NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1958763819|ref|XP_038961708|]
View 

sodium channel protein type 7 subunit alpha isoform X2 [Rattus norvegicus]

Protein Classification

Ion_trans and Na_channel_gate domain-containing protein (domain architecture ID 11998195)

protein containing domains Na_trans_assoc, Ion_trans, and Na_channel_gate

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
932-1199 1.84e-44

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 161.67  E-value: 1.84e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  932 NSWFECFIGLVTLLCTGTLALEDIYIDQRKTiKIFLEYGDMIFAYIFILEMLLKWVAYGF-KAYFSNNWYKLDFMVVIVL 1010
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPL-TTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1011 CLSLIGKTREDLNPLASIKFLRALRVL---SQFERMKVVLRALIKTTLPAVSVFLVCLMIWLLFSVMGVFLFAGKFYECI 1087
Cdd:pfam00520   80 LISLVLSSVGSLSGLRVLRLLRLLRLLrliRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWE 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1088 DPtrgerfsvfevmnksqcenlvfnesmpwENAKLNFDNVGNGFLSLFQVATFNGWISIMNSAIDSvgvymqpsfEHSLH 1167
Cdd:pfam00520  160 NP----------------------------DNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDG---------KGEFW 202
                          250       260       270
                   ....*....|....*....|....*....|..
gi 1958763819 1168 MYTYFIIFVVFGLFLPLCMLIGVIIRNFNKQK 1199
Cdd:pfam00520  203 AYIYFVSFIILGGFLLLNLFIAVIIDNFQELT 234
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
504-738 6.19e-42

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 154.35  E-value: 6.19e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  504 HPLFDLFLVICIILNICFLALEH-FPMSEELMSLLAIGNLVFIGIYTIEMILKIIAMHP-YGYFQISWHIFDSILVVLGL 581
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  582 TEMLLADIEEITVFILVPLIFI----KLGKYAPPFKNLMRILGRALVALKDLVLLVSIFIYFSAVFGMKLFGRSYKdcvc 657
Cdd:pfam00520   81 ISLVLSSVGSLSGLRVLRLLRLlrllRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLK---- 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  658 hVDQDCQRQRWHMSDFLHAYVTVFRILCGE-WIETLWECMEVAGEAWCIPFYMMVILIGNLLILYLFVALV-SSFASYDA 735
Cdd:pfam00520  157 -TWENPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIiDNFQELTE 235

                   ...
gi 1958763819  736 TTE 738
Cdd:pfam00520  236 RTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1248-1495 4.21e-32

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 125.84  E-value: 4.21e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1248 HRVFNVIIILLICFQATTIMIQNDEQSPQIETAV-FWMNSLFTMLFTLECILKLTAFRC--HYFTSAWNVHDFMVVVFSI 1324
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLTTVlEILDYVFTGIFTLEMLLKIIAAGFkkRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1325 TGLLLPLSIGQYFVppSLVQLLLLSRIIHVLRPGKGPKVFhdlMLPLMLSLPALLNIALLIFLVMFIYAIFGMYNFAYV- 1403
Cdd:pfam00520   81 ISLVLSSVGSLSGL--RVLRLLRLLRLLRLIRRLEGLRTL---VNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKl 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1404 -KKEAGINDVSNFETFGSSMLCLFQVTTFSGWDGMLDAIFNSQwsdcdpdkinpgtqvrgdcgSPSVGIFYFVSYILISW 1482
Cdd:pfam00520  156 kTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK--------------------GEFWAYIYFVSFIILGG 215
                          250
                   ....*....|...
gi 1958763819 1483 LIIVNMYVVLIME 1495
Cdd:pfam00520  216 FLLLNLFIAVIID 228
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
117-405 9.24e-32

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 125.07  E-value: 9.24e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  117 HPLFRLLILISVLTDSILMCMSNLPE-------WILAVENTLLGIYTFEILVKVIARGIWagsFSFLGDLWNWLDFSVTL 189
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQpeeplttVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  190 FELIT----RSSPLSSLPMFKTIRTLRILKIIPLNHGLQSIVVTLVQCLKKLLGAIALALFFLTVSSLFGMGLFMGNLKH 265
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  266 kcvrwpqedgndvmyngtgsqyhilerenfyymegaryallcgnktdaglcpegymcvkeGSNPDNGFTSFDNFGWALLA 345
Cdd:pfam00520  158 ------------------------------------------------------------WENPDNGRTNFDNFPNAFLW 177
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1958763819  346 MFRLMTQ-DYPELLYHQILYASGKIYMIFFVLISFWFAFYMASLFLGILTMAYEQEKQRAS 405
Cdd:pfam00520  178 LFQTMTTeGWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1194-1244 1.71e-19

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


:

Pssm-ID: 240441  Cd Length: 54  Bit Score: 83.38  E-value: 1.71e-19
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 1958763819 1194 NFNKQKIK--GGSNIFITVKQKKQYRALKKLLYADSQKPAARPRNKFQGFICD 1244
Cdd:cd13433      2 NFNQLKKKygGGLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
Na_trans_assoc super family cl05828
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
742-926 5.33e-17

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


The actual alignment was detected with superfamily member pfam06512:

Pssm-ID: 399489  Cd Length: 201  Bit Score: 81.25  E-value: 5.33e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  742 EAKNLQLAVA-------WIKMVINCVLLKILCKEKTVSTE--ATDQTCDPSVKEN-ISGHTLselsntqtflRYKDQSSG 811
Cdd:pfam06512    3 EMNNLQIALAriqrgirFVKRTLRDFCCRLCLLEPQKLPEkkPLDESKDASKKTNqIANHTS----------APKELKKA 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  812 TEKTPVTESESQSLIASPSVSETVPIASGESDIENLDNKETrskSANGSSKEKMKQ---------SSSSECSTVDIAISe 882
Cdd:pfam06512   73 PGGKYGVDEDHMSFITNPNLTVCVPIAEGESDLENEEDEDE---SSQSSDEEKSKQqeqlqqvddSSSSEGSTVDLTDP- 148
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 1958763819  883 eeemvYEHEKSKLHKN------------GYERKSSAGQVSRESRNGKIWRNIRKTC 926
Cdd:pfam06512  149 -----EEELEQIPEEAedlkepedcfpeGCVRRFPCCAVDITKGPWKIWWNLRKTC 199
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
932-1199 1.84e-44

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 161.67  E-value: 1.84e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  932 NSWFECFIGLVTLLCTGTLALEDIYIDQRKTiKIFLEYGDMIFAYIFILEMLLKWVAYGF-KAYFSNNWYKLDFMVVIVL 1010
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPL-TTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1011 CLSLIGKTREDLNPLASIKFLRALRVL---SQFERMKVVLRALIKTTLPAVSVFLVCLMIWLLFSVMGVFLFAGKFYECI 1087
Cdd:pfam00520   80 LISLVLSSVGSLSGLRVLRLLRLLRLLrliRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWE 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1088 DPtrgerfsvfevmnksqcenlvfnesmpwENAKLNFDNVGNGFLSLFQVATFNGWISIMNSAIDSvgvymqpsfEHSLH 1167
Cdd:pfam00520  160 NP----------------------------DNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDG---------KGEFW 202
                          250       260       270
                   ....*....|....*....|....*....|..
gi 1958763819 1168 MYTYFIIFVVFGLFLPLCMLIGVIIRNFNKQK 1199
Cdd:pfam00520  203 AYIYFVSFIILGGFLLLNLFIAVIIDNFQELT 234
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
504-738 6.19e-42

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 154.35  E-value: 6.19e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  504 HPLFDLFLVICIILNICFLALEH-FPMSEELMSLLAIGNLVFIGIYTIEMILKIIAMHP-YGYFQISWHIFDSILVVLGL 581
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  582 TEMLLADIEEITVFILVPLIFI----KLGKYAPPFKNLMRILGRALVALKDLVLLVSIFIYFSAVFGMKLFGRSYKdcvc 657
Cdd:pfam00520   81 ISLVLSSVGSLSGLRVLRLLRLlrllRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLK---- 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  658 hVDQDCQRQRWHMSDFLHAYVTVFRILCGE-WIETLWECMEVAGEAWCIPFYMMVILIGNLLILYLFVALV-SSFASYDA 735
Cdd:pfam00520  157 -TWENPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIiDNFQELTE 235

                   ...
gi 1958763819  736 TTE 738
Cdd:pfam00520  236 RTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1248-1495 4.21e-32

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 125.84  E-value: 4.21e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1248 HRVFNVIIILLICFQATTIMIQNDEQSPQIETAV-FWMNSLFTMLFTLECILKLTAFRC--HYFTSAWNVHDFMVVVFSI 1324
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLTTVlEILDYVFTGIFTLEMLLKIIAAGFkkRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1325 TGLLLPLSIGQYFVppSLVQLLLLSRIIHVLRPGKGPKVFhdlMLPLMLSLPALLNIALLIFLVMFIYAIFGMYNFAYV- 1403
Cdd:pfam00520   81 ISLVLSSVGSLSGL--RVLRLLRLLRLLRLIRRLEGLRTL---VNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKl 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1404 -KKEAGINDVSNFETFGSSMLCLFQVTTFSGWDGMLDAIFNSQwsdcdpdkinpgtqvrgdcgSPSVGIFYFVSYILISW 1482
Cdd:pfam00520  156 kTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK--------------------GEFWAYIYFVSFIILGG 215
                          250
                   ....*....|...
gi 1958763819 1483 LIIVNMYVVLIME 1495
Cdd:pfam00520  216 FLLLNLFIAVIID 228
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
117-405 9.24e-32

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 125.07  E-value: 9.24e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  117 HPLFRLLILISVLTDSILMCMSNLPE-------WILAVENTLLGIYTFEILVKVIARGIWagsFSFLGDLWNWLDFSVTL 189
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQpeeplttVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  190 FELIT----RSSPLSSLPMFKTIRTLRILKIIPLNHGLQSIVVTLVQCLKKLLGAIALALFFLTVSSLFGMGLFMGNLKH 265
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  266 kcvrwpqedgndvmyngtgsqyhilerenfyymegaryallcgnktdaglcpegymcvkeGSNPDNGFTSFDNFGWALLA 345
Cdd:pfam00520  158 ------------------------------------------------------------WENPDNGRTNFDNFPNAFLW 177
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1958763819  346 MFRLMTQ-DYPELLYHQILYASGKIYMIFFVLISFWFAFYMASLFLGILTMAYEQEKQRAS 405
Cdd:pfam00520  178 LFQTMTTeGWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1194-1244 1.71e-19

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 83.38  E-value: 1.71e-19
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 1958763819 1194 NFNKQKIK--GGSNIFITVKQKKQYRALKKLLYADSQKPAARPRNKFQGFICD 1244
Cdd:cd13433      2 NFNQLKKKygGGLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
742-926 5.33e-17

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 399489  Cd Length: 201  Bit Score: 81.25  E-value: 5.33e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  742 EAKNLQLAVA-------WIKMVINCVLLKILCKEKTVSTE--ATDQTCDPSVKEN-ISGHTLselsntqtflRYKDQSSG 811
Cdd:pfam06512    3 EMNNLQIALAriqrgirFVKRTLRDFCCRLCLLEPQKLPEkkPLDESKDASKKTNqIANHTS----------APKELKKA 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  812 TEKTPVTESESQSLIASPSVSETVPIASGESDIENLDNKETrskSANGSSKEKMKQ---------SSSSECSTVDIAISe 882
Cdd:pfam06512   73 PGGKYGVDEDHMSFITNPNLTVCVPIAEGESDLENEEDEDE---SSQSSDEEKSKQqeqlqqvddSSSSEGSTVDLTDP- 148
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 1958763819  883 eeemvYEHEKSKLHKN------------GYERKSSAGQVSRESRNGKIWRNIRKTC 926
Cdd:pfam06512  149 -----EEELEQIPEEAedlkepedcfpeGCVRRFPCCAVDITKGPWKIWWNLRKTC 199
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
932-1199 1.84e-44

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 161.67  E-value: 1.84e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  932 NSWFECFIGLVTLLCTGTLALEDIYIDQRKTiKIFLEYGDMIFAYIFILEMLLKWVAYGF-KAYFSNNWYKLDFMVVIVL 1010
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPL-TTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1011 CLSLIGKTREDLNPLASIKFLRALRVL---SQFERMKVVLRALIKTTLPAVSVFLVCLMIWLLFSVMGVFLFAGKFYECI 1087
Cdd:pfam00520   80 LISLVLSSVGSLSGLRVLRLLRLLRLLrliRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWE 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1088 DPtrgerfsvfevmnksqcenlvfnesmpwENAKLNFDNVGNGFLSLFQVATFNGWISIMNSAIDSvgvymqpsfEHSLH 1167
Cdd:pfam00520  160 NP----------------------------DNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDG---------KGEFW 202
                          250       260       270
                   ....*....|....*....|....*....|..
gi 1958763819 1168 MYTYFIIFVVFGLFLPLCMLIGVIIRNFNKQK 1199
Cdd:pfam00520  203 AYIYFVSFIILGGFLLLNLFIAVIIDNFQELT 234
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
504-738 6.19e-42

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 154.35  E-value: 6.19e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  504 HPLFDLFLVICIILNICFLALEH-FPMSEELMSLLAIGNLVFIGIYTIEMILKIIAMHP-YGYFQISWHIFDSILVVLGL 581
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  582 TEMLLADIEEITVFILVPLIFI----KLGKYAPPFKNLMRILGRALVALKDLVLLVSIFIYFSAVFGMKLFGRSYKdcvc 657
Cdd:pfam00520   81 ISLVLSSVGSLSGLRVLRLLRLlrllRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLK---- 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  658 hVDQDCQRQRWHMSDFLHAYVTVFRILCGE-WIETLWECMEVAGEAWCIPFYMMVILIGNLLILYLFVALV-SSFASYDA 735
Cdd:pfam00520  157 -TWENPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIiDNFQELTE 235

                   ...
gi 1958763819  736 TTE 738
Cdd:pfam00520  236 RTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1248-1495 4.21e-32

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 125.84  E-value: 4.21e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1248 HRVFNVIIILLICFQATTIMIQNDEQSPQIETAV-FWMNSLFTMLFTLECILKLTAFRC--HYFTSAWNVHDFMVVVFSI 1324
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLTTVlEILDYVFTGIFTLEMLLKIIAAGFkkRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1325 TGLLLPLSIGQYFVppSLVQLLLLSRIIHVLRPGKGPKVFhdlMLPLMLSLPALLNIALLIFLVMFIYAIFGMYNFAYV- 1403
Cdd:pfam00520   81 ISLVLSSVGSLSGL--RVLRLLRLLRLLRLIRRLEGLRTL---VNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKl 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1404 -KKEAGINDVSNFETFGSSMLCLFQVTTFSGWDGMLDAIFNSQwsdcdpdkinpgtqvrgdcgSPSVGIFYFVSYILISW 1482
Cdd:pfam00520  156 kTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK--------------------GEFWAYIYFVSFIILGG 215
                          250
                   ....*....|...
gi 1958763819 1483 LIIVNMYVVLIME 1495
Cdd:pfam00520  216 FLLLNLFIAVIID 228
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
117-405 9.24e-32

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 125.07  E-value: 9.24e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  117 HPLFRLLILISVLTDSILMCMSNLPE-------WILAVENTLLGIYTFEILVKVIARGIWagsFSFLGDLWNWLDFSVTL 189
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQpeeplttVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  190 FELIT----RSSPLSSLPMFKTIRTLRILKIIPLNHGLQSIVVTLVQCLKKLLGAIALALFFLTVSSLFGMGLFMGNLKH 265
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  266 kcvrwpqedgndvmyngtgsqyhilerenfyymegaryallcgnktdaglcpegymcvkeGSNPDNGFTSFDNFGWALLA 345
Cdd:pfam00520  158 ------------------------------------------------------------WENPDNGRTNFDNFPNAFLW 177
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1958763819  346 MFRLMTQ-DYPELLYHQILYASGKIYMIFFVLISFWFAFYMASLFLGILTMAYEQEKQRAS 405
Cdd:pfam00520  178 LFQTMTTeGWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1194-1244 1.71e-19

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 83.38  E-value: 1.71e-19
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 1958763819 1194 NFNKQKIK--GGSNIFITVKQKKQYRALKKLLYADSQKPAARPRNKFQGFICD 1244
Cdd:cd13433      2 NFNQLKKKygGGLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
742-926 5.33e-17

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 399489  Cd Length: 201  Bit Score: 81.25  E-value: 5.33e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  742 EAKNLQLAVA-------WIKMVINCVLLKILCKEKTVSTE--ATDQTCDPSVKEN-ISGHTLselsntqtflRYKDQSSG 811
Cdd:pfam06512    3 EMNNLQIALAriqrgirFVKRTLRDFCCRLCLLEPQKLPEkkPLDESKDASKKTNqIANHTS----------APKELKKA 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  812 TEKTPVTESESQSLIASPSVSETVPIASGESDIENLDNKETrskSANGSSKEKMKQ---------SSSSECSTVDIAISe 882
Cdd:pfam06512   73 PGGKYGVDEDHMSFITNPNLTVCVPIAEGESDLENEEDEDE---SSQSSDEEKSKQqeqlqqvddSSSSEGSTVDLTDP- 148
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 1958763819  883 eeemvYEHEKSKLHKN------------GYERKSSAGQVSRESRNGKIWRNIRKTC 926
Cdd:pfam06512  149 -----EEELEQIPEEAedlkepedcfpeGCVRRFPCCAVDITKGPWKIWWNLRKTC 199
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
1287-1495 1.39e-04

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 400395  Cd Length: 424  Bit Score: 46.18  E-value: 1.39e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1287 LFTMLFTLECILKLTAFRCHYFTSAWNVHDFMVVVFSItgLLLPLSIGQYFVPPSLVQLLL-----------LSRIIHVL 1355
Cdd:pfam08016  218 VFFLYFVVEEILKIRKHRPSYLRSVWNLLDLAIVILSV--VLIVLNIYRDFLVDRLIKSVEaspvtfidfdrVAQLDNLY 295
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819 1356 RPGKG----------------PKVFHDLMLPLMLSLPALLNIALLIFLVMFIYAIFGMYNFAyvkkeagiNDVSNFETFG 1419
Cdd:pfam08016  296 RIILAflvfltwlklfkvlrfNKTMSLFTKTLSRAWKDLAGFALMFVIFFFAYAQFGYLLFG--------TQAPNFSNFV 367
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1958763819 1420 SSMLCLFQVttfsgwdgMLDAIfnsQWSDcdpdkINPGTQVrgdcgspsVGIFYFVSYILISWLIIVNMYVVLIME 1495
Cdd:pfam08016  368 KSILTLFRT--------ILGDF---GYNE-----IFSGNRV--------LGPLLFLTFVFLVIFILLNLFLAIIND 419
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
542-739 9.78e-03

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 400395  Cd Length: 424  Bit Score: 40.41  E-value: 9.78e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  542 LVFIGIYTIEMILKIiAMHPYGYFQISWHIFDSILVVL----------------GLTEMLLADIEEITVF---------- 595
Cdd:pfam08016  217 VVFFLYFVVEEILKI-RKHRPSYLRSVWNLLDLAIVILsvvlivlniyrdflvdRLIKSVEASPVTFIDFdrvaqldnly 295
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958763819  596 -----ILVPLIFIKLGKY---APPFKNLMRILGRALVALKDLVLLVSIFIYFSAVFGMKLFGRsykdcvchvdqdcqrQR 667
Cdd:pfam08016  296 riilaFLVFLTWLKLFKVlrfNKTMSLFTKTLSRAWKDLAGFALMFVIFFFAYAQFGYLLFGT---------------QA 360
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1958763819  668 WHMSDFLHAYVTVFRILCGEW-IETLWECMEVAGEAWCIPFYMMVILIgnllILYLFVALVssfasYDATTEV 739
Cdd:pfam08016  361 PNFSNFVKSILTLFRTILGDFgYNEIFSGNRVLGPLLFLTFVFLVIFI----LLNLFLAII-----NDSYVEV 424
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH