhakalEAREMRVGLI 327
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 350 AEQ-------------LTLAQAELQSQWEAKCEQLLASA--RDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAF 414
Cdd:COG2268   328 ERQketelepqersyfINAAQRQAQEEAKAAANIAEAIGaqAEAAVETARETEEAERAEQAALVAAAEAAEQEQVEIAVR 407
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907156437 415 TEQKEHMQRLEKT--KSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFELEESYDGGTILRTIMHTI 478
Cdd:COG2268   408 AEAAKAEAEAQAAeiKAEAEAIREKGKAEAEAKRALAEAIQVLGDAAAAELFKALVQALPEVAEEA 473
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
126-426 4.82e-03

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 40.34  E-value: 4.82e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  126 IQRIIQENERLKQ---ELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTE 202
Cdd:TIGR00618  565 MQEIQQSFSILTQcdnRSKEDIPNLQNITVRLQDLTEKLSEAEDMLACEQHALLRKLQPEQDLQDVRLHLQQCSQELALK 644
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  203 ELAAATAQVSHLQLKMTAHQKKETELQLQLTD-NLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKV 281
Cdd:TIGR00618  645 LTALHALQLTLTQERVREHALSIRVLPKELLAsRQLALQKMQSEKEQLTYWKEMLAQCQTLLRELETHIEEYDREFNEIE 724
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  282 TSLEEELTDLRAEKTSLEKNLSERKKKsAQERCQAEAEMDEiRKSHQE-----ELDRLRQLLKKARVSTDQAAAEQLTLA 356
Cdd:TIGR00618  725 NASSSLGSDLAAREDALNQSLKELMHQ-ARTVLKARTEAHF-NNNEEVtaalqTGAELSHLAAEIQFFNRLREEDTHLLK 802
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1907156437  357 QAELQSQWEAKCEQLLASARDEHLQQYREVCAQRDA------HQQKLALLQD-ECLALQAQiaAFTEQKEHMQRLEK 426
Cdd:TIGR00618  803 TLEAEIGQEIPSDEDILNLQCETLVQEEEQFLSRLEeksatlGEITHQLLKYeECSKQLAQ--LTQEQAKIIQLSDK 877
tolA PRK09510
cell envelope integrity inner membrane protein TolA; Provisional
250-438 4.92e-03

cell envelope integrity inner membrane protein TolA; Provisional


Pssm-ID: 236545 [Multi-domain]  Cd Length: 387  Bit Score: 39.79  E-value: 4.92e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 250 QADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEmdEIRKSHQE 329
Cdd:PRK09510   74 AKRAEEQRKKKEQQQAEELQQKQAAEQERLKQLEKERLAAQEQKKQAEEAAKQAALKQKQAEEAAAKAAA--AAKAKAEA 151
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 330 ELDRLRQLLKKARVSTD-QAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLAllqdecLALQ 408
Cdd:PRK09510  152 EAKRAAAAAKKAAAEAKkKAEAEAAKKAAAEAKKKAEAEAAAKAAAEAKKKAEAEAKKKAAAEAKKKAAA------EAKA 225
                         170       180       190
                  ....*....|....*....|....*....|
gi 1907156437 409 AQIAAFTEQKEHMQRLEKTKSQAPAGRAAA 438
Cdd:PRK09510  226 AAAKAAAEAKAAAEKAAAAKAAEKAAAAKA 255
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
517-760 5.04e-03

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 40.54  E-value: 5.04e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  517 TPGMPPAPPSGETQEAP--EVLPEQVVGETTPLPLQALPT--PENGAQTRKGEPAEAEVPSEIKDSSLPPQPAGIPAHRV 592
Cdd:PHA03307    64 RFEPPTGPPPGPGTEAPanESRSTPTWSLSTLAPASPAREgsPTPPGPSSPDPPPPTPPPASPPPSPAPDLSEMLRPVGS 143
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  593 LGPPTSIPPKPPGpvtmdsESEEMLAADQRTVQPNGLL---GEEHVRevatdgllqgnsrrlsltPDPEKGEPPALDPES 669
Cdd:PHA03307   144 PGPPPAASPPAAG------ASPAAVASDAASSRQAALPlssPEETAR------------------APSSPPAEPPPSTPP 199
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  670 QGGEAQPPECKQAEDVSSSGPRETLLDTELASAAAGTSLRHNQDSQHCSLSGDEEdelfkgATLKVPRPTAQPEEEDEDE 749
Cdd:PHA03307   200 AAASPRPPRRSSPISASASSPAPAPGRSAADDAGASSSDSSSSESSGCGWGPENE------CPLPRPAPITLPTRIWEAS 273
                          250
                   ....*....|.
gi 1907156437  750 VSMKGRPPPTP 760
Cdd:PHA03307   274 GWNGPSSRPGP 284
PRK00106 PRK00106
ribonuclease Y;
193-359 5.50e-03

ribonuclease Y;


Pssm-ID: 178867 [Multi-domain]  Cd Length: 535  Bit Score: 39.85  E-value: 5.50e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 193 AEQEKAKVTEELAAATAQvshlQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTrLQADlSELREASEQTQTKFKSEKQ 272
Cdd:PRK00106   24 IKMKSAKEAAELTLLNAE----QEAVNLRGKAERDAEHIKKTAKRESKALKKELL-LEAK-EEARKYREEIEQEFKSERQ 97
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 273 SRRQLELKVTSLEEELtDLRAEKTSLEKNLSERKKKSAQERC----QAEAEMDEIRKSHQEELDRLRQLlkkarvstDQA 348
Cdd:PRK00106   98 ELKQIESRLTERATSL-DRKDENLSSKEKTLESKEQSLTDKSkhidEREEQVEKLEEQKKAELERVAAL--------SQA 168
                         170
                  ....*....|.
gi 1907156437 349 AAEQLTLAQAE 359
Cdd:PRK00106  169 EAREIILAETE 179
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
131-377 5.88e-03

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 40.16  E-value: 5.88e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  131 QENERLKQELLEKSSRIEEQNDKISDLIERnqryVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQ 210
Cdd:pfam01576  422 SESERQRAELAEKLSKLQSELESVSGLLSE----AEGKSIKLSKDVSSLESQLQDTQELLQEETRQKLNLSSRLRQLEDE 497
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  211 VSHL--QLKMTAHQKKETE-----LQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTS 283
Cdd:pfam01576  498 RNSLqeQLEEEEEAKRNVErqlstLQAQLSEMKKKLEEDAGAVEALEEAKKRLQRELEALTQRLEEKAAAYDKLEKTKNR 577
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  284 LEEELTDLRAEKTSLEKNLSERKKKSAQERcQAEAEMDEIRKSHQEELDRLRQLL--KKARVSTDQAAAEQLTLAQAELQ 361
Cdd:pfam01576  578 LQQELDDLLVDLDHQRQLVSNLEKKQKKFD-QMLAEEKAISARYAEERDRAEAEAreKETRALSLSRALEEALEAKEELE 656
                          250
                   ....*....|....*....
gi 1907156437  362 ---SQWEAKCEQLLASARD 377
Cdd:pfam01576  657 rqnKQLRAEMEDLVSSKDD 675
TPR_MLP1_2 pfam07926
TPR/MLP1/MLP2-like protein; The sequences featured in this family are similar to a region of ...
193-300 5.90e-03

TPR/MLP1/MLP2-like protein; The sequences featured in this family are similar to a region of human TPR protein and to yeast myosin-like proteins 1 (MLP1) and 2 (MLP2). These proteins share a number of features; for example, they all have coiled-coil regions and all three are associated with nuclear pores. TPR is thought to be a component of nuclear pore complex- attached intra-nuclear filaments, and is implicated in nuclear protein import. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerization of kinase domains or by targeting these kinases to the nuclear pore complex. MLP1 and MLP2 are involved in the process of telomere length regulation, where they are thought to interact with proteins such as Tel1p and modulate their activity.


Pssm-ID: 400329 [Multi-domain]  Cd Length: 129  Bit Score: 37.59  E-value: 5.90e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 193 AEQEKAKVTEELAAATAQVSHLQLKM--------TAHQKKETELQLQLTDnLKETDLLRGHVTRLQADLSELREASEQTQ 264
Cdd:pfam07926   6 LESEIKRLKEEAEDAEAQLQKLQEDLekqaeiakEAQQNYERELVLHAED-IKALQALREELNELKAEIAELKAEAESAK 84
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 1907156437 265 TKFKSEKQSrrqLELKVTSLEEELTDLRAEKTSLEK 300
Cdd:pfam07926  85 AELEESEES---WEEQKERLEKELSELEKRIEDLNE 117
COG5022 COG5022
Myosin heavy chain [General function prediction only];
223-458 6.43e-03

Myosin heavy chain [General function prediction only];


Pssm-ID: 227355 [Multi-domain]  Cd Length: 1463  Bit Score: 40.06  E-value: 6.43e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  223 KKETELQLQLTDNLKETDLLRGHVtrLQADLSElreaSEQTQTKFKSEKQS--RRQLELKVTSLEEELTDLRAEKTSLE- 299
Cdd:COG5022    823 QKTIKREKKLRETEEVEFSLKAEV--LIQKFGR----SLKAKKRFSLLKKEtiYLQSAQRVELAERQLQELKIDVKSISs 896
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  300 -KNLSERKKKSAQE-RCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSQ---WEAKCEQL--L 372
Cdd:COG5022    897 lKLVNLELESEIIElKKSLSSDLIENLEFKTELIARLKKLLNNIDLEEGPSIEYVKLPELNKLHEVeskLKETSEEYedL 976
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  373 ASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHMQRLE---KTKSQAPAGRAAADPSEKVKKIMN 449
Cdd:COG5022    977 LKKSTILVREGNKANSELKNFKKELAELSKQYGALQESTKQLKELPVEVAELQsasKIISSESTELSILKPLQKLKGLLL 1056

                   ....*....
gi 1907156437  450 QVFQSLRGE 458
Cdd:COG5022   1057 LENNQLQAR 1065
mukB PRK04863
chromosome partition protein MukB;
134-417 6.55e-03

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 39.94  E-value: 6.55e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  134 ERLKQELLEKSSRIEEQN---DKISDLIERNQRYVEQSNLMMEKRNNSL---QTATENTQARIL---HAEQ--EKAKVTE 202
Cdd:PRK04863   351 ERYQADLEELEERLEEQNevvEEADEQQEENEARAEAAEEEVDELKSQLadyQQALDVQQTRAIqyqQAVQalERAKQLC 430
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  203 ELAAATA-QVSHLQLKMTAHQKKETELQLQLTDNLKETD-----------LLR---GHVTR------------------- 248
Cdd:PRK04863   431 GLPDLTAdNAEDWLEEFQAKEQEATEELLSLEQKLSVAQaahsqfeqayqLVRkiaGEVSRseawdvarellrrlreqrh 510
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  249 -------LQADLSELREASEQTQTKFKSEKQSRRQLELKVTSlEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAemd 321
Cdd:PRK04863   511 laeqlqqLRMRLSELEQRLRQQQRAERLLAEFCKRLGKNLDD-EDELEQLQEELEARLESLSESVSEARERRMALRQ--- 586
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  322 eirksHQEELD-RLRQLLKKARV-STDQAAAEQLtlaqaELQSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLAL 399
Cdd:PRK04863   587 -----QLEQLQaRIQRLAARAPAwLAAQDALARL-----REQSGEEFEDSQDVTEYMQQLLERERELTVERDELAARKQA 656
                          330
                   ....*....|....*...
gi 1907156437  400 LQDECLALQAQIAAFTEQ 417
Cdd:PRK04863   657 LDEEIERLSQPGGSEDPR 674
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
56-424 6.60e-03

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 40.10  E-value: 6.60e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437   56 HFQGSGDMMSFLMteaRQHNTEIRMAVNKVADKMDHLmtkvEELQKHSSGNSMLLPSMSvtmetsmiMSNIQRIIQENER 135
Cdd:pfam15921  214 HFRSLGSAISKIL---RELDTEISYLKGRIFPVEDQL----EALKSESQNKIELLLQQH--------QDRIEQLISEHEV 278
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  136 LKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENtqariLHAEQEKAKVTEElaaatAQVSHLQ 215
Cdd:pfam15921  279 EITGLTEKASSARSQANSIQSQLEIIQEQARNQNSMYMRQLSDLESTVSQ-----LRSELREAKRMYE-----DKIEELE 348
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  216 LKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADL----SELREASEQTQTKFKSEKQS-------RRQLE---LKV 281
Cdd:pfam15921  349 KQLVLANSELTEARTERDQFSQESGNLDDQLQKLLADLhkreKELSLEKEQNKRLWDRDTGNsitidhlRRELDdrnMEV 428
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  282 TSLEEELTDLRAE-KTSLEKNLS--ERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQllKKARVSTDQAAAEQLTLAQA 358
Cdd:pfam15921  429 QRLEALLKAMKSEcQGQMERQMAaiQGKNESLEKVSSLTAQLESTKEMLRKVVEELTA--KKMTLESSERTVSDLTASLQ 506
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1907156437  359 ELQSQWEAKCEQL--LASARDEHLQQYREVCAQRDAHQQklalLQDECLALQAQIAA-------FTEQKEHMQRL 424
Cdd:pfam15921  507 EKERAIEATNAEItkLRSRVDLKLQELQHLKNEGDHLRN----VQTECEALKLQMAEkdkvieiLRQQIENMTQL 577
BREX_BrxC NF033441
BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, ...
246-447 6.77e-03

BREX system P-loop protein BrxC; BrxC is a P-loop-containing protein, and probable ATPase, from BREX (bacteriophage exclusion) systems of type 1.


Pssm-ID: 380283  Cd Length: 1173  Bit Score: 39.87  E-value: 6.77e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  246 VTRLQADLSELREAS--EQTQTKFKSEKQSRRQLELKVTSLEEELT--------DLRAEKTSLEKNLSERKKKSAQErcq 315
Cdd:NF033441   928 LEPALALLEEILSIKdnEEFLKALNKKEDDLLDLIEDWEDVKSFFEgdqlpiwdRALRLLKEYEDNLDYELDEEAEE--- 1004
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437  316 AEAEMDEIRKSH---------QEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQSqwEAKCEQLLASARDEHLQQYREv 386
Cdd:NF033441  1005 AIEELRSILADPdpysripdlPPLLEALREALREALEELREAALEAIEEAKAELEA--DLEWQELSDEQQNRLLAPFDE- 1081
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1907156437  387 CAQRDAHQQKLALLQDecLALQAQIAAFTEQKEHMQRL--EKTKSQAPAGRAAADPSEKVKKI 447
Cdd:NF033441  1082 LKERIEPEVSIASLRA--LLDQLADALLDRLLDRIEALiqRFQEEKAEPEVKEAAAEPPEPKV 1142
GAS pfam13851
Growth-arrest specific micro-tubule binding; This family is the highly conserved central ...
217-362 7.41e-03

Growth-arrest specific micro-tubule binding; This family is the highly conserved central region of a number of metazoan proteins referred to as growth-arrest proteins. In mouse, Gas8 is predominantly a testicular protein, whose expression is developmentally regulated during puberty and spermatogenesis. In humans, it is absent in infertile males who lack the ability to generate gametes. The localization of Gas8 in the motility apparatus of post-meiotic gametocytes and mature spermatozoa, together with the detection of Gas8 also in cilia at the apical surfaces of epithelial cells lining the pulmonary bronchi and Fallopian tubes suggests that the Gas8 protein may have a role in the functioning of motile cellular appendages. Gas8 is a microtubule-binding protein localized to regions of dynein regulation in mammalian cells.


Pssm-ID: 404693 [Multi-domain]  Cd Length: 200  Bit Score: 38.35  E-value: 7.41e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 217 KMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQtqtkFKSEKQSRRQLELKVTSLEEELTDLRAEKt 296
Cdd:pfam13851  34 EIAELKKKEERNEKLMSEIQQENKRLTEPLQKAQEEVEELRKQLEN----YEKDKQSLKNLKARLKVLEKELKDLKWEH- 108
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1907156437 297 sleKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKaRVstdQAAAEQLTLAQAELQS 362
Cdd:pfam13851 109 ---EVLEQRFEKVERERDELYDKFEAAIQDVQQKTGLKNLLLEK-KL---QALGETLEKKEAQLNE 167
ATG16 pfam08614
Autophagy protein 16 (ATG16); Autophagy is a ubiquitous intracellular degradation system for ...
156-293 8.85e-03

Autophagy protein 16 (ATG16); Autophagy is a ubiquitous intracellular degradation system for eukaryotic cells. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. ATG16 (also known as Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate in the yeast autophagy pathway.


Pssm-ID: 400781 [Multi-domain]  Cd Length: 176  Bit Score: 37.99  E-value: 8.85e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 156 DLIERNQRYVEQSNLMmEKRNNSLQTATENTQARILHAEQEKAKVTEE-LAAATAQVSHLQLKMTAHQKKETELQLQLTD 234
Cdd:pfam08614   4 ELIDAYNRLLDRTALL-EAENAKLQSEPESVPPSTSSSLASASPVQSAsIQSLEQKLAQLREELAELYRSRGELAQQLVD 82
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 1907156437 235 nlketdllrghvtrLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRA 293
Cdd:pfam08614  83 --------------LNEELQELESELREDERRLAELEAERAQLEEKLRDREEELREKRK 127
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
124-300 8.98e-03

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 39.36  E-value: 8.98e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 124 SNIQRIIQENERLKQELLEKSSRIEEQND--KISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQAR----ILHAEQEK 197
Cdd:COG0419   562 RQLEDRLQELKELLEELRLLRTRKEELEElrERLKELKKKLKELEERLSQLEELLQSLELSEAENELEeaeeELESELEK 641
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 198 AKVTEELA-AATAQVSHLQLK--------MTAHQKKETELQLQltDNLKETDLLRGHVTRLQADLSELREaseqtqtKFK 268
Cdd:COG0419   642 LNLQAELEeLLQAALEELEEKveeleaeiRRELQRIENEEQLE--EKLEELEQLEEELEQLREELEELLK-------KLG 712
                         170       180       190
                  ....*....|....*....|....*....|..
gi 1907156437 269 SEKQSRRQLELKVTSLEEELTDLRAEKTSLEK 300
Cdd:COG0419   713 EIEQLIEELESRKAELEELKKELEKLEKALEL 744
WEMBL pfam05701
Weak chloroplast movement under blue light; WEMBL consists of several plant proteins required ...
193-418 9.15e-03

Weak chloroplast movement under blue light; WEMBL consists of several plant proteins required for the chloroplast avoidance response under high intensity blue light. This avoidance response consists in the relocation of chloroplasts on the anticlinal side of exposed cells. Acts in association with PMI2 to maintain the velocity of chloroplast photo-relocation movement via the regulation of cp-actin filaments. Thus several member-sequences are described as "myosin heavy chain-like".


Pssm-ID: 399015 [Multi-domain]  Cd Length: 562  Bit Score: 39.23  E-value: 9.15e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 193 AEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQlqltdnlKETDLLRGHVTRLQADLSElrEASEQTQTKFKSEKQ 272
Cdd:pfam05701  61 AEAAKSQVLEELESTKRLIEELKLNLEKAQTEEAQAK-------QDSELAKLRVEEMEQGIAD--EASVAAKAQLEVAKA 131
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907156437 273 SRRQLELKVTSLEEELTDLRAEKTSLeknLSERkKKSAQERCQAEAEMDEIRKSHQE---ELDRLRQLLKKARVSTDQAA 349
Cdd:pfam05701 132 RHAAAVAELKSVKEELESLQKEYASL---VSER-DIAIKRAEEAVSASKEIEKTVEEltiELIATKESLESAHAAHLEAE 207
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1907156437 350 AEQLTLAQAELQ--SQWEAKCEQLlasarDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQK 418
Cdd:pfam05701 208 EHRIGAALAREQdkLNWEKELKQA-----EEELQRLNQQLLSAKDLKSKLETASALLLDLKAELAAYMESK 273
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH