NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1958683498|ref|XP_038950354|]
View 

neuropeptide Y receptor type 1 isoform X2 [Rattus norvegicus]

Protein Classification

G protein-coupled receptor family protein( domain architecture ID 705710)

G protein-coupled receptor family protein is a seven-transmembrane G protein-coupled receptor (7TM-GPCR) family protein which typically transmits an extracellular signal into the cell by the conformational rearrangement of the 7TM helices and by the subsequent binding and activation of an intracellular heterotrimeric G protein; GPCR ligands include light-sensitive compounds, odors, pheromones, hormones, and neurotransmitters

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
1-88 1.09e-57

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15395:

Pssm-ID: 452889 [Multi-domain]  Cd Length: 293  Bit Score: 180.78  E-value: 1.09e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   1 MMDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFL 80
Cdd:cd15395   206 MMDKMRDNKYRSSETKRINIMLISIVVAFAVCWLPLNIFNAVFDWNHEAIATCNHNLLFLICHLTAMISTCVNPIFYGFL 285

                  ....*...
gi 1958683498  81 NKNFQRDL 88
Cdd:cd15395   286 NKNFQRDL 293
 
Name Accession Description Interval E-value
7tmA_NPY1R cd15395
neuropeptide Y receptor type 1, member of the class A family of seven-transmembrane G ...
1-88 1.09e-57

neuropeptide Y receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. When NPY signals through NPY2R in concert with NPY5R, it induces angiogenesis and consequently plays an important role in revascularization and wound healing. On the other hand, when NPY acts through NPY1R and NPYR5, it acts as a vascular mitogen, leading to restenosis and atherosclerosis.


Pssm-ID: 320517 [Multi-domain]  Cd Length: 293  Bit Score: 180.78  E-value: 1.09e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   1 MMDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFL 80
Cdd:cd15395   206 MMDKMRDNKYRSSETKRINIMLISIVVAFAVCWLPLNIFNAVFDWNHEAIATCNHNLLFLICHLTAMISTCVNPIFYGFL 285

                  ....*...
gi 1958683498  81 NKNFQRDL 88
Cdd:cd15395   286 NKNFQRDL 293
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
4-77 9.73e-14

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 425413 [Multi-domain]  Cd Length: 257  Bit Score: 65.79  E-value: 9.73e-14
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1958683498   4 KIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFY 77
Cdd:pfam00001 184 KQKSEERTQRRERKALKTLAVVVVVFILCWLPYHIVNLLDSLALDCELSRLLDKALSITLWLAYVNSCLNPIIY 257
 
Name Accession Description Interval E-value
7tmA_NPY1R cd15395
neuropeptide Y receptor type 1, member of the class A family of seven-transmembrane G ...
1-88 1.09e-57

neuropeptide Y receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. When NPY signals through NPY2R in concert with NPY5R, it induces angiogenesis and consequently plays an important role in revascularization and wound healing. On the other hand, when NPY acts through NPY1R and NPYR5, it acts as a vascular mitogen, leading to restenosis and atherosclerosis.


Pssm-ID: 320517 [Multi-domain]  Cd Length: 293  Bit Score: 180.78  E-value: 1.09e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   1 MMDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFL 80
Cdd:cd15395   206 MMDKMRDNKYRSSETKRINIMLISIVVAFAVCWLPLNIFNAVFDWNHEAIATCNHNLLFLICHLTAMISTCVNPIFYGFL 285

                  ....*...
gi 1958683498  81 NKNFQRDL 88
Cdd:cd15395   286 NKNFQRDL 293
7tmA_NPY4R cd15397
neuropeptide Y receptor type 4, member of the class A family of seven-transmembrane G ...
1-88 1.17e-42

neuropeptide Y receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety.


Pssm-ID: 320519 [Multi-domain]  Cd Length: 293  Bit Score: 142.19  E-value: 1.17e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   1 MMDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFL 80
Cdd:cd15397   206 MLERRGEYNRRAGHSKRINVMLVSLVAAFALCWLPLNVFNAIADWNHEAIPHCQHNLIFSLCHLAAMASTCVNPIIYGFL 285

                  ....*...
gi 1958683498  81 NKNFQRDL 88
Cdd:cd15397   286 NSNFKKEV 293
7tmA_NPY6R cd15396
neuropeptide Y receptor type 6, member of the class A family of seven-transmembrane G ...
1-88 1.42e-42

neuropeptide Y receptor type 6, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety.


Pssm-ID: 320518 [Multi-domain]  Cd Length: 293  Bit Score: 141.89  E-value: 1.42e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   1 MMDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFL 80
Cdd:cd15396   206 KIDRMRENESRLSENKRINTMLISIVVTFAACWLPLNIFNVVFDWNHEVLMSCHHNLVFTLCHLVAMVSTCINPIFYGFL 285

                  ....*...
gi 1958683498  81 NKNFQRDL 88
Cdd:cd15396   286 NKNFQKDL 293
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
1-88 6.59e-30

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331 [Multi-domain]  Cd Length: 293  Bit Score: 109.23  E-value: 6.59e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   1 MMDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQI-IATCNHNLLFLLCHLTAMISTCVNPIFYGF 79
Cdd:cd15203   205 RTLSSRRRRSELRRKRRTNRLLIAMVVVFAVCWLPLNLFNLLRDFEPLPqIDGRHFYLIFLICHLIAMSSACVNPLLYGW 284

                  ....*....
gi 1958683498  80 LNKNFQRDL 88
Cdd:cd15203   285 LNDNFRKEF 293
7tmA_PrRP_R cd15394
prolactin-releasing peptide receptor, member of the class A family of seven-transmembrane G ...
16-88 9.37e-17

prolactin-releasing peptide receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Prolactin-releasing peptide (PrRP) receptor (previously known as GPR10) is expressed in the central nervous system with the highest levels located in the anterior pituitary and is activated by its endogenous ligand PrRP, a neuropeptide possessing a C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acids (PrRP-20) and the other consists of 31 amino acids (PrRP-31), where PrRP-20 is a C-terminal fragment of PrRP-31. Binding of PrRP to the receptor coupled to G(i/o) proteins activates the extracellular signal-related kinase (ERK) and it can also couple to G(q) protein leading to an increase in intracellular calcium and activation of c-Jun N-terminal protein kinase (JNK). The PrRP receptor shares significant sequence homology with the neuropeptide Y (NPY) receptor, and micromolar levels of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors. PrRP has been shown to reduce food intake and body weight and modify body temperature when administered in rats. It also has been shown to decrease circulating growth hormone levels by activating somatostatin-secreting neurons in the hypothalamic periventricular nucleus.


Pssm-ID: 320516 [Multi-domain]  Cd Length: 286  Bit Score: 74.39  E-value: 9.37e-17
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15394   214 RKTFRLLVVVVVAFAICWLPLHIFNVIRDIDIDLIDKQYFNLIQLLCHWLAMSSACYNPFLYAWLHDSFRGEL 286
7tmA_TACR_family cd14992
tachykinin receptor and closely related proteins, member of the class A family of ...
10-86 8.22e-14

tachykinin receptor and closely related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled receptors for a variety of neuropeptides of the tachykinin (TK) family as well as closely related receptors. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320123 [Multi-domain]  Cd Length: 291  Bit Score: 66.30  E-value: 8.22e-14
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1958683498  10 YRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd14992   213 KRLKCKRRVIKMLVCVVVLFVICWLPFHLFFLLRDFFPLIMKEKHTLQVYYFLHWIAMSNSMYNPIIYVTLNNNFRK 289
7tmA_NPY5R cd15398
neuropeptide Y receptor type 5, member of the class A family of seven-transmembrane G ...
15-88 9.35e-14

neuropeptide Y receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. When NPY signals through NPY2R in concert with NPY5R, it induces angiogenesis and consequently plays an important role in revascularization and wound healing. On the other hand, when NPY acts through NPY1R and NPYR5, it acts as a vascular mitogen, leading to restenosis and atherosclerosis.


Pssm-ID: 320520 [Multi-domain]  Cd Length: 273  Bit Score: 65.95  E-value: 9.35e-14
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1958683498  15 TKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15398   200 SRSVFYRLTIVILAFAVSWMPLHLFHLVTDFNANLISNRHFKLVYCICHLLGMLSCCLNPILYGFLNNGIKSDL 273
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
4-77 9.73e-14

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 425413 [Multi-domain]  Cd Length: 257  Bit Score: 65.79  E-value: 9.73e-14
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1958683498   4 KIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFY 77
Cdd:pfam00001 184 KQKSEERTQRRERKALKTLAVVVVVFILCWLPYHIVNLLDSLALDCELSRLLDKALSITLWLAYVNSCLNPIIY 257
7tmA_PR4-like cd15392
neuropeptide Y receptor-like found in insect and related proteins, member of the class A ...
1-86 1.77e-13

neuropeptide Y receptor-like found in insect and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a novel G protein-coupled receptor (also known as PR4 receptor) from Drosophila melanogaster, which can be activated by the members of the neuropeptide Y (NPY) family, including NPY, peptide YY (PYY) and pancreatic polypeptide (PP), when expressed in Xenopus oocytes. These homologous peptides of 36-amino acids in length contain a hairpin-like structural motif, which referred to as the pancreatic polypeptide fold, and function as gastrointestinal hormones and neurotransmitters. The PR4 receptor also shares strong sequence homology to the mammalian tachykinin receptors (NK1R, NK2R, and NK3R), whose endogenous ligands are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB), respectively. The tachykinins function as excitatory transmitters on neurons and cells in the gastrointestinal tract.


Pssm-ID: 320514 [Multi-domain]  Cd Length: 287  Bit Score: 65.46  E-value: 1.77e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   1 MMDKIRDSKYRSSETKRINvMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFL 80
Cdd:cd15392   201 EAENNRDQRMAESKRKLVK-MMITVVAIFALCWLPLNILNLVGDHDESIYSWPYIPYLWLAAHWLAMSHCCYNPFIYCWM 279

                  ....*.
gi 1958683498  81 NKNFQR 86
Cdd:cd15392   280 NAKFRN 285
7tmA_NPY2R cd15399
neuropeptide Y receptor type 2, member of the class A family of seven-transmembrane G ...
16-85 8.65e-13

neuropeptide Y receptor type 2, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. When NPY signals through NPY2R in concert with NPY5R, it induces angiogenesis and consequently plays an important role in revascularization and wound healing. On the other hand, when NPY acts through NPY1R and NPYR5, it acts as a vascular mitogen, leading to restenosis and atherosclerosis.


Pssm-ID: 320521 [Multi-domain]  Cd Length: 285  Bit Score: 63.30  E-value: 8.65e-13
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15399   213 RKTTKMLVCVVVVFAVSWLPFHAFQLASDIDSKVLDLKEYKLIYTIFHVIAMCSTFANPLLYGWMNNNYR 282
7tmA_NPR-like_invertebrate cd15391
invertebrate neuropeptide receptor-like, member of the class A family of seven-transmembrane G ...
3-88 1.55e-12

invertebrate neuropeptide receptor-like, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes putative neuropeptide receptor found in invertebrates, which is a member of class A of 7-transmembrane G protein-coupled receptors. This orphan receptor shares a significant amino acid sequence identity with the neurokinin 1 receptor (NK1R). The endogenous ligand for NK1R is substance P, an 11-amino acid peptide that functions as a vasodilator and neurotransmitter and is released from the autonomic sensory nerve fibers.


Pssm-ID: 320513 [Multi-domain]  Cd Length: 289  Bit Score: 62.53  E-value: 1.55e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   3 DKIRDSKyRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWnHQIIATCNHN---LLFLLCHLTAMISTCVNPIFYGF 79
Cdd:cd15391   203 DKGRDDM-QIKSKRKVIKMLVFVVLMFGICWLPLHLFNLVQDF-STVFRNMPQHttrLIYGACHWIAMSNSFVNPIIYLF 280

                  ....*....
gi 1958683498  80 LNKNFQRDL 88
Cdd:cd15391   281 MNDSFRSIL 289
7tmA_GPR83 cd15389
G protein-coupled receptor 83, member of the class A family of seven-transmembrane G ...
21-88 2.43e-12

G protein-coupled receptor 83, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR83, also known as GPR72, is widely expressed in the brain, including hypothalamic nuclei which is involved in regulating energy balance and food intake. The hypothalamic expression of GPR83 is tightly regulated in response to nutrient availability and is decreased in obese mice. A recent study suggests that GPR83 has a critical role in the regulation of systemic energy metabolism via ghrelin-dependent and ghrelin-independent mechanisms. GPR83 shares a significant amino acid sequence identity with the tachykinin receptors, however its endogenous ligand is unknown.


Pssm-ID: 320511 [Multi-domain]  Cd Length: 285  Bit Score: 61.97  E-value: 2.43e-12
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  21 MLLSIVVAFAVCWLPLTIFNTVFDWNhqiiATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15389   222 MLMLVVLLFAICWLPLNCYHVLLSSH----PIRSNSALFFAFHWLAMSSTCYNPFIYCWLNDSFRSEL 285
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
16-86 8.44e-12

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124 [Multi-domain]  Cd Length: 296  Bit Score: 60.69  E-value: 8.44e-12
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL--LFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd14993   222 KKVARMLIVVVVLFALSWLPYYVLSILLDFGPLSSEESDENFllILPFAQLLGYSNSAINPIIYCFMSKKFRR 294
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
11-81 1.71e-11

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 59.61  E-value: 1.71e-11
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1958683498  11 RSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHqiIATCNHNLLFLLCHLTAMISTCVNPIFYGFLN 81
Cdd:cd00637   207 RRRRERKVTKTLLIVVVVFLLCWLPYFILLLLDVFGP--DPSPLPRILYFLALLLAYLNSAINPIIYAFFN 275
7tmA_NPFFR cd15207
neuropeptide FF receptors, member of the class A family of seven-transmembrane G ...
21-86 3.97e-11

neuropeptide FF receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide FF (NPFF) is a mammalian octapeptide that belongs to a family of neuropeptides containing an RF-amide motif at their C-terminus that have been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of these peptides are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R. NPFF has been shown to inhibit adenylate cyclase via the Gi protein coupled to NPFF1-R.


Pssm-ID: 320335 [Multi-domain]  Cd Length: 291  Bit Score: 58.79  E-value: 3.97e-11
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1958683498  21 MLLSIVVAFAVCWLPLTIFNTVFDWNH------QIIatcnHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15207   222 MLIVVVVLFALSWLPLHTVTMLDDFGNlspnqrEVL----YVYIYPIAHWLAYFNSCVNPIVYGYFNRNFRK 289
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
3-86 1.23e-10

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101 [Multi-domain]  Cd Length: 282  Bit Score: 57.30  E-value: 1.23e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   3 DKIRDSKYRSSE--TKRINVMLLSIVVAFAVCWLPLTIFNTVfdwnhQIIATCNHNL----LFLLCHLTAMISTCVNPIF 76
Cdd:cd14970   196 RNLSTSGAREKRraRRKVTRLVLVVVAVFVVCWLPFHVFQIV-----RLLIDPPETLtvvgVFLFCIALSYANSCLNPIL 270
                          90
                  ....*....|
gi 1958683498  77 YGFLNKNFQR 86
Cdd:cd14970   271 YAFLDENFRK 280
7tmA_leucokinin-like cd15393
leucokinin-like peptide receptor from tick and related proteins, member of the class A family ...
15-87 1.32e-10

leucokinin-like peptide receptor from tick and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a leucokinin-like peptide receptor from the Southern cattle tick, Boophilus microplus, a pest of cattle world-wide. Leucokinins are invertebrate neuropeptides that exhibit myotropic and diuretic activity. This receptor is the first neuropeptide receptor known from the Acari and the second known in the subfamily of leucokinin-like peptide G-protein-coupled receptors. The other known leucokinin-like peptide receptor is a lymnokinin receptor from the mollusc Lymnaea stagnalis.


Pssm-ID: 320515 [Multi-domain]  Cd Length: 288  Bit Score: 57.42  E-value: 1.32e-10
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1958683498  15 TKRINVMLLSIVVAFAVCWLPLTIFNTVfdwnHQIIATCNH----NLLFLLCHLTAMISTCVNPIFYGFLNKNFQRD 87
Cdd:cd15393   215 KKKVIKMLIIVVALFALCWLPLQTYNLL----NEIKPEINKykyiNIIWFCSHWLAMSNSCYNPFIYGLYNEKFKRE 287
7tmA_CCK_R cd15206
cholecystokinin receptors, member of the class A family of seven-transmembrane G ...
16-86 2.03e-10

cholecystokinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Cholecystokinin receptors (CCK-AR and CCK-BR) are a group of G-protein coupled receptors which bind the peptide hormones cholecystokinin (CCK) or gastrin. CCK, which facilitates digestion in the small intestine, and gastrin, a major regulator of gastric acid secretion, are highly similar peptides. Like gastrin, CCK is a naturally-occurring linear peptide that is synthesized as a preprohormone, then proteolytically cleaved to form a family of peptides with the common C-terminal sequence (Gly-Trp-Met-Asp-Phe-NH2), which is required for full biological activity. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors.


Pssm-ID: 320334 [Multi-domain]  Cd Length: 269  Bit Score: 56.63  E-value: 2.03e-10
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNT--VFDWNHQIIATCNHNLLFLlcHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15206   197 KRVIRMLFVIVVEFFICWTPLYVINTwkAFDPPSAARYVSSTTISLI--QLLAYISSCVNPITYCFMNKRFRQ 267
7tmA_TACR-like cd15202
tachykinin receptors and related receptors, member of the class A family of ...
6-88 2.77e-10

tachykinin receptors and related receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the neurokinin/tachykinin receptors and its closely related receptors such as orphan GPR83 and leucokinin-like peptide receptor. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320330 [Multi-domain]  Cd Length: 288  Bit Score: 56.36  E-value: 2.77e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   6 RDSKYRSSETKRINvMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNhNLLFLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15202   208 RYFALRRKKKKVIK-MLMVVVVLFALCWLPFNIYVLLLSSKPDYLIKTI-NAVYFAFHWLAMSSTCYNPFIYCWLNERFR 285

                  ...
gi 1958683498  86 RDL 88
Cdd:cd15202   286 IEF 288
7tmA_KiSS1R cd15095
KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of ...
15-88 4.19e-10

KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled KiSS1-derived peptide receptor (GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (previously known as metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. The KiSS1 receptor is coupled to G proteins of the G(q/11) family, which lead to activation of phospholipase C and increase of intracellular calcium. This signaling cascade plays an important role in reproduction by regulating the secretion of gonadotropin-releasing hormone.


Pssm-ID: 320223 [Multi-domain]  Cd Length: 288  Bit Score: 55.75  E-value: 4.19e-10
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  15 TKRINVMLLSIVVAFAVCWLPLTIFN--TVFDWNHQIiatcNHNLLFL--LCHLTAMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15095   215 KRKVTRMVIVVVVLFAICWLPNHVLNlwQRFDPNFPE----TYATYALkiAALCLSYANSAVNPFVYAFMGENFRKYF 288
7tmA_GPRnna14-like cd15001
GPRnna14 and related proteins, member of the class A family of seven-transmembrane G ...
10-85 6.72e-10

GPRnna14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the orphan G-protein coupled receptor GPRnna14 found in body louse (Pediculus humanus humanus) as well as its closely related proteins of unknown function. These receptors are members of the class A rhodopsin-like G-protein coupled receptors. As an obligatory parasite of humans, the body louse is an important vector for human diseases, including epidemic typhus, relapsing fever, and trench fever. GPRnna14 shares significant sequence similarity with the members of the neurotensin receptor family. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320132 [Multi-domain]  Cd Length: 266  Bit Score: 55.36  E-value: 6.72e-10
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1958683498  10 YRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWN-HQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15001   187 YARDTRKQVIKMLISVVVLFAVCWGPLLIDNLLVSFDvISTLHTQALKYMRIAFHLLSYANSCINPIIYAFMSKNFR 263
7tmA_AstA_R_insect cd15096
allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G ...
15-86 6.79e-09

allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled AstA receptor binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320224 [Multi-domain]  Cd Length: 284  Bit Score: 52.30  E-value: 6.79e-09
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1958683498  15 TKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFlLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15096   212 KRRVTRLVVVVVVVFAICWLPIHIILLLKYYGVLPETVLYVVIQI-LSNCLAYGNSCVNPILYAFLSQNFRK 282
7tmA_SSTR4 cd15973
somatostatin receptor type 4, member of the class A family of seven-transmembrane G ...
11-86 7.74e-09

somatostatin receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR4 plays a critical role in mediating inflammation. Unlike other SSTRs, SSTR4 subtype is not detected in all pituitary adenomas while it is expressed in the normal human pituitary.


Pssm-ID: 320639 [Multi-domain]  Cd Length: 274  Bit Score: 52.17  E-value: 7.74e-09
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1958683498  11 RSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHnllflLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15973   202 RRKSEKKITRMVLMVVTVFVICWMPFYVVQLLNLFLPRLDATVNH-----ASLILSYANSCANPILYGFLSDNFRR 272
7tmA_Galanin_R-like cd14971
galanin receptor and related proteins, member of the class A family of seven-transmembrane G ...
16-86 1.07e-08

galanin receptor and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled galanin receptors, kisspeptin receptor and allatostatin-A receptor (AstA-R) in insects. These receptors, which are members of the class A of seven transmembrane GPCRs, share a high degree of sequence homology among themselves. The galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, eating disorders, and epilepsy, among many others. KiSS1-derived peptide receptor (also known as GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. AstA-R is a G-protein coupled receptor that binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320102 [Multi-domain]  Cd Length: 281  Bit Score: 52.08  E-value: 1.07e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIaTCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd14971   210 RKVTRLVLVVVVLFAACWGPIHAILLLVALGPFPL-TYATYALRIWAHCLAYSNSAVNPVLYAFLSEHFRK 279
7tmA_SSTR cd15093
somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
8-86 1.11e-08

somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. They share common signaling cascades such as inhibition of adenylyl cyclase, activation of phosphotyrosine phosphatase activity, and G-protein-dependent regulation of MAPKs.


Pssm-ID: 320221 [Multi-domain]  Cd Length: 280  Bit Score: 51.69  E-value: 1.11e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   8 SKYRSSEtKRINVMLLSIVVAFAVCWLPLTIFNTVfdwnHQIIATCNHNLLFLLCHLTAMIS---TCVNPIFYGFLNKNF 84
Cdd:cd15093   202 QQRKRSE-RKVTRMVVMVVVVFVICWLPFYVLQLV----NVFVQLPETPALVGVYHFVVILSyanSCANPILYGFLSDNF 276

                  ..
gi 1958683498  85 QR 86
Cdd:cd15093   277 KK 278
7tmA_Anaphylatoxin_R-like cd14974
anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class ...
6-86 2.27e-08

anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes anaphylatoxin receptors, formyl peptide receptors (FPR), prostaglandin D2 receptor 2, GPR1, and related chemokine receptors. The anaphylatoxin receptors are a group of G-protein coupled receptors that bind anaphylatoxins. The members of this group include C3a and C5a receptors. The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed mainly on polymorphonuclear and mononuclear phagocytes and bind N-formyl-methionyl peptides (FMLP), which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Chemokine receptor-like 1 (also known as chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. Prostaglandin D2 receptor, also known as CRTH2, is a chemoattractant G-protein coupled receptor expressed on T helper type 2 cells that binds prostaglandin D2 (PGD2). PGD2 functions as a mast cell-derived mediator to trigger asthmatic responses and also causes vasodilation. PGD2 exerts its inflammatory effects by binding to two G-protein coupled receptors, the D-type prostanoid receptor (DP) and PD2R2 (CRTH2). PD2R2 couples to the G protein G(i/o) type which leads to a reduction in intracellular cAMP levels and an increase in intracellular calcium. GPR1 is an orphan receptor that can be activated by the leukocyte chemoattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1.


Pssm-ID: 320105 [Multi-domain]  Cd Length: 274  Bit Score: 50.76  E-value: 2.27e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   6 RDSKYRSSETKRInvmLLSIVVAFAVCWLPLTIFNTVfDWNHqiiATCNHNLLFL---LCHLTAMISTCVNPIFYGFLNK 82
Cdd:cd14974   196 RKRLAKSSKPLRV---LLAVVVAFFLCWLPYHVFALL-ELVA---AAGLPEVVLLglpLATGLAYFNSCLNPILYVFMGQ 268

                  ....
gi 1958683498  83 NFQR 86
Cdd:cd14974   269 DFRK 272
7tmA_Delta_opioid_R cd15089
opioid receptor subtype delta, member of the class A family of seven-transmembrane G ...
5-86 2.53e-08

opioid receptor subtype delta, member of the class A family of seven-transmembrane G protein-coupled receptors; The delta-opioid receptor binds the endogenous pentapeptide ligands such as enkephalins and produces antidepressant-like effects. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320217 [Multi-domain]  Cd Length: 281  Bit Score: 50.72  E-value: 2.53e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   5 IRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVF-----DWNHQIIATCNHnllflLCHLTAMISTCVNPIFYGF 79
Cdd:cd15089   198 LSGSKEKDRNLRRITRMVLVVVAAFIICWTPIHIFVIVWtlvdiDRRNPLVVAALH-----LCIALGYANSSLNPVLYAF 272

                  ....*..
gi 1958683498  80 LNKNFQR 86
Cdd:cd15089   273 LDENFKR 279
7tmA_capaR cd15134
neuropeptide capa receptor and similar invertebrate proteins, member of the class A family of ...
5-86 3.16e-08

neuropeptide capa receptor and similar invertebrate proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; CapaR is a G-protein coupled receptor for the Drosophila melanogaster capa neuropeptides (Drm-capa-1 and -2), which act on the Malpighian tubules to increase fluid transport. The capa peptides are evolutionarily related to vertebrate Neuromedin U neuropeptide and contain a C-terminal FPRXamide motif. CapaR regulates fluid homeostasis through its ligands, thereby acts as a desiccation stress-responsive receptor. CapaR undergoes desensitization, with internalization mediated by beta-arrestin-2.


Pssm-ID: 320262 [Multi-domain]  Cd Length: 298  Bit Score: 50.79  E-value: 3.16e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   5 IRDSKYRSSETKRINVMLLSIVVAFAVCWLP------LTIFNTVFDWNHQIIatcnHNLLFLLCHLTAMISTCVNPIFYG 78
Cdd:cd15134   213 VSGGRRSSQSRRTVLRMLVAVVVAFFICWAPfhaqrlLTVYAKNMTPPYLFI----NRILFYISGVLYYVSSTVNPILYN 288

                  ....*...
gi 1958683498  79 FLNKNFQR 86
Cdd:cd15134   289 VMSAKYRQ 296
7tmA_ACKR3_CXCR7 cd14987
CXC chemokine receptor 7, member of the class A family of seven-transmembrane G ...
21-88 3.42e-08

CXC chemokine receptor 7, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR3, also known as CXCR7, is an atypical chemokine receptor for CXCL12 and CXCR11. Unlike the classical chemokine receptors, ACKR3 contains a DRYLSIT-sequence instead of the conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. Thus, ACKR3 does not activate classical GPCR signaling, instead induces beta-arrestin recruitment which is leading to ligand internalization and MAP-kinase activation. It is acting as a scavenger for CXCL12 and, to a lesser degree, for CXCL11. ACKR3 is highly expressed by blood vascular endothelial cells in brain, in numerous embryonic and neonatal tissues, in inflamed tissues and in a variety of cancers such as lymphomas, sarcomas, prostate and breast cancers, and gliomas. Five receptors have been identified for the ACKR family, including CC-Chemokine Receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, DARC, and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320118 [Multi-domain]  Cd Length: 282  Bit Score: 50.53  E-value: 3.42e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1958683498  21 MLLSIVVAFAVCWLP--LTIFNTVFDWNHQIIATCN-HNLLFLLCHLT---AMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd14987   209 IIFSYVVVFLVCWLPyhTVVLLDILSFLHLIPFSCQlENFLYAALHVTqcfSLVHCCVNPILYSFINRNYRYEL 282
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
16-86 4.41e-08

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098 [Multi-domain]  Cd Length: 259  Bit Score: 49.87  E-value: 4.41e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHqiiATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd14967   190 LKAAKTLAIIVGAFLLCWLPFFIIYLVSAFCP---PDCVPPILYAVFFWLGYLNSALNPIIYALFNRDFRR 257
7tmA_TACR cd15390
neurokinin receptors (or tachykinin receptors), member of the class A family of ...
16-84 4.81e-08

neurokinin receptors (or tachykinin receptors), member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents G-protein coupled receptors for a variety of neuropeptides of the tachykinin (TK) family. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320512 [Multi-domain]  Cd Length: 289  Bit Score: 49.99  E-value: 4.81e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFnTVFDWNHQIIATCNH-NLLFLLCHLTAMISTCVNPIFYGFLNKNF 84
Cdd:cd15390   217 RKVVKMMIVVVVIFAICWLPYHLY-FILTYLYPDINSWKYiQQIYLAIYWLAMSNSMYNPIIYCWMNKRF 285
7tmA_GPR151 cd15002
G protein-coupled receptor 151, member of the class A family of seven-transmembrane G ...
16-88 4.97e-08

G protein-coupled receptor 151, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor 151 (GRP151) is an orphan receptor of unknown function. Its expression is conserved in habenular axonal projections of vertebrates and may be a promising novel target for psychiatric drug development. GPR151 shows high sequence similarity with galanin receptors (GALR). GPR151 is a member of the class A rhodopsin-like GPCRs, which represent a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320133 [Multi-domain]  Cd Length: 280  Bit Score: 50.10  E-value: 4.97e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFnTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15002   209 RKLTHMLLSVVLAFTILWLPEWVA-WLWLIHIKSSGSSPPQLFNVLAQLLAFSISSVNPIIFLLMSEEFREGF 280
7tmA_CCK-BR cd15979
cholecystokinin receptor type B, member of the class A family of seven-transmembrane G ...
16-88 5.73e-08

cholecystokinin receptor type B, member of the class A family of seven-transmembrane G protein-coupled receptors; Cholecystokinin receptors (CCK-AR and CCK-BR) are a group of G-protein coupled receptors which bind the peptide hormones cholecystokinin (CCK) or gastrin. CCK, which facilitates digestion in the small intestine, and gastrin, a major regulator of gastric acid secretion, are highly similar peptides. Like gastrin, CCK is a naturally-occurring linear peptide that is synthesized as a preprohormone, then proteolytically cleaved to form a family of peptides with the common C-terminal sequence (Gly-Trp-Met-Asp-Phe-NH2), which is required for full biological activity. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors.


Pssm-ID: 320645 [Multi-domain]  Cd Length: 275  Bit Score: 49.81  E-value: 5.73e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNT--VFDWNHQIIATCNHNLLFLlcHLTAMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15979   203 KRVIRMLVVIVAMFFLCWLPIFSANTwrAFDPLSAHRALSGAPISFI--HLLSYTSACVNPLVYCFMNRRFRKAF 275
7tmA_Mel1B cd15400
melatonin receptor subtype 1B, member of the class A family of seven-transmembrane G ...
20-87 6.22e-08

melatonin receptor subtype 1B, member of the class A family of seven-transmembrane G protein-coupled receptors; Melatonin (N-acetyl-5-methoxytryptamine) is a naturally occurring sleep-promoting chemical found in vertebrates, invertebrates, bacteria, fungi, and plants. In mammals, melatonin is secreted by the pineal gland and is involved in regulation of circadian rhythms. Its production peaks during the nighttime, and is suppressed by light. Melatonin is shown to be synthesized in other organs and cells of many vertebrates, including the Harderian gland, leukocytes, skin, and the gastrointestinal (GI) tract, which contains several hundred times more melatonin than the pineal gland and is involved in the regulation of GI motility, inflammation, and sensation. Melatonin exerts its pleiotropic physiological effects through specific membrane receptors, named MT1A, MT1B, and MT1C, which belong to the class A rhodopsin-like G-protein coupled receptor family. MT1A and MT1B subtypes are present in mammals, whereas MT1C subtype has been found in amphibians and birds. The melatonin receptors couple to G proteins of the G(i/o) class, leading to the inhibition of adenylate cyclase.


Pssm-ID: 320522 [Multi-domain]  Cd Length: 279  Bit Score: 49.85  E-value: 6.22e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  20 VMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRD 87
Cdd:cd15400   211 LTMFVVFVIFAICWAPLNLIGLAVAINPQEMAPKVPEWLFVVSYFMAYFNSCLNAIIYGLLNQNFRKE 278
7tmA_GPR84-like cd15210
G protein-coupled receptor 84 and similar proteins, member of the class A family of ...
10-86 6.84e-08

G protein-coupled receptor 84 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR84, also known as the inflammation-related G-Protein coupled receptor EX33, is a receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Among these medium-chain FFAs, capric acid (C10:0), undecanoic acid (C11:0), and lauric acid (C12:0) are the most potent endogenous agonists of GPR84, whereas short-chain and long-chain saturated and unsaturated FFAs do not activate this receptor. GPR84 contains a [G/N]RY-motif instead of the highly conserved Asp-Arg-Tyr (DRY) motif found in the third transmembrane helix (TM3) of the rhodopsin-like class A receptors and important for efficient G protein-coupled signal transduction. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, which then activate the heterotrimeric G proteins. In the case of GPR84, activation of the receptor couples to a pertussis toxin sensitive G(i/o)-protein pathway. GPR84 knockout mice showed increased Th2 cytokine production including IL-4, IL-5, and IL-13 compared to wild-type mice. It has been also shown that activation of GPR84 augments lipopolysaccharide-stimulated IL-8 production in polymorphonuclear leukocytes and TNF-alpha production in macrophages, suggesting that GPR84 may function as a proinflammatory receptor.


Pssm-ID: 320338 [Multi-domain]  Cd Length: 254  Bit Score: 49.57  E-value: 6.84e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1958683498  10 YRSSETKRINVMLLSIVVAFAVCWLPLTIFNtVFDWN--HQIIATCNHNLLFLlchltamiSTCVNPIFYGFLNKNFQR 86
Cdd:cd15210   183 YARREDRRLTRMMLVIFLCFLVCYLPITLVN-VFDDEvaPPVLHIIAYVLIWL--------SSCINPIIYVAMNRQYRQ 252
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
11-88 7.86e-08

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341318 [Multi-domain]  Cd Length: 283  Bit Score: 49.57  E-value: 7.86e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  11 RSSETKRINVMLLSIVVAFAVCWLPLTIFNTV-FDWNHQIIATCN-HNLLFLLCHLT---AMISTCVNPIFYGFLNKNFQ 85
Cdd:cd14982   201 KSVRKRKALRMILIVLAVFLVCFLPYHVTRILyLLVRLSFIADCSaRNSLYKAYRITlclASLNSCLDPLIYYFLSKTFR 280

                  ...
gi 1958683498  86 RDL 88
Cdd:cd14982   281 KRL 283
7tmA_Mel1 cd15209
melatonin receptor 1, member of the class A family of seven-transmembrane G protein-coupled ...
20-87 7.96e-08

melatonin receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Melatonin (N-acetyl-5-methoxytryptamine) is a naturally occurring sleep-promoting chemical found in vertebrates, invertebrates, bacteria, fungi, and plants. In mammals, melatonin is secreted by the pineal gland and is involved in regulation of circadian rhythms. Its production peaks during the nighttime, and is suppressed by light. Melatonin is shown to be synthesized in other organs and cells of many vertebrates, including the Harderian gland, leukocytes, skin, and the gastrointestinal (GI) tract, which contains several hundred times more melatonin than the pineal gland and is involved in the regulation of GI motility, inflammation, and sensation. Melatonin exerts its pleiotropic physiological effects through specific membrane receptors, named MT1A, MT1B, and MT1C, which belong to the class A rhodopsin-like G-protein coupled receptor family. MT1A and MT1B subtypes are present in mammals, whereas MT1C subtype has been found in amphibians and birds. The melatonin receptors couple to G proteins of the G(i/o) class, leading to the inhibition of adenylate cyclase.


Pssm-ID: 320337 [Multi-domain]  Cd Length: 279  Bit Score: 49.39  E-value: 7.96e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  20 VMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRD 87
Cdd:cd15209   211 LTMFVVFVLFAVCWAPLNFIGLAVAINPKEMAPKIPEWLFVASYFMAYFNSCLNAIIYGLLNQNFRKE 278
7tmA_SSTR5 cd15974
somatostatin receptor type 5, member of the class A family of seven-transmembrane G ...
8-86 1.31e-07

somatostatin receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR5 is coupled to inward rectifying K channels and phospholipase C, and plays critical roles in growth hormone and insulin secretion. SSTR5 acts as a negative regulator of PDX-1 (pancreatic and duodenal homeobox-1) expression, which is a conserved homeodomain-containing beta cell-specific transcription factor essentially involved in pancreatic development, among many other functions.


Pssm-ID: 320640 [Multi-domain]  Cd Length: 277  Bit Score: 48.64  E-value: 1.31e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   8 SKYRSSEtKRINVMLLSIVVAFAVCWLP---LTIFNTVFDWNHQIIATcnhNLLFLLCHLTaMISTCVNPIFYGFLNKNF 84
Cdd:cd15974   199 TKRRKSE-RKVTRMVVIIVVVFVFCWLPfymLNIVNLIVILPEEPAFV---GVYFFVVVLS-YANSCANPILYGFLSDNF 273

                  ..
gi 1958683498  85 QR 86
Cdd:cd15974   274 KQ 275
7tmA_SSTR1 cd15970
somatostatin receptor type 1, member of the class A family of seven-transmembrane G ...
11-86 1.75e-07

somatostatin receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR1 is coupled to a Na/H exchanger, voltage-dependent calcium channels, and AMPA/kainate glutamate channels. SSTR1 is expressed in the normal human pituitary and in nearly half of all pituitary adenoma subtypes.


Pssm-ID: 320636 [Multi-domain]  Cd Length: 276  Bit Score: 48.37  E-value: 1.75e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1958683498  11 RSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHnllflLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15970   204 RKRSERKITLMVMMVVTVFVICWMPFYVVQLVSVFVGQHDATVSQ-----LSVILGYANSCANPILYGFLSDNFKR 274
7tmA_Mu_opioid_R cd15090
opioid receptor subtype mu, member of the class A family of seven-transmembrane G ...
5-86 2.14e-07

opioid receptor subtype mu, member of the class A family of seven-transmembrane G protein-coupled receptors; The mu-opioid receptor binds endogenous opioids such as beta-endorphin and endomorphin. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320218 [Multi-domain]  Cd Length: 279  Bit Score: 48.07  E-value: 2.14e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   5 IRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFnTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNF 84
Cdd:cd15090   197 LSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIY-VIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENF 275

                  ..
gi 1958683498  85 QR 86
Cdd:cd15090   276 KR 277
7tmA_QRFPR cd15205
pyroglutamylated RFamide peptide receptor, member of the class A family of seven-transmembrane ...
16-87 2.96e-07

pyroglutamylated RFamide peptide receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that belongs to a family of neuropeptides containing an Arg-Phe-NH2 (RFamide) motif at its C-terminus. 26Rfa/QRFP exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103.


Pssm-ID: 320333 [Multi-domain]  Cd Length: 298  Bit Score: 47.85  E-value: 2.96e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWN--HQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRD 87
Cdd:cd15205   224 KRAVKMMVTVVLLFAVCWAPFHVVHMMIEYSnlENKYDGVTIKLIFAIVQLIGFSNSFNNPIVYAFMNENFKKN 297
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
14-86 5.49e-07

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 341320 [Multi-domain]  Cd Length: 284  Bit Score: 46.99  E-value: 5.49e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  14 ETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNH-QIIATCNH----NLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd14985   205 KRRKSLKIIFALVVAFLVCWLPFHFFKFLDFLAQlGAIRPCFWelflDLGLPIATCLAFTNSCLNPFIYVFVDRRFRQ 282
7tmA_Gal1_R cd15098
galanin receptor subtype 1, member of the class A family of seven-transmembrane G ...
1-87 7.91e-07

galanin receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320226 [Multi-domain]  Cd Length: 282  Bit Score: 46.64  E-value: 7.91e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   1 MMDKIRDSKyrssetKRINVMLLSIVVAFAVCWLPltifntvfdwnHQIIA----------TCNHNLLFLLCHLTAMIST 70
Cdd:cd15098   202 MSKKSERSK------KKTAQTVLVVVVVFGISWLP-----------HHIIHlwvefgdfplTQASFVLRITAHCLAYANS 264
                          90
                  ....*....|....*..
gi 1958683498  71 CVNPIFYGFLNKNFQRD 87
Cdd:cd15098   265 CVNPIIYAFLSENFRKA 281
7tmA_Parietopsin cd15085
non-visual parietopsins, member of the class A family of seven-transmembrane G protein-coupled ...
9-85 9.84e-07

non-visual parietopsins, member of the class A family of seven-transmembrane G protein-coupled receptors; Parietopsin is a non-visual green light-sensitive opsin that was initially identified in the parietal eye of lizards. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extra-retinal tissues and/or in non-rod, non-cone retinal cells. They are thought to be involved in light-dependent physiological functions such as photo-entrainment of circadian rhythm, photoperiodicity and body color change. Parietopsin belongs to the class A of the G protein-coupled receptors and shows strong homology to the vertebrate visual opsins.


Pssm-ID: 320213 [Multi-domain]  Cd Length: 280  Bit Score: 46.38  E-value: 9.84e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1958683498   9 KYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATcnhNLLFLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15085   204 KNCPEEEERAVIMVLAMVIAFLICWLPYTVFALIVVVNPELSIS---PLAATMPTYFAKTSPVYNPIIYIFLNKQFR 277
7tmA_Mel1A cd15402
melatonin receptor subtype 1A, member of the class A family of seven-transmembrane G ...
20-87 1.03e-06

melatonin receptor subtype 1A, member of the class A family of seven-transmembrane G protein-coupled receptors; Melatonin (N-acetyl-5-methoxytryptamine) is a naturally occurring sleep-promoting chemical found in vertebrates, invertebrates, bacteria, fungi, and plants. In mammals, melatonin is secreted by the pineal gland and is involved in regulation of circadian rhythms. Its production peaks during the nighttime, and is suppressed by light. Melatonin is shown to be synthesized in other organs and cells of many vertebrates, including the Harderian gland, leukocytes, skin, and the gastrointestinal (GI) tract, which contains several hundred times more melatonin than the pineal gland and is involved in the regulation of GI motility, inflammation, and sensation. Melatonin exerts its pleiotropic physiological effects through specific membrane receptors, named MT1A, MT1B, and MT1C, which belong to the class A rhodopsin-like G-protein coupled receptor family. MT1A and MT1B subtypes are present in mammals, whereas MT1C subtype has been found in amphibians and birds. The melatonin receptors couple to G proteins of the G(i/o) class, leading to the inhibition of adenylate cyclase.


Pssm-ID: 320524 [Multi-domain]  Cd Length: 279  Bit Score: 46.44  E-value: 1.03e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  20 VMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRD 87
Cdd:cd15402   211 VTMFVVFVLFAVCWAPLNFIGLAVAVDPETIVPRIPEWLFVASYYMAYFNSCLNAIIYGLLNQNFRRE 278
7tmA_NOFQ_opioid_R cd15092
nociceptin/orphanin FQ peptide receptor, member of the class A family of seven-transmembrane G ...
8-86 1.14e-06

nociceptin/orphanin FQ peptide receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The nociceptin (NOP) receptor binds nociceptin or orphanin FQ, a 17 amino acid endogenous neuropeptide. The NOP receptor is involved in the modulation of various brain activities including instinctive and emotional behaviors. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320220 [Multi-domain]  Cd Length: 279  Bit Score: 46.01  E-value: 1.14e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   8 SKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNhnlLFLLCHLTAM--ISTCVNPIFYGFLNKNFQ 85
Cdd:cd15092   200 SKEKDRNLRRITRLVLVVVAVFVGCWTPIQIFVLAQGLGVQPSSETA---VAILRFCTALgyVNSSLNPVLYAFLDENFK 276

                  .
gi 1958683498  86 R 86
Cdd:cd15092   277 A 277
7tmA_Mel1C cd15401
melatonin receptor subtype 1C, member of the class A family of seven-transmembrane G ...
6-87 1.17e-06

melatonin receptor subtype 1C, member of the class A family of seven-transmembrane G protein-coupled receptors; Melatonin (N-acetyl-5-methoxytryptamine) is a naturally occurring sleep-promoting chemical found in vertebrates, invertebrates, bacteria, fungi, and plants. In mammals, melatonin is secreted by the pineal gland and is involved in regulation of circadian rhythms. Its production peaks during the nighttime, and is suppressed by light. Melatonin is shown to be synthesized in other organs and cells of many vertebrates, including the Harderian gland, leukocytes, skin, and the gastrointestinal (GI) tract, which contains several hundred times more melatonin than the pineal gland and is involved in the regulation of GI motility, inflammation, and sensation. Melatonin exerts its pleiotropic physiological effects through specific membrane receptors, named MT1A, MT1B, and MT1C, which belong to the class A rhodopsin-like G-protein coupled receptor family. MT1A and MT1B subtypes are present in mammals, whereas MT1C subtype has been found in amphibians and birds. The melatonin receptors couple to G proteins of the G(i/o) class, leading to the inhibition of adenylate cyclase.


Pssm-ID: 320523 [Multi-domain]  Cd Length: 279  Bit Score: 46.06  E-value: 1.17e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   6 RDSKYRSSETKRINVMLLSIV-VAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNF 84
Cdd:cd15401   196 QDSKQKLKANDIRNFLTMFVVfVLFAVCWGPLNFIGLAVAINPLKVAPKIPEWLFVLSYFMAYFNSCLNAVIYGVLNQNF 275

                  ...
gi 1958683498  85 QRD 87
Cdd:cd15401   276 RKE 278
7tmA_GHSR-like cd15928
growth hormone secretagogue receptor, motilin receptor, and related proteins, member of the ...
8-85 1.21e-06

growth hormone secretagogue receptor, motilin receptor, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes growth hormone secretagogue receptor (GHSR or ghrelin receptor), motilin receptor (also called GPR38), and related proteins. Both GHSR and GPR38 bind peptide hormones. Ghrelin, the endogenous ligand for GHSR, is an acylated 28-amino acid peptide hormone produced by ghrelin cells in the gastrointestinal tract. Ghrelin is also called the hunger hormone and is involved in the regulation of growth hormone release, appetite and feeding, gut motility, lipid and glucose metabolism, and energy balance. Motilin, the ligand for GPR38, is a 22 amino acid peptide hormone expressed throughout the gastrointestinal tract and stimulates contraction of gut smooth muscle. It is involved in the regulation of digestive tract motility.


Pssm-ID: 320594 [Multi-domain]  Cd Length: 288  Bit Score: 45.94  E-value: 1.21e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   8 SKYRSSETKRINVMLLSIVVAFAVCWLPL----TIFNTVFDWNHQIIATCNH-NLL-FLLCHLTAMIstcvNPIFYGFLN 81
Cdd:cd15928   206 ASRRDNNHRQTVRMLAVIVLAFVLCWLPFhvgrVIFNHSRASTKHLHYVSQYfNLVsFVLFYLSAAI----NPILYNLMS 281

                  ....
gi 1958683498  82 KNFQ 85
Cdd:cd15928   282 KRYR 285
7tmA_NMU-R2 cd15357
neuromedin U receptor subtype 2, member of the class A family of seven-transmembrane G ...
16-85 1.38e-06

neuromedin U receptor subtype 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuromedin U (NMU) is a highly conserved neuropeptide with a common C-terminal heptapeptide sequence (FLFRPRN-amide) found at the highest levels in the gastrointestinal tract and pituitary gland of mammals. Disruption or replacement of residues in the conserved heptapeptide region can result in the reduced ability of NMU to stimulate smooth-muscle contraction. Two G-protein coupled receptor subtypes, NMU-R1 and NMU-R2, with a distinct expression pattern, have been identified to bind NMU. NMU-R1 is expressed primarily in the peripheral nervous system, while NMU-R2 is mainly found in the central nervous system. Neuromedin S, a 36 amino-acid neuropeptide that shares a conserved C-terminal heptapeptide sequence with NMU, is a highly potent and selective NMU-R2 agonist. Pharmacological studies have shown that both NMU and NMS inhibit food intake and reduce body weight, and that NMU increases energy expenditure.


Pssm-ID: 320479 [Multi-domain]  Cd Length: 293  Bit Score: 46.01  E-value: 1.38e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTI----FNTVFDWNHQIIATcnHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15357   219 KSVTKMLFVLVLVFAICWAPFHVdrlfFSFVVEWTEPLANV--FNLIHVVSGVFFYLSSAVNPIIYNLLSRRFR 290
7tmA_AT1R cd15192
type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
4-88 1.73e-06

type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 320320 [Multi-domain]  Cd Length: 285  Bit Score: 45.50  E-value: 1.73e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   4 KIRDSKYRSSETKRinvMLLSIVVAFAVCWLPLTIFnTVFDWNHQ--IIATC------NHNLLFLLChlTAMISTCVNPI 75
Cdd:cd15192   199 EIQRNKPRNDEIFK---MIMAVVLFFFFCWIPHQIF-TFLDVLIQlkVIQDChiadivDTAMPFTIC--IAYFNSCLNPI 272
                          90
                  ....*....|...
gi 1958683498  76 FYGFLNKNFQRDL 88
Cdd:cd15192   273 LYGFVGKNFRKKF 285
7tmA_Bombesin_R-like cd15927
bombesin receptor subfamily, member of the class A family of seven-transmembrane G ...
16-86 2.14e-06

bombesin receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; This bombesin subfamily of G-protein coupled receptors consists of neuromedin B receptor (NMBR), gastrin-releasing peptide receptor (GRPR), and bombesin receptor subtype 3 (BRS-3). Bombesin is a tetradecapeptide, originally isolated from frog skin. Mammalian bombesin-related peptides are widely distributed in the gastrointestinal and central nervous systems. The bombesin family receptors couple mainly to the G proteins of G(q/11) family. NMBR functions as the receptor for the neuropeptide neuromedin B, a potent mitogen and growth factor for normal and cancerous lung and for gastrointestinal epithelial tissues. Gastrin-releasing peptide is an endogenous ligand for GRPR and shares high sequence homology with NMB in the C-terminal region. Both NMB and GRP possess bombesin-like biochemical properties. BRS-3 is classified as an orphan receptor and suggested to play a role in sperm cell division and maturation. BRS-3 interacts with known naturally-occurring bombesin-related peptides with low affinity; however, no endogenous high-affinity ligand to the receptor has been identified. The bombesin receptor family belongs to the seven transmembrane rhodopsin-like G-protein coupled receptors (class A GPCRs), which perceive extracellular signals and transduce them to guanine nucleotide-binding (G) proteins.


Pssm-ID: 320593 [Multi-domain]  Cd Length: 294  Bit Score: 45.34  E-value: 2.14e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCN--HNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15927   220 KKVAKTVLAFVVLFAVCWLPRHVFMLWFHFAPNGLVDYNafWHVLKIVGFCLSFINSCVNPVALYLLSGSFRR 292
7tmA_Opsins_type2_animals cd14969
type 2 opsins in animals, member of the class A family of seven-transmembrane G ...
16-86 2.28e-06

type 2 opsins in animals, member of the class A family of seven-transmembrane G protein-coupled receptors; This rhodopsin family represents the type 2 opsins found in vertebrates and invertebrates except sponge. Type 2 opsins primarily function as G protein coupled receptors and are responsible for vision as well as for circadian rhythm and pigment regulation. On the contrary, type 1 opsins such as bacteriorhodopsin and proteorhodopsin are found in both prokaryotic and eukaryotic microbes, functioning as light-gated ion channels, proton pumps, sensory receptors and in other unknown functions. Although these two opsin types share seven-transmembrane domain topology and a conserved lysine reside in the seventh helix, type 1 opsins do not activate G-proteins and are not evolutionarily related to type 2. Type 2 opsins can be classified into six distinct subfamilies including the vertebrate opsins/encephalopsins, the G(o) opsins, the G(s) opsins, the invertebrate G(q) opsins, the photoisomerases, and the neuropsins.


Pssm-ID: 381741 [Multi-domain]  Cd Length: 284  Bit Score: 45.27  E-value: 2.28e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFN--TVFDWNHQIiatcnHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd14969   215 KKVAKMVLVMIVAFLIAWTPYAVVSlyVSFGGESTI-----PPLLATIPALFAKSSTIYNPIIYVFMNKQFRR 282
7tmA_SSTR2 cd15971
somatostatin receptor type 2, member of the class A family of seven-transmembrane G ...
4-86 2.81e-06

somatostatin receptor type 2, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin, a polypeptide hormone that regulates a wide variety of physiological such as neurotransmission, endocrine secretion, cell proliferation, and smooth muscle contractility. SSTRs are composed of five distinct subtypes (SSTR1-5) which are encoded by separate genes on different chromosomes. SSTR2 plays critical roles in growth hormone secretion, glucagon secretion, and immune responses. SSTR2 is expressed in the normal human pituitary and in nearly all pituitary growth hormone adenomas.


Pssm-ID: 320637 [Multi-domain]  Cd Length: 279  Bit Score: 44.83  E-value: 2.81e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   4 KIRDSKYRSSEtKRINVMLLSIVVAFAVCWLPLTIFNtVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKN 83
Cdd:cd15971   197 RVGSSKRKKSE-KKVTRMVSIVVAVFVFCWLPFYIFN-VSSVSVSISPTPGLKGMFDFVVVLSYANSCANPILYAFLSDN 274

                  ...
gi 1958683498  84 FQR 86
Cdd:cd15971   275 FKK 277
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
11-88 2.89e-06

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 341319 [Multi-domain]  Cd Length: 278  Bit Score: 44.90  E-value: 2.89e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  11 RSSETKRINVMLLSIVVAFAVCWLP--LTIFNTVFDWNHQIIATCNHN----LLFLLCHLTAMISTCVNPIFYGFLNKNF 84
Cdd:cd14984   195 RNHKKHRALRVIFAVVVVFFLCWLPynIVLLLDTLQLLGIISRSCELSksldYALQVTESLAFSHCCLNPVLYAFVGVKF 274

                  ....
gi 1958683498  85 QRDL 88
Cdd:cd14984   275 RKYL 278
7tmA_OXR cd15208
orexin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
21-86 3.08e-06

orexin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Orexins (OXs, also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. Thus, activation of OX1R or OX2R will activate phospholipase activity and the phosphatidylinositol and calcium signaling pathways. Additionally, OX2R activation can also lead to inhibition of adenylate cyclase.


Pssm-ID: 320336 [Multi-domain]  Cd Length: 303  Bit Score: 45.07  E-value: 3.08e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1958683498  21 MLLSIVVAFAVCWLPLTIFNT---VFDWNHQIIATCnhNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15208   235 MLIVVVIMFAICYLPVHLLNIlryVFGLFTVDRETI--YAWFLFSHWLVYANSAINPIIYNFMSGKFRE 301
7tmA_SSTR3 cd15972
somatostatin receptor type 3, member of the class A family of seven-transmembrane G ...
8-86 3.34e-06

somatostatin receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR3 is coupled to inward rectifying potassium channels. SSTR3 plays critical roles in growth hormone secretion, endothelial cell cycle arrest and apoptosis. Furthermore, SSTR3 is expressed in the normal human pituitary and in nearly half of pituitary growth hormone adenomas.


Pssm-ID: 320638 [Multi-domain]  Cd Length: 279  Bit Score: 44.79  E-value: 3.34e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   8 SKYRSSEtKRINVMLLSIVVAFAVCWLPLTIFNTVfdwnhQIIATC----NHNLLFLLCHLTAMISTCVNPIFYGFLNKN 83
Cdd:cd15972   201 TKRRGSE-RKVTRMVVIVVAAFVLCWLPFYALNIV-----NLVCPLpeepSLFGLYFFVVVLSYANSCANPIIYGFLSDN 274

                  ...
gi 1958683498  84 FQR 86
Cdd:cd15972   275 FKQ 277
7tmA_Adenosine_R cd14968
adenosine receptor subfamily, member of the class A family of seven-transmembrane G ...
22-86 3.38e-06

adenosine receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; The adenosine receptors (or P1 receptors), a family of G protein-coupled purinergic receptors, bind adenosine as their endogenous ligand. There are four types of adenosine receptors in human, designated as A1, A2A, A2B, and A3. Each type is encoded by a different gene and has distinct functions with some overlap. For example, both A1 and A2A receptors are involved in regulating myocardial oxygen consumption and coronary blood flow in the heart, while the A2A receptor also has a broad spectrum of anti-inflammatory effects in the body. These two receptors also expressed in the brain, where they have important roles in the release of other neurotransmitters such as dopamine and glutamate, while the A2B and A3 receptors found primarily in the periphery and play important roles in inflammation and immune responses. The A1 and A3 receptors preferentially interact with G proteins of the G(i/o) family, thereby lowering the intracellular cAMP levels, whereas the A2A and A2B receptors interact with G proteins of the G(s) family, activating adenylate cyclase to elevate cAMP levels.


Pssm-ID: 341316 [Multi-domain]  Cd Length: 285  Bit Score: 44.94  E-value: 3.38e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1958683498  22 LLSIVVAFAVCWLPLTIFNTVFDWNhqiiATCN-HNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd14968   222 LAIILFLFALCWLPLHIINCITLFC----PECKvPKILTYIAILLSHANSAVNPIVYAYRIRKFRQ 283
7tmA_NMU-R cd15133
neuromedin U receptors, member of the class A family of seven-transmembrane G protein-coupled ...
16-85 3.78e-06

neuromedin U receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuromedin U (NMU) is a highly conserved neuropeptide with a common C-terminal heptapeptide sequence (FLFRPRN-amide) found at the highest levels in the gastrointestinal tract and pituitary gland of mammals. Disruption or replacement of residues in the conserved heptapeptide region can result in the reduced ability of NMU to stimulate smooth-muscle contraction. Two G-protein coupled receptor subtypes, NMU-R1 and NMU-R2, with a distinct expression pattern, have been identified to bind NMU. NMU-R1 is expressed primarily in the peripheral nervous system, while NMU-R2 is mainly found in the central nervous system. Neuromedin S, a 36 amino-acid neuropeptide that shares a conserved C-terminal heptapeptide sequence with NMU, is a highly potent and selective NMU-R2 agonist. Pharmacological studies have shown that both NMU and NMS inhibit food intake and reduce body weight, and that NMU increases energy expenditure.


Pssm-ID: 320261 [Multi-domain]  Cd Length: 298  Bit Score: 44.83  E-value: 3.78e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTI----FNTVFDWnhqiiaTCNHNLLFLLCHLTA----MISTCVNPIFYGFLNKNFQ 85
Cdd:cd15133   224 AQVTKMLFILVVVFAICWAPFHIdrlmWSFISDW------TDNLHEVFQYVHIISgvffYLSSAVNPILYNLMSTRFR 295
7tmA_CCK-AR cd15978
cholecystokinin receptor type A, member of the class A family of seven-transmembrane G ...
16-85 4.21e-06

cholecystokinin receptor type A, member of the class A family of seven-transmembrane G protein-coupled receptors; Cholecystokinin receptors (CCK-AR and CCK-BR) are a group of G-protein coupled receptors which bind the peptide hormones cholecystokinin (CCK) or gastrin. CCK, which facilitates digestion in the small intestine, and gastrin, a major regulator of gastric acid secretion, are highly similar peptides. Like gastrin, CCK is a naturally-occurring linear peptide that is synthesized as a preprohormone, then proteolytically cleaved to form a family of peptides with the common C-terminal sequence (Gly-Trp-Met-Asp-Phe-NH2), which is required for full biological activity. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors.


Pssm-ID: 320644 [Multi-domain]  Cd Length: 278  Bit Score: 44.48  E-value: 4.21e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNT--VFDWNHQIIATCNHNLLFLlcHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15978   206 KRVIRMLIVIVILFFLCWTPIFSANAwrAFDTRSADRLLSGAPISFI--HLLSYTSACVNPIIYCFMNKRFR 275
7tmA_NKR_NK3R cd16003
neuromedin-K receptor, member of the class A family of seven-transmembrane G protein-coupled ...
16-85 8.38e-06

neuromedin-K receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The neuromedin-K receptor (NKR), also known as tachykinin receptor 3 (TACR3) or neurokinin B receptor or NK3R, is a G-protein coupled receptor that specifically binds to neurokinin B. The tachykinins (TKs) act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320669 [Multi-domain]  Cd Length: 282  Bit Score: 43.77  E-value: 8.38e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd16003   210 RKVVKMMIIVVLTFAICWLPYHIYFIVTGLYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFR 279
7tmA_GPR185-like cd15960
G protein-coupled receptor 185 and similar proteins, member of the class A family of ...
17-88 9.93e-06

G protein-coupled receptor 185 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR185, also called GPRx, is a member of the constitutively active GPR3/6/12 subfamily of G protein-coupled receptors. It plays a role in the maintenance of meiotic arrest in Xenopus laevis oocytes through G(s) protein, which leads to increased cAMP levels. In Xenopus laevis, GPR185 is primarily expressed in brain, ovary, and testis; however, its ortholog has not been identified in other vertebrate genomes. GPR3, GPR6, and GPR12 form a subfamily of constitutively active G-protein coupled receptors with dual coupling to G(s) and G(i) proteins. These three orphan receptors are involved in the regulation of cell proliferation and survival, neurite outgrowth, cell clustering, and maintenance of meiotic prophase arrest.


Pssm-ID: 320626 [Multi-domain]  Cd Length: 268  Bit Score: 43.35  E-value: 9.93e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1958683498  17 RINVMLLSIVVA-FAVCWLPLTIFNTVFDWNHQIIATcnhnllfllcHLTAMISTC---VNPIFYGFLNKNFQRDL 88
Cdd:cd15960   203 RKGVSTLSLILAtFAFCWVPFAVYSMVADSSYPMIYT----------YYLVLPAACnsvINPIIYAFRNPDIQKSL 268
7tmA_Kappa_opioid_R cd15091
opioid receptor subtype kappa, member of the class A family of seven-transmembrane G ...
8-86 1.24e-05

opioid receptor subtype kappa, member of the class A family of seven-transmembrane G protein-coupled receptors; The kappa-opioid receptor binds the opioid peptide dynorphin as the primary endogenous ligand. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320219 [Multi-domain]  Cd Length: 282  Bit Score: 43.02  E-value: 1.24e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   8 SKYRSSETKRINVMLLSIVVAFAVCWLPLTIF---NTVFDWNHQIIATCNhnllFLLCHLTAMISTCVNPIFYGFLNKNF 84
Cdd:cd15091   203 SREKDRNLRRITRLVLVVVAVFVVCWTPIHIFilvEALGSVSHSTAAVSS----YYFCIALGYTNSSLNPILYAFLDENF 278

                  ..
gi 1958683498  85 QR 86
Cdd:cd15091   279 KR 280
7tmA_NTSR-like cd14979
neurotensin receptors and related G protein-coupled receptors, member of the class A family of ...
16-86 1.37e-05

neurotensin receptors and related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes the neurotensin receptors and related G-protein coupled receptors, including neuromedin U receptors, growth hormone secretagogue receptor, motilin receptor, the putative GPR39 and the capa receptors from insects. These receptors all bind peptide hormones with diverse physiological effects. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320110 [Multi-domain]  Cd Length: 300  Bit Score: 43.11  E-value: 1.37e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPL----TIFNTVFDWNHQIIATCNHnlLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd14979   226 RQVVKMLGAVVIAFFVCWLPFhaqrLMFSYASKEDTFLFDFYQY--LYPISGILFYLSSAINPILYNLMSSRFRV 298
7tmA_SKR_NK2R cd16004
substance-K receptor, member of the class A family of seven-transmembrane G protein-coupled ...
16-85 1.46e-05

substance-K receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The substance-K receptor (SKR), also known as tachykinin receptor 2 (TACR2) or neurokinin A receptor or NK2R, is a G-protein coupled receptor that specifically binds to neurokinin A. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception.


Pssm-ID: 320670 [Multi-domain]  Cd Length: 285  Bit Score: 42.91  E-value: 1.46e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd16004   213 KKFVKTMVVVVVTFAICWLPYHLYFILGSFNEDIYCQKYIQQVYLAIFWLAMSSTMYNPIIYCCLNQRFR 282
7tmA_XCR1 cd15182
XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled ...
9-88 1.46e-05

XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; XCR1 is a chemokine receptor specific for XCL1 and XCL2 (previously called lymphotactin alpha/beta), which differ in only two amino acids. XCL1/2 is the only member of the C chemokine subfamily, which is unique as containing only two of the four cysteines that are found in other chemokine families. Human XCL1/2 has been shown to be secreted by activated CD8+ T cells and upon activation of the innate immune system. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling.


Pssm-ID: 341337 [Multi-domain]  Cd Length: 271  Bit Score: 42.73  E-value: 1.46e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   9 KYRSSETKRINVMLLSIVVAFAVCWLP--LTIFNTVFDWNHQIIATCNHNLL--FLLCHLTAMISTCVNPIFYGFLNKNF 84
Cdd:cd15182   188 RTRTMRKHRTVKLIFVIVLVFFLSWAPynIVIFLRSLKDLTIPICECSKQLDyaFYICRNIAFSHCCLNPVFYVFVGVKF 267

                  ....
gi 1958683498  85 QRDL 88
Cdd:cd15182   268 RNHL 271
7tmA_FMRFamide_R-like cd14978
FMRFamide (Phe-Met-Arg-Phe) receptors and related proteins, member of the class A family of ...
1-88 1.53e-05

FMRFamide (Phe-Met-Arg-Phe) receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Drosophila melanogaster G-protein coupled FMRFamide (Phe-Met-Arg-Phe-NH2) receptor DrmFMRFa-R and related invertebrate receptors, as well as the vertebrate proteins GPR139 and GPR142. DrmFMRFa-R binds with high affinity to FMRFamide and intrinsic FMRFamide-related peptides. FMRFamide is a neuropeptide from the family of FMRFamide-related peptides (FaRPs), which all containing a C-terminal RFamide (Arg-Phe-NH2) motif and have diverse functions in the central and peripheral nervous systems. FMRFamide is an important neuropeptide in many types of invertebrates such as insects, nematodes, molluscs, and worms. In invertebrates, the FMRFamide-related peptides are involved in the regulation of heart rate, blood pressure, gut motility, feeding behavior, and reproduction. On the other hand, in vertebrates such as mice, they play a role in the modulation of morphine-induced antinociception. Orphan receptors GPR139 and GPR142 are very closely related G protein-coupled receptors, but they have different expression patterns in the brain and in other tissues. These receptors couple to inhibitory G proteins and activate phospholipase C. Studies suggested that dimer formation may be required for their proper function. GPR142 is predominantly expressed in pancreatic beta-cells and mediates enhancement of glucose-stimulated insulin secretion, whereas GPR139 is mostly expressed in the brain and is suggested to play a role in the control of locomotor activity. Tryptophan and phenylalanine have been identified as putative endogenous ligands of GPR139.


Pssm-ID: 410630 [Multi-domain]  Cd Length: 299  Bit Score: 43.01  E-value: 1.53e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   1 MMDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFL 80
Cdd:cd14978   212 LRRRRRLLSRSQRRERRTTIMLIAVVIVFLICNLPAGILNILEAIFGESFLSPIYQLLGDISNLLVVLNSAVNFIIYCLF 291

                  ....*...
gi 1958683498  81 NKNFQRDL 88
Cdd:cd14978   292 SSKFRRTF 299
7tmA_prokineticin-R cd15204
prokineticin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
16-83 1.84e-05

prokineticin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Prokineticins 1 (PROK1) and 2 (PROK2), also known as endocrine gland vascular endothelial factor and Bombina varigata 8, respectively, are multifunctional chemokine-like peptides that are highly conserved across species. Prokineticins can bind with similar affinities to two closely homologous 7-transmembrane G protein coupled receptors, PROKR1 and PROKR2, which are phylogenetically related to the tachykinin receptors. Prokineticins and their GPCRs are widely distributed in human tissues and are involved in numerous physiological roles, including gastrointestinal motility, generation of circadian rhythms, neuron migration and survival, pain sensation, angiogenesis, inflammation, and reproduction. Moreover, different point mutations in genes encoding PROK2 or its receptor (PROKR2) can lead to Kallmann syndrome, a disease characterized by delayed or absent puberty and impaired olfactory function.


Pssm-ID: 320332 [Multi-domain]  Cd Length: 288  Bit Score: 42.65  E-value: 1.84e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL-LFLLCHLTAMISTCVNPIFYGFLNKN 83
Cdd:cd15204   215 RRKVRLLVVILTAFVLCWAPYYGYAIVRDFFPTLLSKEKLNTtIFYIVEALAMSNSMINTVVYVAFNNN 283
7tmA_CXCR1_2 cd15178
CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G ...
11-88 2.41e-05

CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR1 and CXCR2 are closely related chemotactic receptors for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. Expression of CXCR1 and CXCR2 is strictly controlled in neutrophils by external stimuli such as lipopolysaccharide (LPS), tumor necrosis factor (TNF)-alpha, Toll-like receptor agonists, and nitric oxide. CXCL8 (formerly known as interleukin-8) binds with high-affinity and activates both receptors. CXCR1 also binds CXCL7 (neutrophil-activating protein-2), whereas CXCR2 non-selectively binds to all seven ELR-positive chemokines (CXCL1-7). Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341333 [Multi-domain]  Cd Length: 279  Bit Score: 42.26  E-value: 2.41e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  11 RSSETKRINVMLLSIVVAFAVCWLP--LTIFNTVFDWNHQIIATC---NH-NLLFLLCHLTAMISTCVNPIFYGFLNKNF 84
Cdd:cd15178   196 RSFQKHRAMRVIFAVVLAFLLCWLPynVTVLIDTLMRTKLITETCelrNHvDVALYVTQILGFLHSCINPVLYAFIGQKF 275

                  ....
gi 1958683498  85 QRDL 88
Cdd:cd15178   276 RNNL 279
7tmA_Pinopsin cd15084
non-visual pinopsins, member of the class A family of seven-transmembrane G protein-coupled ...
6-85 2.81e-05

non-visual pinopsins, member of the class A family of seven-transmembrane G protein-coupled receptors; Pinopsins are found in the pineal organ of birds, reptiles and amphibians, but are absent from teleosts and mammals. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extra-retinal tissues and/or in non-rod, non-cone retinal cells. They are thought to be involved in light-dependent physiological functions such as photo-entrainment of circadian rhythm, photoperiodicity and body color change. Pinopsins belong the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320212 [Multi-domain]  Cd Length: 295  Bit Score: 42.16  E-value: 2.81e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   6 RDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIAtcnHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15084   209 KESETTQRAEKEVTRMVIAMVMAFLICWLPYATFAMVVATNKDVVI---QPTLASLPSYFSKTATVYNPIIYVFMNKQFR 285
7tmA_mAChR cd15049
muscarinic acetylcholine receptor subfamily, member of the class A family of ...
21-86 2.82e-05

muscarinic acetylcholine receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. Activation of mAChRs by agonist (acetylcholine) leads to a variety of biochemical and electrophysiological responses. In general, the exact nature of these responses and the subsequent physiological effects mainly depend on the molecular and pharmacological identity of the activated receptor subtype(s). All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341322 [Multi-domain]  Cd Length: 262  Bit Score: 41.92  E-value: 2.82e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1958683498  21 MLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTamiSTcVNPIFYGFLNKNFQR 86
Cdd:cd15049   199 TLSAILLAFIITWTPYNILVLVSTFCAKCIPDTLWSFGYWLCYIN---ST-INPFCYALCNKTFRK 260
7tmA_NPFFR2 cd15980
neuropeptide FF receptor 2, member of the class A family of seven-transmembrane G ...
12-86 3.33e-05

neuropeptide FF receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide FF (NPFF) is a mammalian octapeptide that belongs to a family of neuropeptides containing an RF-amide motif at their C-terminus that have been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of these peptides are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R. NPFF has been shown to inhibit adenylate cyclase via the Gi protein coupled to NPFF1-R.


Pssm-ID: 320646 [Multi-domain]  Cd Length: 299  Bit Score: 41.80  E-value: 3.33e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  12 SSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDW------NHQIIATcnhnLLFLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15980   221 SRKKQKVIKMLLIVALLFILSWLPLWTLMMLSDYanlspnQLQIINI----YIYPFAHWLAFFNSSVNPIIYGFFNENFR 296

                  .
gi 1958683498  86 R 86
Cdd:cd15980   297 R 297
7tmA_GPR12 cd15961
G protein-coupled receptor 12, member of the class A family of seven-transmembrane G ...
15-88 4.08e-05

G protein-coupled receptor 12, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR3, GPR6, and GPR12 form a subfamily of constitutively active G-protein coupled receptors with dual coupling to G(s) and G(i) proteins. These three orphan receptors are involved in the regulation of cell proliferation and survival, neurite outgrowth, cell clustering, and maintenance of meiotic prophase arrest. They constitutively activate adenylate cyclase to a similar degree as that seen with fully activated G(s)-coupled receptors, and are also able to constitutively activate inhibitory G(i/o) proteins. Lysophospholipids such as sphingosine 1-phosphate (S1P) and sphingosylphosphorylcholine have been detected as the high-affinity ligands for Gpr6 and Gpr12, respectively, which show high sequence homology with GPR3.


Pssm-ID: 320627 [Multi-domain]  Cd Length: 268  Bit Score: 41.55  E-value: 4.08e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1958683498  15 TKRINVMLLSIVVA-FAVCWLPLTIFNTVFDWNHQIIATcnhnllfLLCHLTAMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15961   201 TTRKGVSTLAIILGtFAACWMPFTLYSLIADYTYPSIYT-------YATLLPATYNSIINPVIYAFRNQEIQKAL 268
7tmA_Gal2_Gal3_R cd15097
galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G ...
2-86 5.06e-05

galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320225 [Multi-domain]  Cd Length: 279  Bit Score: 41.35  E-value: 5.06e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   2 MDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFdWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLN 81
Cdd:cd15097   194 VDPLEAMSESKRAKRKVTKMIIIVTALFCLCWLPHHVVILCY-LYGDFPFNQATYAFRLLSHCMAYANSCLNPIVYALVS 272

                  ....*
gi 1958683498  82 KNFQR 86
Cdd:cd15097   273 KHFRK 277
7tmA_C5aR cd15114
complement component 5a anaphylatoxin chemotactic receptors, member of the class A family of ...
6-88 6.10e-05

complement component 5a anaphylatoxin chemotactic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The anaphylatoxin receptors are a group of G-protein coupled receptors which bind anaphylatoxins; members of this group include C3a receptors and C5a receptors. Anaphylatoxins are also known as complement peptides (C3a, C4a and C5a) that are produced from the activation of the complement system cascade. These complement anaphylatoxins can trigger degranulation of endothelial cells, mast cells, or phagocytes, which induce a local inflammatory response and stimulate smooth muscle cell contraction, histamine release, and increased vascular permeability. They are potent mediators involved in chemotaxis, inflammation, and generation of cytotoxic oxygen-derived free radicals. In humans, a single receptor for C3a (C3AR1) and two receptors for C5a (C5AR1 and C5AR2, also known as C5L2 or GPR77) have been identified, but there is no known receptor for C4a.


Pssm-ID: 320242 [Multi-domain]  Cd Length: 274  Bit Score: 41.24  E-value: 6.10e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   6 RDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVfdwnhqIIATCNHNLLFL-------LCHLTAMISTCVNPIFYG 78
Cdd:cd15114   191 RTWSRRRQKSRRTLKVVTAVVVGFFLCWTPYHVVGLI------IAASAPNSRLLAnalkadpLTVSLAYINSCLNPIIYV 264
                          90
                  ....*....|
gi 1958683498  79 FLNKNFQRDL 88
Cdd:cd15114   265 VAGRGFRKSL 274
7tmA_Dop1R2-like cd15067
dopamine 1-like receptor 2 from Drosophila melanogaster and similar proteins, member of the ...
10-86 6.29e-05

dopamine 1-like receptor 2 from Drosophila melanogaster and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled dopamine 1-like receptor 2 is expressed in Drosophila heads and it shows significant sequence similarity with vertebrate and invertebrate dopamine receptors. Although the Drosophila Dop1R2 receptor does not cluster into the D1-like structural group, it does show pharmacological properties similar to D1-like receptors. As shown in vertebrate D1-like receptors, agonist stimulation of Dop1R2 activates adenylyl cyclase to increase cAMP levels and also generates a calcium signal through stimulation of phospholipase C.


Pssm-ID: 320195 [Multi-domain]  Cd Length: 262  Bit Score: 41.19  E-value: 6.29e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  10 YRSSETKRINVMLLSIVV-AFAVCWLPLTIFNTVFDWNHQiiaTCNHN--LLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15067   184 YRAAAKEQKAAKTLGIVMgVFILCWLPFFVTNILIGFCPS---NCVSNpdILFPLVTWLGYINSGMNPIIYACSSRDFRR 260
7tmA_NK1R cd16002
neurokinin 1 receptor, member of the class A family of seven-transmembrane G protein-coupled ...
7-85 1.04e-04

neurokinin 1 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The neurokinin 1 receptor (NK1R), also known as tachykinin receptor 1 (TACR1) or substance P receptor (SPR), is a G-protein coupled receptor found in the mammalian central nervous and peripheral nervous systems. The tachykinins act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. SP is an extremely potent vasodilator through endothelium dependent mechanism and is released from the autonomic sensory nerves. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception.


Pssm-ID: 320668 [Multi-domain]  Cd Length: 284  Bit Score: 40.62  E-value: 1.04e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   7 DSKYRSSET----KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNK 82
Cdd:cd16002   199 DSSDRYHEQvsakRKVVKMMIVVVCTFAICWLPYHIYFLLQYFHPELYEQKFIQQVYLAIMWLAMSSTMYNPIIYCCLND 278

                  ...
gi 1958683498  83 NFQ 85
Cdd:cd16002   279 RFR 281
7tmA_NMBR cd15125
neuromedin B receptor, member of the class A family of seven-transmembrane G protein-coupled ...
8-86 1.19e-04

neuromedin B receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The neuromedin B receptor (NMBR), also known as BB1, is a G-protein coupled receptor whose endogenous ligand is the neuropeptide neuromedin B. Neuromedin B is a potent mitogen and growth factor for normal and cancerous lung and for gastrointestinal epithelial tissues. NMBR is widely distributed in the CNS, with especially high levels in olfactory nucleus and thalamic regions. The receptor couples primarily to a pertussis-toxin-insensitive G protein of the Gq/11 family, which leads to the activation of phospholipase C. NMBR belongs to the bombesin subfamily of G-protein coupled receptors, whose members also include gastrin-releasing peptide receptor (GRPR) and bombesin receptor subtype 3 (BRS-3). Bombesin is a tetradecapeptide, originally isolated from frog skin.


Pssm-ID: 320253 [Multi-domain]  Cd Length: 292  Bit Score: 40.32  E-value: 1.19e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   8 SKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNH-QIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15125   211 SKRQMETRKRLAKIVLVFVGLFAFCWFPNHVLYMYRSFNYnEIDSSLGHMIVTLVARVLSFCNSCVNPFALYLLSESFRR 290
7tmA_AstC_insect cd15094
somatostatin-like receptor for allatostatin C, member of the class A family of ...
8-86 1.25e-04

somatostatin-like receptor for allatostatin C, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. In Drosophila melanogaster and other insects, a 15-amino-acid peptide named allatostatin C(AstC) binds the somatostatin-like receptors. Two AstC receptors have been identified in Drosophila with strong sequence homology to human somatostatin and opioid receptors.


Pssm-ID: 320222 [Multi-domain]  Cd Length: 282  Bit Score: 40.15  E-value: 1.25e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   8 SKYRSSETKRINVMLLSIVVAFAVCWLPLtifntvfdWNHQIIATCNHN---------LLFLLCHLTAMISTCVNPIFYG 78
Cdd:cd15094   201 SKEKRRSHRKVTRLVLTVISVYIICWLPY--------WAFQVHLIFLPPgtdmpkweiLMFLLLTVLSYANSMVNPLLYA 272

                  ....*...
gi 1958683498  79 FLNKNFQR 86
Cdd:cd15094   273 FLSENFRK 280
7tmA_FPR-like cd15117
N-formyl peptide receptors, member of the class A family of seven-transmembrane G ...
11-88 1.26e-04

N-formyl peptide receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed at elevated levels on polymorphonuclear and mononuclear phagocytes. FPRs bind N-formyl peptides, which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Activation of FPRs by N-formyl peptides such as N-formyl-Met-Leu-Phe (FMLP) triggers a signaling cascade that stimulates neutrophil accumulation, phagocytosis and superoxide production. These responses are mediated through a pertussis toxin-sensitive G(i) protein that activates a PLC-IP3-calcium signaling pathway. While FPRs are involved in host defense responses to bacterial infection, they can also suppress the immune system under certain conditions. Yet, the physiological role of the FPR family is not fully understood.


Pssm-ID: 320245 [Multi-domain]  Cd Length: 288  Bit Score: 40.10  E-value: 1.26e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  11 RSSETKRInvmLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLT---AMISTCVNPIFYGFLNKNFQRD 87
Cdd:cd15117   211 HSSRPFRV---LTAVVAAFFLCWFPFHLVSLLELVVILNQKEDLNPLLILLLPLSsslACVNSCLNPLLYVFVGRDFRER 287

                  .
gi 1958683498  88 L 88
Cdd:cd15117   288 L 288
7tmA_NTSR1 cd15355
neurotensin receptor subtype 1, member of the class A family of seven-transmembrane G ...
21-86 1.26e-04

neurotensin receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Neurotensin (NTS) is a 13 amino-acid neuropeptide that functions as both a neurotransmitter and a hormone in the nervous system and peripheral tissues, respectively. NTS exerts various biological activities through activation of the G protein-coupled neurotensin receptors, NTSR1 and NTSR2. In the brain, NTS is involved in the modulation of dopamine neurotransmission, opioid-independent analgesia, hypothermia, and the inhibition of food intake, while in the periphery NTS promotes the growth of various normal and cancer cells and acts as a paracrine and endocrine modulator of the digestive tract. The third neurotensin receptor, NTSR3 or also called sortilin, is not a G protein-coupled receptor.


Pssm-ID: 320477 [Multi-domain]  Cd Length: 310  Bit Score: 40.22  E-value: 1.26e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  21 MLLSIVVAFAVCWLPLTI----FNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15355   239 VLRAVVIAFVVCWLPYHVrrlmFCYVSDEQWTTFLYDFYHYFYMLTNVLFYVSSAINPILYNLVSANFRQ 308
7tmA_C3aR cd15115
complement component 3a anaphylatoxin chemotactic receptors, member of the class A family of ...
4-85 1.32e-04

complement component 3a anaphylatoxin chemotactic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The anaphylatoxin receptors are a group of G-protein coupled receptors which bind anaphylatoxins; members of this group include C3a receptors and C5a receptors. Anaphylatoxins are also known as complement peptides (C3a, C4a and C5a) that are produced from the activation of the complement system cascade. These complement anaphylatoxins can trigger degranulation of endothelial cells, mast cells, or phagocytes, which induce a local inflammatory response and stimulate smooth muscle cell contraction, histamine release, and increased vascular permeability. They are potent mediators involved in chemotaxis, inflammation, and generation of cytotoxic oxygen-derived free radicals. In humans, a single receptor for C3a (C3AR1) and two receptors for C5a (C5AR1 and C5AR2, also known as C5L2 or GPR77) have been identified, but there is no known receptor for C4a.


Pssm-ID: 320243 [Multi-domain]  Cd Length: 265  Bit Score: 40.14  E-value: 1.32e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   4 KIRDSKYRSSETKRINVMLLsIVVAFAVCWLPLTIFNTVFDWNhqiiATCNHNLLFLLCHLT---AMISTCVNPIFYGFL 80
Cdd:cd15115   183 RMQRGRFAKSQSKTFRVIIA-VVVAFFVCWAPYHIIGILSLYG----DPPLSKVLMSWDHLSialAYANSCLNPVLYVFM 257

                  ....*
gi 1958683498  81 NKNFQ 85
Cdd:cd15115   258 GKDFK 262
7tmA_GPR3_GPR6_GPR12-like cd15100
G protein-coupled receptors 3, 6, 12, and related proteins, member of the class A family of ...
15-88 1.49e-04

G protein-coupled receptors 3, 6, 12, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR3, GPR6, and GPR12 form a subfamily of constitutively active G-protein coupled receptors with dual coupling to G(s) and G(i) proteins. These three orphan receptors are involved in the regulation of cell proliferation and survival, neurite outgrowth, cell clustering, and maintenance of meiotic prophase arrest. They constitutively activate adenylate cyclase to a similar degree as that seen with fully activated G(s)-coupled receptors, and are also able to constitutively activate inhibitory G(i/o) proteins. Lysophospholipids such as sphingosine 1-phosphate (S1P) and sphingosylphosphorylcholine have been detected as the high-affinity ligands for Gpr6 and Gpr12, respectively, which show high sequence homology with GPR3. Also included in this subfamily is GPRx, also known as GPR185, which involved in the maintenance of meiotic arrest in frog oocytes.


Pssm-ID: 320228 [Multi-domain]  Cd Length: 268  Bit Score: 40.15  E-value: 1.49e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  15 TKRINVMLLSIVVA-FAVCWLPLTIFNTVFDWNHQIIATcnhnllfllcHLTAMISTC---VNPIFYGFLNKNFQRDL 88
Cdd:cd15100   201 ATRKGVSTLALILGtFAACWIPFAVYCLLGDGSSPALYT----------YATLLPATYnsmINPIIYAFRNQDIQKVL 268
7tmA_Parapinopsin cd15075
non-visual parapinopsin, member of the class A family of seven-transmembrane G protein-coupled ...
21-86 1.69e-04

non-visual parapinopsin, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the non-visual pineal pigment, parapinopsin, which is a member of the class A of the seven transmembrane G protein-coupled receptors. Parapinopsin serves as a UV-sensitive pigment for the wavelength discrimination in the pineal-related organs of lower vertebrates such as reptiles, amphibians, and fish. Although parapinopsin is phylogenetically related to vertebrate visual pigments such as rhodopsin, which releases its retinal chromophore and bleaches, the parapinopsin photoproduct is stable and does not bleach. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extra-retinal tissues and/or in non-rod, non-cone retinal cells.


Pssm-ID: 320203 [Multi-domain]  Cd Length: 279  Bit Score: 39.76  E-value: 1.69e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1958683498  21 MLLSIVVAFAVCWLPLTIFN--TVFDWNHQI---IATCNHNLlfllchltAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15075   215 MVVVMVMAFLLCWLPYAAFAltVVSKPDVYInplIATVPMYL--------AKSSTVYNPIIYIFMNKQFRD 277
7tmA_NPFFR1 cd15981
neuropeptide FF receptor 1, member of the class A family of seven-transmembrane G ...
11-86 1.99e-04

neuropeptide FF receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide FF (NPFF) is a mammalian octapeptide that belongs to a family of neuropeptides containing an RF-amide motif at their C-terminus that have been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of these peptides are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R. NPFF has been shown to inhibit adenylate cyclase via the Gi protein coupled to NPFF1-R.


Pssm-ID: 320647 [Multi-domain]  Cd Length: 299  Bit Score: 39.81  E-value: 1.99e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  11 RSSETKRINVMLLSIVVA--FAVCWLPLTIFNTVFDWNHqiIATCNHNLL----FLLCHLTAMISTCVNPIFYGFLNKNF 84
Cdd:cd15981   218 RRVSKRKIKVINMLIIVAlfFTLSWLPLWTLMLLTDYGH--LSEDQLNLVtvyvFPFAHWLAFFNSSVNPIIYGYFNENF 295

                  ..
gi 1958683498  85 QR 86
Cdd:cd15981   296 RR 297
7tmA_tmt_opsin cd15086
teleost multiple tissue (tmt) opsin, member of the class A family of seven-transmembrane G ...
4-86 2.05e-04

teleost multiple tissue (tmt) opsin, member of the class A family of seven-transmembrane G protein-coupled receptors; Teleost multiple tissue (tmt) opsins are homologs of encephalopsin. Mouse encephalopsin (or panopsin) is highly expressed in the brain and testes, whereas the teleost homologs are localized to multiple tissues. The exact functions of the encephalopsins and tmt-opsins are unknown. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extra-retinal tissues and/or in non-rod, non-cone retinal cells. They are thought to be involved in light-dependent physiological functions such as photo-entrainment of circadian rhythm, photoperiodicity and body color change. Tmt opsins belong to the class A of the G protein-coupled receptors and show strong homology to the vertebrate visual opsins.


Pssm-ID: 320214 [Multi-domain]  Cd Length: 276  Bit Score: 39.72  E-value: 2.05e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   4 KIRDSKYRSSEtKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLfllCHLTAMISTCVNPIFYGFLNKN 83
Cdd:cd15086   196 KINKSTARKRE-QHVLLMVVTMVICYLLCWLPYGVMALLATFGKPGLVTPVASIV---PSILAKSSTVVNPIIYVFMNKQ 271

                  ...
gi 1958683498  84 FQR 86
Cdd:cd15086   272 FYR 274
7tmA_Vasopressin-like cd14986
vasopressin receptors and its related G protein-coupled receptors, member of the class A ...
21-84 2.29e-04

vasopressin receptors and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this group form a subfamily within the class A G-protein coupled receptors (GPCRs), which includes the vasopressin and oxytocin receptors, the gonadotropin-releasing hormone receptors (GnRHRs), the neuropeptide S receptor (NPSR), and orphan GPR150. These receptors share significant sequence homology with each other, suggesting that they have a common evolutionary origin. Vasopressin, also known as arginine vasopressin or anti-diuretic hormone, is a neuropeptide synthesized in the hypothalamus. The actions of vasopressin are mediated by the interaction of this hormone with three tissue-specific subtypes: V1AR, V1BR, and V2R. Although vasopressin differs from oxytocin by only two amino acids, they have divergent physiological functions. Vasopressin is involved in regulating osmotic and cardiovascular homeostasis, whereas oxytocin plays an important role in the uterus during childbirth and in lactation. GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. Neuropeptide S (NPS) promotes arousal and anxiolytic-like effects by activating its cognate receptor NPSR. NPSR has also been associated with asthma and allergy. GPR150 is an orphan receptor closely related to the oxytocin and vasopressin receptors.


Pssm-ID: 320117 [Multi-domain]  Cd Length: 295  Bit Score: 39.67  E-value: 2.29e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1958683498  21 MLLSIVVAFAVCWLPLTIFNTVFDWNHQiiaTCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNF 84
Cdd:cd14986   231 MTLVIILAFILCWTPYFIVQLLDVYAGM---QQLENDAYVVSETLASLNSALNPLIYGFFSSHL 291
7tmA_MCHR-like cd15088
melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G ...
12-88 2.83e-04

melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320216 [Multi-domain]  Cd Length: 278  Bit Score: 39.36  E-value: 2.83e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  12 SSETKRINVMLLSIVVAFAVCWLPLTIFNTVfdwnhqIIATCNHNLLFLLCHLTAM----ISTCVNPIFYGFLNKNFQRD 87
Cdd:cd15088   204 SSRTKRVTKMVILIVVVFIVCWLPFHVVQLV------NLAMNRPTLAFEVAYFLSIclgyANSCLNPFVYILVSENFRKR 277

                  .
gi 1958683498  88 L 88
Cdd:cd15088   278 L 278
7tmA_Histamine_H2R cd15051
histamine subtype H2 receptor, member of the class A family of seven-transmembrane G ...
20-86 3.03e-04

histamine subtype H2 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine receptor subtype H2R, a member of histamine receptor family, which belongs to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). The H2R subtype selectively interacts with the G(s)-type G protein that activates adenylate cyclase, leading to increased cAMP production and activation of Protein Kinase A. H2R is found in various tissues such as the brain, stomach, and heart. Its most prominent role is in histamine-induced gastric acid secretion. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320179 [Multi-domain]  Cd Length: 287  Bit Score: 39.24  E-value: 3.03e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  20 VMLLSIVVAFAVCWLPLTIFNTVFDwnhqiIATCNHNLLFLLCHL-TAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15051   223 VTLAAVLGAFIICWFPYFTYFTYRG-----LCGDNINETALSVVLwLGYANSALNPILYAFLNRDFRR 285
7tmA_GPR3 cd15963
G protein-coupled receptor 3, member of the class A family of seven-transmembrane G ...
15-88 3.17e-04

G protein-coupled receptor 3, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR3, GPR6, and GPR12 form a subfamily of constitutively active G-protein coupled receptors with dual coupling to G(s) and G(i) proteins. These three orphan receptors are involved in the regulation of cell proliferation and survival, neurite outgrowth, cell clustering, and maintenance of meiotic prophase arrest. They constitutively activate adenylate cyclase to a similar degree as that seen with fully activated G(s)-coupled receptors, and are also able to constitutively activate inhibitory G(i/o) proteins. Lysophospholipids such as sphingosine 1-phosphate (S1P) and sphingosylphosphorylcholine have been detected as the high-affinity ligands for Gpr6 and Gpr12, respectively, which show high sequence homology with GPR3.


Pssm-ID: 320629 [Multi-domain]  Cd Length: 268  Bit Score: 39.10  E-value: 3.17e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1958683498  15 TKRINVMLLSIVV-AFAVCWLPLTIFNTVFDWNHQIIATcnhnllfLLCHLTAMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15963   201 TTRKGIATLAVILgTFASCWLPFAVYCLLGDYTYPALYT-------YATLLPATYNSMINPIIYAFRNQEIQKVL 268
7tmA_GPR182 cd14988
G protein-coupled receptor 182, member of the class A family of seven-transmembrane G ...
14-88 3.40e-04

G protein-coupled receptor 182, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR182 is an orphan G-protein coupled receptor that belongs to the class A of seven-transmembrane GPCR superfamily. When GPR182 gene was first cloned, it was proposed to encode an adrenomedullin receptor. However when the corresponding protein was expressed, it was found not to respond to adrenomedullin (ADM). All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320119 [Multi-domain]  Cd Length: 278  Bit Score: 38.99  E-value: 3.40e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498  14 ETKRINVMLLSIVVAFAVCWLP--LTIFNTVFDWNHqIIATCN--HNLLFL--LCHLTAMISTCVNPIFYGFLNKNFQRD 87
Cdd:cd14988   199 ESRRHCLLIYAYILVFVVCWLPyhVTLLLLTLHGSH-ISLHCNlvHFLYFFydVIDCFSLLHCVANPILYNFLSKSFRGK 277

                  .
gi 1958683498  88 L 88
Cdd:cd14988   278 L 278
7tmA_Apelin_R cd15190
apelin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
14-85 5.18e-04

apelin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Apelin (APJ) receptor is a G protein-coupled receptor that binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake.


Pssm-ID: 341340 [Multi-domain]  Cd Length: 304  Bit Score: 38.59  E-value: 5.18e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  14 ETKRINVMLLSIVVAFAVCWLPLTIFNTVF--DWNHQIIATCNHNLLFLLCH----LTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15190   224 KKRRLLKIIITLVVTFALCWLPFHLVKTLYalMYLGILPFSCGFDLFLMNAHpyatCLAYVNSCLNPFLYAFFDPRFR 301
7tmA_GPR1 cd15119
G protein-coupled receptor 1 for chemerin, member of the class A family of seven-transmembrane ...
21-85 5.34e-04

G protein-coupled receptor 1 for chemerin, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor 1 (GPR1) belongs to the class A of the seven transmembrane domain receptors. This is an orphan receptor that can be activated by the leukocyte chemoattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1. GPR1 is most closely related to another chemerin receptor CMKLR1. In an in-vitro study, GPR1 has been shown to act as a co-receptor to allow replication of HIV viruses.


Pssm-ID: 320247 [Multi-domain]  Cd Length: 278  Bit Score: 38.57  E-value: 5.34e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  21 MLLSIVVAFAVCWLPLTIFNTVFDWNHQiiATCNHNLL---FLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15119   210 TISAVIVAFFVCWTPYHIFSILELSIHH--SSYLHNVLragIPLATSLAFINSCLNPILYVLIGKKFK 275
7tmA_GnRHR_vertebrate cd15383
vertebrate gonadotropin-releasing hormone receptors, member of the class A family of ...
21-88 5.61e-04

vertebrate gonadotropin-releasing hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. GnRHR is expressed predominantly in the gonadotrope membrane of the anterior pituitary as well as found in numerous extrapituitary tissues including lymphocytes, breast, ovary, prostate, and cancer cell lines. There are at least two types of GnRH receptors, GnRHR1 and GnRHR2, which couple primarily to G proteins of the Gq/11 family. GnRHR is closely related to the adipokinetic hormone receptor (AKH), which binds to a lipid-mobilizing hormone that is involved in control of insect metabolism. They share a common ancestor and are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320505 [Multi-domain]  Cd Length: 295  Bit Score: 38.50  E-value: 5.61e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1958683498  21 MLLSIVVAFAVCWLP---LTIFNTVF--DWNHQIIATCNHNL-LFLLCHltamisTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15383   228 MTIVIVSSFIVCWTPyylLGLWYWFSpeMLEQTVPESLSHILfLFGLLN------ACLDPLIYGLFTISFRRGL 295
7tmA_Mrgpr cd14973
mas-related G protein-coupled receptors, member of the class A family of seven-transmembrane G ...
16-80 5.89e-04

mas-related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The Mas-related G-protein coupled receptor (Mrgpr) family constitutes a group of orphan receptors exclusively expressed in nociceptive primary sensory neurons and mast cells in the skin. Members of the Mrgpr family have been implicated in the modulation of nociception, pruritus (itching), and mast cell degranulation. The Mrgpr family in rodents and humans contains more than 50 members that can be grouped into 9 distinct subfamilies: MrgprA, B, C (MrgprX1), D, E, F, G, H (GPR90), and the primate-specific MrgprX subfamily. Some Mrgprs can be activated by endogenous ligands such as beta-alanine, adenine (a cell metabolite and potential transmitter), RF-amide related peptides, or salusin-beta (a bioactive peptide). However, the effects of these agonists are not clearly understood, and the physiological role of the individual receptor family members remains to be determined. Also included in this family is Mas-related G-protein coupled receptor 1-like (MAS1L) which is only found in primates. The angiotensin-II metabolite angiotensin is an endogenous ligand for MAS1L.


Pssm-ID: 320104 [Multi-domain]  Cd Length: 272  Bit Score: 38.39  E-value: 5.89e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLchltAMISTCVNPIFYGFL 80
Cdd:cd14973   188 TRLYVVILLTVLVFLLCGLPLGIYWFLLLWFSNYLFHTFHPISDLL----SCVNSSANPIIYFFV 248
7tmA_GnRHR-like cd15195
gonadotropin-releasing hormone and adipokinetic hormone receptors, member of the class A ...
16-86 6.57e-04

gonadotropin-releasing hormone and adipokinetic hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Gonadotropin-releasing hormone (GnRH) and adipokinetic hormone (AKH) receptors share strong sequence homology to each other, suggesting that they have a common evolutionary origin. GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. Adipokinetic hormone (AKH) is a lipid-mobilizing hormone that is involved in control of insect metabolism. Generally, AKH behaves as a typical stress hormone by mobilizing lipids, carbohydrates and/or certain amino acids such as proline. Thus, it utilizes the body's energy reserves to fight the immediate stress problems and subdue processes that are less important. Although AKH is known to responsible for regulating the energy metabolism during insect flying, it is also found in insects that have lost its functional wings and predominantly walk for their locomotion. Both GnRH and AKH receptors are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320323 [Multi-domain]  Cd Length: 293  Bit Score: 38.15  E-value: 6.57e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL---LFLLCHLtamiSTCVNPIFYGFLNKNFQR 86
Cdd:cd15195   222 MRTLRMTALIVLTFIVCWGPYYVLGLWYWFDKESIKNLPPALshiMFLLGYL----NPCLHPIIYGVFMKEIRN 291
7tmA_BNGR-A34-like cd15000
putative neuropeptide receptor BNGR-A34 and similar proteins, member of the class A family of ...
16-86 7.03e-04

putative neuropeptide receptor BNGR-A34 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes putative neuropeptide receptor BNGR-A34 found in silkworm and its closely related proteins from invertebrates. They are members of the class A rhodopsin-like GPCRs, which represent a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320131 [Multi-domain]  Cd Length: 285  Bit Score: 38.18  E-value: 7.03e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIF-----NTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15000   208 KKAAKTLFIVLITFVVCRIPFTALifyryKLVPNDNTQNSVSGSFHILWFASKYLMFLNAAVNPLIYGFTNENFRK 283
7tmA_TRH-R cd14995
thyrotropin-releasing hormone receptor, member of the class A family of seven-transmembrane G ...
12-86 8.73e-04

thyrotropin-releasing hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; TRH-R is a member of the class A rhodopsin-like G protein-coupled receptors, which binds the tripeptide thyrotropin releasing hormone. The TRH-R activates phosphoinositide metabolism through a pertussis-toxin-insensitive G-protein, the G(q)/G(11) class. TRH stimulates the synthesis and release of thyroid-stimulating hormone in the anterior pituitary. TRH is produced in many other tissues, especially within the nervous system, where it appears to act as a neurotransmitter/neuromodulator. It also stimulates the synthesis and release of prolactin. In the CNS, TRH stimulates a number of behavioral and pharmacological actions, including increased turnover of catecholamines in the nucleus accumbens. There are two thyrotropin-releasing hormone receptors in some mammals, thyrotropin-releasing hormone receptor 1 (TRH1) which has been found in a number of species including rat, mouse, and human and thyrotropin-releasing hormone receptor 2 (TRH2) which has, only been found in rodents. These TRH receptors are found in high levels in the anterior pituitary, and are also found in the retina and in certain areas of the brain.


Pssm-ID: 320126 [Multi-domain]  Cd Length: 269  Bit Score: 37.75  E-value: 8.73e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1958683498  12 SSETKRINVMLLSIVVAFAVCWLPLTIFnTVFDWnhqIIATCNHNLLFLL-CHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd14995   196 FSSRKQVTKMLAVVVVLFALLWMPYRTL-VVYNS---FASPPYLDLWFLLfCRTCIYLNSAINPILYNLMSQKFRA 267
7tmA_UII-R cd14999
urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled ...
8-88 1.01e-03

urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The urotensin-II receptor (UII-R, also known as the hypocretin receptor) is a member of the class A rhodopsin-like G-protein coupled receptors, which binds the peptide hormone urotensin-II. Urotensin II (UII) is a vasoactive somatostatin-like or cortistatin-like peptide hormone. However, despite the apparent structural similarity to these peptide hormones, they are not homologous to UII. Urotensin II was first identified in fish spinal cord, but later found in humans and other mammals. In fish, UII is secreted at the back part of the spinal cord, in a neurosecretory centre called uroneurapophysa, and is involved in the regulation of the renal and cardiovascular systems. In mammals, urotensin II is the most potent mammalian vasoconstrictor identified to date and causes contraction of arterial blood vessels, including the thoracic aorta. The urotensin II receptor is a rhodopsin-like G-protein coupled receptor, which binds urotensin-II. The receptor was previously known as GPR14, or sensory epithelial neuropeptide-like receptor (SENR). The UII receptor is expressed in the CNS (cerebellum and spinal cord), skeletal muscle, pancreas, heart, endothelium and vascular smooth muscle. It is involved in the pathophysiological control of cardiovascular function and may also influence CNS and endocrine functions. Binding of urotensin II to the receptor leads to activation of phospholipase C, through coupling to G(q/11) family proteins. The resulting increase in intracellular calcium may cause the contraction of vascular smooth muscle.


Pssm-ID: 320130 [Multi-domain]  Cd Length: 282  Bit Score: 37.81  E-value: 1.01e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   8 SKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWnHQIIATCNH---NLLFLLCHLTaMISTCVNPIFYGFLNKNF 84
Cdd:cd14999   201 SSRKRLPKQKVLKMIFTIVLVFWACFLPFWIWQLLYLY-SPSLSLSPRtttYVNYLLTCLT-YSNSCINPFLYTLLTKNY 278

                  ....
gi 1958683498  85 QRDL 88
Cdd:cd14999   279 KEYL 282
7tmA_GPER1 cd14989
G protein-coupled estrogen receptor 1, member of the class A family of seven-transmembrane G ...
5-88 1.09e-03

G protein-coupled estrogen receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled estrogen receptor 1 (GPER1), also known as the G-protein coupled receptor 30 (GPR30), is a high affinity receptor for estrogen. This receptor is a member of the class A of seven-transmembrane GPCRs. Estrogen binding results in intracellular calcium mobilization and synthesis of phosphatidylinositol (3,4,5)-trisphosphate in the nucleus. GPR30 plays an important role in development of tamoxifen resistance in breast cancer cells. The distribution of GPR30 is well established in the rodent, with high expression observed in the hypothalamus, pituitary gland, adrenal medulla, kidney medulla and developing follicles of the ovary. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320120 [Multi-domain]  Cd Length: 276  Bit Score: 37.50  E-value: 1.09e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   5 IRDSKYRSSETKRINV--MLLSIVVAFAVCWLPLTIFNTV--FDWNHQIIATC------NHNLLFLLCHLTAMISTCVNP 74
Cdd:cd14989   183 VRAQKHRRLRPRRQKAlrMILVVVLVFFICWLPENVFISIqlLQGTQEPSESYdesfrhNHPLTGHIVNLAAFSNSCLNP 262
                          90
                  ....*....|....
gi 1958683498  75 IFYGFLNKNFQRDL 88
Cdd:cd14989   263 LIYSFLGETFRDKL 276
7tmA_Opsin5_neuropsin cd15074
neuropsin (Opsin-5), member of the class A family of seven-transmembrane G protein-coupled ...
6-88 1.29e-03

neuropsin (Opsin-5), member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropsin, also known as Opsin-5, is a photoreceptor protein expressed in the retina, brain, testes, and spinal cord. Neuropsin belongs to the type 2 opsin family of the class A G-protein coupled receptors. Mammalian neuropsin activates Gi protein-mediated photo-transduction pathway in a UV-dependent manner, whereas, in non-mammalian vertebrates, neuropsin is involved in regulating the photoperiodic control of seasonal reproduction in birds such as quail. As with other opsins, it may also act as a retinal photoisomerase.


Pssm-ID: 320202 [Multi-domain]  Cd Length: 284  Bit Score: 37.25  E-value: 1.29e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   6 RDSKYRSSETKrINVMLLSIVVAFAVCWLPLTI--FNTVFDWNHQIiatcnHNLLFLLCHLTAMISTCVNPIFYGFLNKN 83
Cdd:cd15074   206 RSKRQHKIERK-VTKVAVLICAGFLIAWTPYAVvsMWSAFGSPDSV-----PILASILPALFAKSSCMYNPIIYLLFSSK 279

                  ....*
gi 1958683498  84 FQRDL 88
Cdd:cd15074   280 FRQDL 284
7tmA_AKHR cd15382
adipokinetic hormone receptor, member of the class A family of seven-transmembrane G ...
21-88 1.34e-03

adipokinetic hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Adipokinetic hormone (AKH) is a lipid-mobilizing hormone that is involved in control of insect metabolism. Generally, AKH behaves as a typical stress hormone by mobilizing lipids, carbohydrates and/or certain amino acids such as proline. Thus, it utilizes the body's energy reserves to fight the immediate stress problems and subdue processes that are less important. Although AKH is known to responsible for regulating the energy metabolism during insect flight, it is also found in insects that have lost its functional wings and predominantly walk for their locomotion. AKH is structurally related to the mammalian gonadotropin-releasing hormone (GnRH) and they share a common ancestor. Both GnRH and AKH receptors are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320504 [Multi-domain]  Cd Length: 298  Bit Score: 37.29  E-value: 1.34e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1958683498  21 MLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCN---HNLLFLLchltAMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15382   232 MTIVIVLVFIICWTPYFIMSLWYWFDRESASKVDpriQKGLFLF----AVSNSCMNPIVYGYFSIDLRREL 298
7tmA_5-HT1A_vertebrates cd15330
serotonin receptor subtype 1A from vertebrates, member of the class A family of ...
10-85 1.45e-03

serotonin receptor subtype 1A from vertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320453 [Multi-domain]  Cd Length: 260  Bit Score: 37.27  E-value: 1.45e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  10 YRSSETKRINVMLLSIVVA-FAVCWLPLTIFNTVFDWNHQiiaTCNH-NLLFLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15330   183 FKAAARERKTVKTLGIIMGtFILCWLPFFIVALVLPFCES---TCHMpELLGAIINWLGYSNSLLNPIIYAYFNKDFQ 257
7tmA_P2Y1-like cd15168
P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of ...
21-86 1.45e-03

P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y1-like receptors as well as other closely related orphan receptors, such as GPR91 (a succinate receptor) and GPR80/GPR99 (an alpha-ketoglutarate receptor).


Pssm-ID: 341329 [Multi-domain]  Cd Length: 284  Bit Score: 37.30  E-value: 1.45e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1958683498  21 MLLSIVVAFAVCWLPLTIFNTVF--DWNHQIIATCNHNLLFLLCHLT----AMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15168   211 LVIIVLALFAVCFLPFHVTRTINlaARLLSGTASCATLNGIYVAYKVtrplASLNSCLNPLLYFLAGDKFRR 282
7tmA_BRS-3 cd15123
bombesin receptor subtype 3, member of the class A family of seven-transmembrane G ...
16-86 1.49e-03

bombesin receptor subtype 3, member of the class A family of seven-transmembrane G protein-coupled receptors; BRS-3 is classified as an orphan receptor and belongs to the bombesin subfamily of G-protein coupled receptors, whose members also include neuromedin B receptor (NMBR) and gastrin-releasing peptide receptor (GRPR). Bombesin is a tetradecapeptide, originally isolated from frog skin. Mammalian bombesin-related peptides are widely distributed in the gastrointestinal and central nervous systems. The bombesin family receptors couple primarily to the G proteins of G(q/11) family. BRS-3 interacts with known naturally-occurring bombesin-related peptides with low affinity; however, no endogenous high-affinity ligand to the receptor has been identified. BRS-3 is suggested to play a role in sperm cell division and maturation.


Pssm-ID: 320251 [Multi-domain]  Cd Length: 294  Bit Score: 37.21  E-value: 1.49e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1958683498  16 KRINVMLLSIVVAFAVCWLP---LTIFNTvFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15123   220 KRVAKTVLVLVALFAFCWLPnhiLYLYRS-FTYHTSVDSSAFHLIATIFSRVLAFSNSCVNPFALYWLSKSFRQ 292
7tmA_mAChR_M2 cd15297
muscarinic acetylcholine receptor subtype M2, member of the class A family of ...
12-86 1.64e-03

muscarinic acetylcholine receptor subtype M2, member of the class A family of seven-transmembrane G protein-coupled receptors; Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. Activation of M2 receptor causes a decrease in cAMP production, generally leading to inhibitory-type effects. This causes an outward current of potassium in the heart, resulting in a decreased heart rate. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320424 [Multi-domain]  Cd Length: 262  Bit Score: 36.87  E-value: 1.64e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1958683498  12 SSETKRINVMLLSIVVAFAVCWLPLTIFNTVfdwnHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15297   190 SSREKKVTRTILAILLAFIITWTPYNVMVLI----NTFCASCIPNTVWTIGYWLCYINSTINPACYALCNATFKK 260
7tmA_LTB4R cd14975
leukotriene B4 receptors, member of the class A family of seven-transmembrane G ...
4-79 1.95e-03

leukotriene B4 receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Leukotriene B4 (LTB4), a metabolite of arachidonic acid, is a powerful chemotactic activator for granulocytes and macrophages. Two receptors for LTB4 have been identified: a high-affinity receptor (LTB4R1 or BLT1) and a low-affinity receptor (TB4R2 or BLT2). Both BLT1 and BLT2 receptors belong to the rhodopsin-like G-protein coupled receptor superfamily and primarily couple to G(i) proteins, which lead to chemotaxis, calcium mobilization, and inhibition of adenylate cyclase. In some cells, they can also couple to the G(q)-like protein, G16, and activate phospholipase C. LTB4 is involved in mediating inflammatory processes, immune responses, and host defense against infection. Studies have shown that LTB4 stimulates leukocyte extravasation, neutrophil degranulation, lysozyme release, and reactive oxygen species generation.


Pssm-ID: 320106 [Multi-domain]  Cd Length: 278  Bit Score: 36.69  E-value: 1.95e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   4 KIRDSKYRSSetKRINVMLLSIVVAFAVCWLPLTIFNTVfdwnhQIIAT---CNHNLLFLLCHLTAM---------ISTC 71
Cdd:cd14975   188 RLRRRRFRRR--RRTGRLIASVVVAFAACWLPYHVGNLL-----EVVSEligGSKMAGTLGKVAEAGrpiagalafLSSS 260

                  ....*...
gi 1958683498  72 VNPIFYGF 79
Cdd:cd14975   261 INPLLYAF 268
7tmA_Glycoprotein_LRR_R-like cd14980
glycoprotein hormone receptors and leucine-rich repeats containing G protein-coupled receptors, ...
12-88 2.10e-03

glycoprotein hormone receptors and leucine-rich repeats containing G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes the glycoprotein hormone receptors (GPHRs), vertebrate receptors containing 17 leucine-rich repeats (LGR4-6), and the relaxin family peptide receptors (also known as LGR7 and LGR8). They are seven transmembrane domain receptors with a very large extracellular N-terminal domain containing many leucine-rich repeats responsible for hormone recognition and binding. The glycoprotein hormone receptor family contains receptors for the pituitary hormones, thyrotropin (thyroid-stimulating hormone receptor), follitropin (follicle-stimulating hormone receptor), and lutropin (luteinizing hormone receptor). Glycoprotein hormone receptors couple primarily to the G(s)-protein and promotes cAMP production, but also to the G(i)- or G(q)-protein. Two orphan GPCRs, LGR7 and LGR8, have been recently identified as receptors for the relaxin peptide hormones.


Pssm-ID: 320111 [Multi-domain]  Cd Length: 286  Bit Score: 36.83  E-value: 2.10e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1958683498  12 SSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATcnHNLLFLLChLTAMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd14980   213 SKRDKRIAIRLALILITDLICWLPYYIVIFSGLLTSTEIDI--HVLQFIAI-LALPLNSAINPYLYTLTTPTFKRDF 286
7tmA_Trissin_R cd15012
trissin receptor and related proteins, member of the class A family of seven-transmembrane G ...
21-88 2.14e-03

trissin receptor and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the Drosophila melanogaster trissin receptor and closely related invertebrate proteins which are a member of the class A family of seven-transmembrane G-protein coupled receptors. The cysteine-rich trissin has been shown to be an endogenous ligand for the orphan CG34381 in Drosophila melanogaster. Trissin is a peptide composed of 28 amino acids with three intrachain disulfide bonds with no significant structural similarities to known endogenous peptides. Cysteine-rich peptides are known to have antimicrobial or toxicant activities, although frequently their mechanism of action is poorly understood. Since the expression of trissin and its receptor is reported to predominantly localize to the brain and thoracicoabdominal ganglion, trissin is predicted to behave as a neuropeptide. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320140 [Multi-domain]  Cd Length: 277  Bit Score: 36.65  E-value: 2.14e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1958683498  21 MLLSIVVAFAVCWLPltiFNTVFDWNH-QIIATCNHNLLFLLCHLTAMI---STCVNPIFYGFLNKNFQRDL 88
Cdd:cd15012   209 LLVAVVVSFALCNLP---YHARKMWQYwSEPYRCDSNWNALLTPLTFLVlyfNSAVNPLLYAFLSKRFRQSM 277
7tmA_ET_R-like cd14977
endothelin receptors and related proteins, member of the class A family of seven-transmembrane ...
16-86 2.48e-03

endothelin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes endothelin receptors, bombesin receptor subtype 3 (BRS-3), gastrin-releasing peptide receptor (GRPR), neuromedin B receptor (NMB-R), endothelin B receptor-like 2 (ETBR-LP-2), and GRP37. The endothelin receptors and related proteins are members of the seven transmembrane rhodopsin-like G-protein coupled receptor family (class A GPCRs) which activate multiple effectors via different types of G protein.


Pssm-ID: 320108 [Multi-domain]  Cd Length: 292  Bit Score: 36.63  E-value: 2.48e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMIS---TCVNPIFYGFLNKNFQR 86
Cdd:cd14977   217 RQLAKTVLCLVLVFAFCWLPEHISNILRATLYNEVLIDTRSTLDILDLIGQFLSffnSCVNPIALYLLSEPFRR 290
7tmA_LWS_opsin cd15081
long wave-sensitive opsins, member of the class A family of seven-transmembrane G ...
6-85 2.89e-03

long wave-sensitive opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; Long Wave-Sensitive opsin is also called red-sensitive opsin or red cone photoreceptor pigment, which mediates visual transduction in response to light at long wavelengths. Vertebrate cone opsins are expressed in cone photoreceptor cells of the retina and involved in mediating photopic vision, which allows color perception. The cone opsins can be classified into four classes according to their peak absorption wavelengths: SWS1 (ultraviolet sensitive), SWS2 (short wave-sensitive), MWS/LWS (medium/long wave-sensitive), and RH2 (medium wave-sensitive, rhodopsin-like opsins). Members of this group belong to the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320209 [Multi-domain]  Cd Length: 292  Bit Score: 36.42  E-value: 2.89e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   6 RDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHqiiATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQ 85
Cdd:cd15081   213 KESESTQKAEKEVSRMVVVMIFAYCFCWGPYTFFACFAAANP---GYAFHPLAAALPAYFAKSATIYNPIIYVFMNRQFR 289
7tmA_Histamine_H1R cd15050
histamine subtype H1 receptor, member of the class A family of seven-transmembrane G ...
25-86 3.42e-03

histamine subtype H1 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine receptor subtype H1R, a member of histamine receptor family, which belongs to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). H1R selectively interacts with the G(q)-type G protein that activates phospholipase C and the phosphatidylinositol pathway. Antihistamines, a widely used anti-allergy medication, act on the H1 subtype and produce drowsiness as a side effect. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320178 [Multi-domain]  Cd Length: 263  Bit Score: 36.25  E-value: 3.42e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1958683498  25 IVVAFAVCWLPLTIFNTVFDWNHQiiaTCNHNLLFLLCHLTAMISTcVNPIFYGFLNKNFQR 86
Cdd:cd15050   204 IMAAFILCWIPYFILFMVIAFCKN---CCNENLHMFTIWLGYINST-LNPFIYPLCNENFKK 261
7tmA_GPR142 cd15129
G-protein-coupled receptor GPR142, member of the class A family of seven-transmembrane G ...
4-86 3.73e-03

G-protein-coupled receptor GPR142, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR142, a vertebrate orphan receptor, is very closely related to GPR139, but they have different expression patterns in the brain and in other tissues. These receptors couple to inhibitory G proteins and activate phospholipase C. Studies suggested that dimer formation may be required for their proper function. GPR142 is predominantly expressed in pancreatic beta-cells and plays an important role in mediating enhancement of glucose-stimulated insulin secretion and maintaining glucose homeostasis, whereas GPR139 is expressed almost exclusively in the brain and is suggested to play a role in the control of locomotor activity. These orphan receptors are phylogenetically clustered with invertebrate FMRFamide receptors such as Drosophila melanogaster DrmFMRFa-R.


Pssm-ID: 320257 [Multi-domain]  Cd Length: 270  Bit Score: 35.91  E-value: 3.73e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   4 KIRDSKYRSSETKRIN---VMLLSIVVAFAVCWLPLTIFNTVfdwnHQIIATCNHN----LLFLLCHLTAMISTCVNPIF 76
Cdd:cd15129   183 KLRRRKGRSGPQRRSGkttAILLAITTVFAVLWAPRTVVIIY----HLYVSSVNRDwrvhLALDLANMLAMLNTAVNFFL 258
                          90
                  ....*....|
gi 1958683498  77 YGFLNKNFQR 86
Cdd:cd15129   259 YCFVSKRFRR 268
7tmA_5-HT1_5_7 cd15064
serotonin receptor subtypes 1, 5 and 7, member of the class A family of seven-transmembrane G ...
10-85 4.00e-03

serotonin receptor subtypes 1, 5 and 7, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes serotonin receptor subtypes 1, 5, and 7 that are activated by the neurotransmitter serotonin. The 5-HT1 and 5-HT5 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family. The 5-HT1 receptor subfamily includes 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as 5-HT2C receptor. The 5-HT5A and 5-HT5B receptors have been cloned from rat and mouse, but only the 5-HT5A isoform has been identified in human because of the presence of premature stop codons in the human 5-HT5B gene, which prevents a functional receptor from being expressed. The 5-HT7 receptor is coupled to Gs, which positively stimulates adenylate cyclase activity, leading to increased intracellular cAMP formation and calcium influx. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320192 [Multi-domain]  Cd Length: 258  Bit Score: 35.77  E-value: 4.00e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  10 YRSSETKRINVMLLSIVV-AFAVCWLPLTIFNTVFDW-NHQIIATCNHNLLFLLCHLTAMIstcvNPIFYGFLNKNFQ 85
Cdd:cd15064   182 YRAAARERKAAKTLGIILgAFIVCWLPFFLVALIVPLcSHCWIPLALKSFFLWLGYFNSLI----NPLIYTFFNKDFR 255
7tmA_GPR39 cd15135
G protein-coupled receptor 39, member of the class A family of seven-transmembrane G ...
7-86 4.03e-03

G protein-coupled receptor 39, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR39 is an orphan G protein-coupled receptor that belongs to the growth hormone secretagogue and neurotensin receptor subfamily. GPR39 is expressed in peripheral tissues such as pancreas, gut, gastrointestinal tract, liver, kidney as well as certain regions of the brain. The divalent metal ion Zn(2+) has been shown to be a ligand capable of activating GPR39. Thus, it has been suggested that GPR39 function as a G(q)-coupled Zn(2+)-sensing receptor which involved in the regulation of endocrine pancreatic function, body weight, gastrointestinal mobility, and cell death.


Pssm-ID: 320263 [Multi-domain]  Cd Length: 320  Bit Score: 35.93  E-value: 4.03e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   7 DSKYRSSET----KRINVMLLSIVVAFAVCWLPLTIFNTVF------DWNHQ-----IIATCNHNLLFLLchltamiSTC 71
Cdd:cd15135   231 LRKHESAEGktarKQTILFLGLIVGTLAVCWMPNQIRRIMAaakpkdDWTRSyfrayIILLPIADTFFYL-------SSV 303
                          90
                  ....*....|....*
gi 1958683498  72 VNPIFYGFLNKNFQR 86
Cdd:cd15135   304 LNPLLYNLSSQQFRS 318
7tmA_D1-like_dopamine_R cd15057
D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G ...
7-86 4.04e-03

D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. In contrast, activation of D2-like family receptors is linked to G proteins of the G(i) family, which inhibit adenylate cyclase. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320185 [Multi-domain]  Cd Length: 299  Bit Score: 35.87  E-value: 4.04e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   7 DSKYRSS---ETKRINVmlLSIVVA-FAVCWLPLTIFNTV--FDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFl 80
Cdd:cd15057   215 DSSLRSSlrrETKALKT--LSIIMGvFVCCWLPFFILNCVlpFCDLRTAQFPCVPDTTFIVFVWLGWANSSLNPIIYAF- 291

                  ....*.
gi 1958683498  81 NKNFQR 86
Cdd:cd15057   292 NADFRK 297
7tmA_MCHR1 cd15338
melanin concentrating hormone receptor 1, member of the class A family of seven-transmembrane ...
15-88 4.47e-03

melanin concentrating hormone receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320460 [Multi-domain]  Cd Length: 282  Bit Score: 35.94  E-value: 4.47e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1958683498  15 TKRINVMLLSIVVAFAVCWLPLTIFNTVfdwnHQIIATCNHNLLFLLCHLTAM--ISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15338   211 TKKVTRMAVAICLAFFICWAPFYILQLA----HLSIDRPSLAFLYAYNVAISMgyANSCINPFLYIMLSETFKRQF 282
7tmA_VA_opsin cd15082
non-visual VA (vertebrate ancient) opsins, member of the class A family of seven-transmembrane ...
16-86 4.48e-03

non-visual VA (vertebrate ancient) opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; The vertebrate ancient (VA) opsin photopigments were originally identified in salmon and they appear to have diverged early in the evolution of vertebrate opsins. VA opsins are localized in the inner retina and the brain in teleosts. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extraretinal tissues and/or in non-rod, non-cone retinal cells. They are thought to be involved in light-dependent physiological functions such as photo-entrainment of circadian rhythm, photoperiodicity, and body color change. The VA opsins belong the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320210 [Multi-domain]  Cd Length: 291  Bit Score: 35.93  E-value: 4.48e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNtvfdwnhqIIATCnHNLLFLLCHLTAM------ISTCVNPIFYGFLNKNFQR 86
Cdd:cd15082   222 RQVTRMVVVMIVAFMVCWTPYAAFS--------ILVTA-HPTIHLDPRLAAIpaffskTAAVYNPIIYVFMNKQFRK 289
7tmA_ETH-R cd14997
ecdysis-triggering hormone receptors, member of the class A family of seven-transmembrane G ...
16-86 4.51e-03

ecdysis-triggering hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the ecdysis-triggering hormone receptors found in insects, which are members of the class A family of seven-transmembrane G-protein coupled receptors. Ecdysis-triggering hormones are vital regulatory signals that govern the stereotypic physiological sequence leading to cuticle shedding in insects. Thus, the ETH signaling system has been a target for the design of more sophisticated insect-selective pest control strategies. Two subtypes of ecdysis-triggering hormone receptor were identified in Drosophila melanogaster. Blood-borne ecdysis-triggering hormone (ETH) activates the behavioral sequence through direct actions on the central nervous system. In insects, ecdysis is thought to be controlled by the interaction between peptide hormones; in particular between ecdysis-triggering hormone (ETH) from the periphery and eclosion hormone (EH) and crustacean cardioactive peptide (CCAP) from the central nervous system. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320128 [Multi-domain]  Cd Length: 294  Bit Score: 35.73  E-value: 4.51e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNT--VFDWNHQIIATCNHNLLFLL--CHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd14997   218 RQVVYMLITVVVLFFVCLLPFRVVTLwiIFAPDEDLQALGLEGYLNLLvfCRVMVYLNSALNPILYNLMSTKFRS 292
7tmA_5-HT4 cd15056
serotonin receptor subtype 4, member of the class A family of seven-transmembrane G ...
3-86 4.71e-03

serotonin receptor subtype 4, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT4 subtype is a member of the serotonin receptor family that belongs to the class A G protein-coupled receptors, and binds the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the mammalian central nervous system (CNS). 5-HT4 receptors are selectively linked to G proteins of the G(s) family, which positively stimulate adenylate cyclase, causing cAMP formation and activation of protein kinase A. 5-HT4 receptor-specific agonists have been shown to enhance learning and memory in animal studies. Moreover, hippocampal 5-HT4 receptor expression has been reported to be inversely correlated with memory performance in humans. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320184 [Multi-domain]  Cd Length: 294  Bit Score: 35.54  E-value: 4.71e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   3 DKIRDSKYRSsETKRINVMLLsIVVAFAVCWLPLTIFNTVfdwnHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNK 82
Cdd:cd15056   215 DQHRNSRMRT-ETKAAKTLGI-IMGCFCVCWAPFFVTNIV----DPFIGYRVPYLLWTAFLWLGYINSGLNPFLYAFFNK 288

                  ....
gi 1958683498  83 NFQR 86
Cdd:cd15056   289 SFRR 292
7tmA_CMKLR1 cd15116
chemokine-like receptor 1, member of the class A family of seven-transmembrane G ...
11-86 4.95e-03

chemokine-like receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokine receptor-like 1 (also known as Chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. CMKLR1 is prominently expressed in dendritic cells and macrophages.


Pssm-ID: 320244 [Multi-domain]  Cd Length: 284  Bit Score: 35.51  E-value: 4.95e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1958683498  11 RSSETKRINVMLLSIVVAFAVCWLPLTIFNTVfDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15116   208 RLAKSSKPFKIIAAVIVTFFLCWAPYHILNLL-EMEATRSPASVFKIGLPITSSLAFINSCLNPILYVFMGQDFKK 282
7tmA_motilin_R cd15132
motilin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
6-85 5.83e-03

motilin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Motilin receptor, also known as GPR38, is a G-protein coupled receptor that binds the endogenous ligand motilin. Motilin is a 22 amino acid peptide hormone expressed throughout the gastrointestinal tract and stimulates contraction of gut smooth muscle. Motilin is also called as the housekeeper of the gut because it is responsible for the proper filling and emptying of the gastrointestinal tract in response to food intake, and for stimulating the production of pepsin. Motilin receptor shares significant amino acid sequence identity with the growth hormone secretagogue receptor (GHSR) and neurotensin receptors (NTS-R1 and 2).


Pssm-ID: 320260 [Multi-domain]  Cd Length: 289  Bit Score: 35.54  E-value: 5.83e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   6 RDSKYRssETKRInvmLLSIVVAFAVCWLPLTIFNTVF---DWNHQIIATCNHNLL-FLLCHLTAMIstcvNPIFYGFLN 81
Cdd:cd15132   212 RERSHR--QTVRI---LAVVVLAFIICWLPFHIGRILFantEDYRTMMFSQYFNIVaMQLFYLSASI----NPILYNLIS 282

                  ....
gi 1958683498  82 KNFQ 85
Cdd:cd15132   283 RKYR 286
7tmA_V1aR cd15385
vasopressin receptor subtype 1A, member of the class A family of seven-transmembrane G ...
21-87 6.45e-03

vasopressin receptor subtype 1A, member of the class A family of seven-transmembrane G protein-coupled receptors; V1a-type receptor is a G(q/11)-coupled receptor that mediates blood vessel constriction. Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) is synthesized in the hypothalamus and is released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320507 [Multi-domain]  Cd Length: 301  Bit Score: 35.18  E-value: 6.45e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1958683498  21 MLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRD 87
Cdd:cd15385   234 MTFVIVLAYIVCWAPFFTIQMWSVWDQNFPWDESENTAVTITALLASLNSCCNPWIYMFFSGHLLQD 300
7tmA_NTSR2 cd15356
neurotensin receptor subtype 2, member of the class A family of seven-transmembrane G ...
2-86 6.70e-03

neurotensin receptor subtype 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Neurotensin (NTS) is a 13 amino-acid neuropeptide that functions as both a neurotransmitter and a hormone in the nervous system and peripheral tissues, respectively. NTS exerts various biological activities through activation of the G protein-coupled neurotensin receptors, NTSR1 and NTSR2. In the brain, NTS is involved in the modulation of dopamine neurotransmission, opioid-independent analgesia, hypothermia, and the inhibition of food intake, while in the periphery NTS promotes the growth of various normal and cancer cells and acts as a paracrine and endocrine modulator of the digestive tract. The third neurotensin receptor, NTSR3 or also called sortilin, is not a G protein-coupled receptor.


Pssm-ID: 320478 [Multi-domain]  Cd Length: 285  Bit Score: 35.23  E-value: 6.70e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   2 MDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVF------DWNHQIIATcnHNLLFLLCHLTAMISTCVNPI 75
Cdd:cd15356   195 LNGVTVSHLRIQSLQHSVQVLRAIVIAYVICWLPYHARRLMFcyvpddAWTDSLYNF--YHYFYMLTNTLFYVSSAVNPL 272
                          90
                  ....*....|.
gi 1958683498  76 FYGFLNKNFQR 86
Cdd:cd15356   273 LYNVVSSSFRK 283
7tmA_AT2R cd15191
type 2 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
5-88 7.12e-03

type 2 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 341341 [Multi-domain]  Cd Length: 285  Bit Score: 35.11  E-value: 7.12e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   5 IRDSKYRSSETKRINV--MLLSIVVAFAVCWLP---LTIFNTVFDW----NHQIIATCNHNLLFLLChlTAMISTCVNPI 75
Cdd:cd15191   195 LKTKGFGKNKQRRDKVlkMVAAVVLAFLICWFPfhvLTFLDALARMgvinNCWVITVIDKALPFAIC--LGFSNSCINPF 272
                          90
                  ....*....|...
gi 1958683498  76 FYGFLNKNFQRDL 88
Cdd:cd15191   273 LYCFVGNHFREKL 285
7tmA_GPR25 cd15193
G protein-coupled receptor 25, member of the class A family of seven-transmembrane G ...
24-86 7.40e-03

G protein-coupled receptor 25, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR25 is an orphan G-protein coupled receptor that shares strong sequence homology to GPR15 and the angiotensin II receptors. These closely related receptors form a group within the class A G-protein coupled receptors (GPCRs). GPR15 controls homing of T cells, especially FOXP3(+) regulatory T cells, to the large intestine mucosa and thereby mediates local immune homeostasis. Moreover, GRP15-deficient mice were shown to be prone to develop more severe large intestine inflammation. Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors.


Pssm-ID: 320321 [Multi-domain]  Cd Length: 279  Bit Score: 35.11  E-value: 7.40e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1958683498  24 SIVVAFAVCWLPLTIFNTVF--------DWN-HQIIATcnHNLLFLLCHLtAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15193   209 AIVTAFVLSWLPFNTLKAVRlllelgggVLPcHTTVAI--RQGLTITACL-AFVNSCVNPLIYSLLDRHFRR 277
7tmA_Peropsin cd15073
retinal pigment epithelium-derived rhodopsin homolog, member of the class A family of ...
13-86 7.85e-03

retinal pigment epithelium-derived rhodopsin homolog, member of the class A family of seven-transmembrane G protein-coupled receptors; Peropsin, also known as a retinal pigment epithelium-derived rhodopsin homolog (RRH), is a visual pigment-like protein found exclusively in the apical microvilli of the retinal pigment epithelium. Peropsin belongs to the type 2 opsin family of the class A G-protein coupled receptors. Peropsin presumably plays a physiological role in the retinal pigment epithelium either by detecting light directly or monitoring the levels of retinoids, the primary light absorber in visual perception, or other pigment-related compounds in the eye.


Pssm-ID: 320201 [Multi-domain]  Cd Length: 280  Bit Score: 35.10  E-value: 7.85e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1958683498  13 SETKRINVMLLSIVVAFAVCWLPLTIfntVFDW----NHQIIATcnhnLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15073   208 TDQNDVTKMSVIMIVMFLVAWSPYSI---VCLWasfgEPKKIPP----WMAIIPPLFAKSSTFYNPCIYVIANKKFRR 278
7tmA_Encephalopsin cd15078
encephalopsins (opsin-3), member of the class A family of seven-transmembrane G ...
16-88 8.74e-03

encephalopsins (opsin-3), member of the class A family of seven-transmembrane G protein-coupled receptors; Encephalopsin, also called Opsin-3 or Panopsin, is a mammalian extra-retinal opsin that is highly localized in the brain. It is thought to play a role in encephalic photoreception. Encephalopsin belongs to the class A of the G protein-coupled receptors and shows strong homology to the vertebrate visual opsins.


Pssm-ID: 320206 [Multi-domain]  Cd Length: 279  Bit Score: 34.80  E-value: 8.74e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1958683498  16 KRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNhnlLFLLCHLTAMISTCVNPIFYGFLNKNFQRDL 88
Cdd:cd15078   210 KKVAKMCLLMISTFLICWMPYAVVSLLVTSGYSKLVTPT---IAIIPSLFAKSSTAYNPVIYIFMIRKFRQCL 279
7tmA_EDG-like cd14972
endothelial differentiation gene family, member of the class A family of seven-transmembrane G ...
11-86 9.09e-03

endothelial differentiation gene family, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents the endothelial differentiation gene (Edg) family of G-protein coupled receptors, melanocortin/ACTH receptors, and cannabinoid receptors as well as their closely related receptors. The Edg GPCRs bind blood borne lysophospholipids including sphingosine-1-phosphate (S1P) and lysophosphatidic acid (LPA), which are involved in the regulation of cell proliferation, survival, migration, invasion, endothelial cell shape change and cytoskeletal remodeling. The Edg receptors are classified into two subfamilies: the lysophosphatidic acid subfamily that includes LPA1 (Edg2), LPA2 (Edg4), and LPA3 (Edg7); and the S1P subfamily that includes S1P1 (Edg1), S1P2 (Edg5), S1P3 (Edg3), S1P4 (Edg6), and S1P5 (Edg8). Melanocortin receptors bind a group of pituitary peptide hormones known as melanocortins, which include adrenocorticotropic hormone (ACTH) and the different isoforms of melanocyte-stimulating hormones. Two types of cannabinoid receptors, CB1 and CB2, are activated by naturally occurring endocannabinoids, cannabis plant-derived cannabinoids such as tetrahydrocannabinol, or synthetic cannabinoids. The CB receptors are involved in the various physiological processes such as appetite, mood, memory, and pain sensation. CB1 receptor is expressed predominantly in central and peripheral neurons, while CB2 receptor is found mainly in the immune system.


Pssm-ID: 341317 [Multi-domain]  Cd Length: 275  Bit Score: 34.96  E-value: 9.09e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1958683498  11 RSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDwnhQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd14972   201 QPSTSRKLAKTVVIVLGVFLVCWLPLLILLVLDV---LCPSVCDIQAVFYYFLVLALLNSAINPIIYAFRLKEMRR 273
7tmA_Ap5-HTB1-like cd15065
serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of ...
25-86 9.32e-03

serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes Aplysia californica serotonin receptors Ap5-HTB1 and Ap5-HTB2, and similar proteins from bilateria including insects, mollusks, annelids, and worms. Ap5-HTB1 is one of the several different receptors for 5-hydroxytryptamine (5HT, serotonin). In Aplysia, serotonin plays important roles in a variety of behavioral and physiological processes mediated by the central nervous system. These include circadian clock, feeding, locomotor movement, cognition and memory, synaptic growth and synaptic plasticity. Both Ap5-HTB1 and Ap5-HTB2 receptors are coupled to G-proteins that stimulate phospholipase C, leading to the activation of phosphoinositide metabolism. Ap5-HTB1 is expressed in the reproductive system, whereas Ap5-HTB2 is expressed in the central nervous system.


Pssm-ID: 320193 [Multi-domain]  Cd Length: 300  Bit Score: 35.02  E-value: 9.32e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1958683498  25 IVVAFAVCWLPLTIFNTVFDWnhqiIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15065   241 IMGVFLICWLPFFIINIIAAF----CKTCIPPKCFKILTWLGYFNSCLNPIIYSIFNSEFRR 298
7tmA_Prostanoid_R cd14981
G protein-coupled receptors for prostanoids, member of the class A family of ...
3-39 9.63e-03

G protein-coupled receptors for prostanoids, member of the class A family of seven-transmembrane G protein-coupled receptors; Prostanoids are the cyclooxygenase (COX) metabolites of arachidonic acid, which include the prostaglandins (PGD2, PGE2, PGF2alpha), prostacyclin (PGI2), and thromboxane A2 (TxA2). These five major bioactive prostanoids acts as mediators or modulators in a wide range of physiological and pathophysiological processes within the kidney and play important roles in inflammation, platelet aggregation, and vasoconstriction/relaxation, among many others. They act locally by preferentially interacting with G protein-coupled receptors designated DP, EP. FP, IP, and TP, respectively. The phylogenetic tree suggests that the prostanoid receptors can be grouped into two major branches: G(s)-coupled (DP1, EP2, EP4, and IP) and G(i)- (EP3) or G(q)-coupled (EP1, FP, and TP), forming three clusters.


Pssm-ID: 320112 [Multi-domain]  Cd Length: 288  Bit Score: 34.91  E-value: 9.63e-03
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 1958683498   3 DKIRDSKYRSSETKRInVMLLSIVVAFAVCWLPLTIF 39
Cdd:cd14981   207 SRRSARRQKRNEIQMV-VLLLAITVVFSVCWLPLMIR 242
7tmA_TAARs cd15055
trace amine-associated receptors, member of the class A family of seven-transmembrane G ...
25-86 9.65e-03

trace amine-associated receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The trace amine-associated receptors (TAARs) are a distinct subfamily within the class A G protein-coupled receptor family. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. Trace amines, including p-tyramine, beta-phenylethylamine, and tryptamine, are also thought to act as chemical messengers to exert their biological effects in vertebrates. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320183 [Multi-domain]  Cd Length: 285  Bit Score: 34.84  E-value: 9.65e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1958683498  25 IVVAFAVCWLPLTIfNTVFDWNHQIIATCNHNLLFLLchltaMISTCVNPIFYGFLNKNFQR 86
Cdd:cd15055   228 VVGVFLLCWLPYYI-VSLVDPYISTPSSVFDVLIWLG-----YFNSCLNPLIYALFYPWFRK 283
7tmA_Adenosine_R_A2A cd15068
adenosine receptor subtype A2A, member of the class A family of seven-transmembrane G ...
9-85 9.86e-03

adenosine receptor subtype A2A, member of the class A family of seven-transmembrane G protein-coupled receptors; The A2A receptor, a member of the adenosine receptor family of G protein-coupled receptors, binds adenosine as its endogenous ligand and is involved in regulating myocardial oxygen consumption and coronary blood flow. High-affinity A2A and low-affinity A2B receptors are preferentially coupled to G proteins of the stimulatory (Gs) family, which lead to activation of adenylate cyclase and thereby increasing the intracellular cAMP levels. The A2A receptor activation protects against tissue injury and acts as anti-inflammatory agent. In human skin endothelial cells, activation of A2B receptor, but not the A2A receptor, promotes angiogenesis. Alternatively, activated A2A receptor, but not the A2B receptor, promotes angiogenesis in human umbilical vein and lung microvascular endothelial cells. The A2A receptor alters cardiac contractility indirectly by modulating the anti-adrenergic effect of A1 receptor, while the A2B receptor exerts direct effects on cardiac contractile function, but does not modulate beta-adrenergic or A1 anti-adrenergic effects.


Pssm-ID: 320196 [Multi-domain]  Cd Length: 293  Bit Score: 34.91  E-value: 9.86e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958683498   9 KYRSSETKRINVM--LLSIVVAFAVCWLPLTIFN--TVFdwnhqiIATCNHNLLFLLcHLTAMIS---TCVNPIFYGFLN 81
Cdd:cd15068   214 RARSTLQKEVHAAksLAIIVGLFALCWLPLHIINcfTFF------CPDCSHAPLWLM-YLAIVLShtnSVVNPFIYAYRI 286

                  ....
gi 1958683498  82 KNFQ 85
Cdd:cd15068   287 REFR 290
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH