NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|675510769|ref|YP_009054967|]
View 

transcriptional regulator ICP4 [Equid alphaherpesvirus 3]

Protein Classification

PHA03307 family protein( domain architecture ID 11476204)

PHA03307 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
189-1295 0e+00

transcriptional regulator ICP4; Provisional


:

Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 987.75  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  189 PAPSGDGARRPPPPGSRPALPPGDRVLQYLESVREAALARTLEAPDGgapspspRAPPPAALGGPPPPSGASKRKRSRPV 268
Cdd:PHA03307  289 SSPRERSPSPSPSSPGSGPAPSSPRASSSSSSSRESSSSSTSSSSES-------SRGAAVSPGPSPSRSPSPSRPPPPAD 361
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  269 PAFLQAAPRTPSPPADRSSPQRRRSPPQPSSPPLPQQPQRRRRESSGAGRPSGPGPDAAREPAAGPA-EPLLTPAGDPWP 347
Cdd:PHA03307  362 PSSPRKRPRPSRAPSSPAASAGRPTRRRARAAVAGRARRRDATGRFPAGRPRPSPLDAGAASGAFYArYPLLTPSGEPWP 441
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  348 GSDPPPKGRVRYGGTGDSREGLWDDPEILLAAERYEAAGGPVPVYVPEMGDSGKQYRALVRLIFENQ-DAMSWLQNSKLS 426
Cdd:PHA03307  442 GSPPPPPGRVRYGGLGDSRPGLWDAPEVREAAARYEASPGPVPVYVPEMGDSAKQYAALVRLLYTPDrEAMGWLQNPKLT 521
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  427 GPEHNLAQFCQKFIHAPRGHGSFITGSVANPLPHVGDAMARGDALWALPHAAASVAMSRRYDRTQKMFILQSLRRAYSDM 506
Cdd:PHA03307  522 GPDQALDQFCQKKFQAPRGSGSFITGSVARPVPHIGDAMAAGNALWALPHAAAAVAMSRRYDRAQKGFLLQSLRRAYAPM 601
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  507 AFPRPEGEgapaaepgsppgpgpaapsprHDASSSSPTAGAPRSPPqararvrdayarvcaalgarrapgepgepgAARR 586
Cdd:PHA03307  602 AYPENAAD---------------------TGAGAAAPAPAAPRPDA------------------------------AAAG 630
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  587 HPGGARVKELGDACVLACHAALEALLRLRGGAAAVPGLqpgELPTPACPPEALCGNPGGLRAAAAAIYELRDLVERARLL 666
Cdd:PHA03307  631 GASARPLRELADACVLACRAVLEALLEGPDGLSAVPGL---AFPRPACPPRALEACPARLESWLRELRDLRDAVYLARLR 707
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  667 GpqDPGARLGDDDLRLAVRAVLVTARTVAPLVRYNPESARARASAWTLTRAALSIPSLAARQMAEAVAAL--------PG 738
Cdd:PHA03307  708 G--DLPVAGGREERVAAVRAVSLVARTVAPLVRYSPRRARARASAWDITDALFSNPSLVPAKLAEALALLepaepqrgAG 785
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  739 APRPREAAEEGEADHLPPLWAHPPQPQPPGPPSPAAHRAPSPGRGPAPAAPCASPAAARGLPEASEAASPRCLGRLPERR 818
Cdd:PHA03307  786 SSPPVRAEAAFRRPGRLRRSGPAADAASRTASKRKSRSHTPDGGSESSGPARPPGAAARPPPARSSESSKSKPAAAGGRA 865
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  819 PRQRGKRRSEPPRPDEGTDDSEERAGAATPP---APKRRPGAPPPRALGPMPAGGPDPRGGFRRVPRGESHTPAPGEAAR 895
Cdd:PHA03307  866 RGKNGRRRPRPPEPRARPGAAAPPKAAAAAPpagAPAPRPRPAPRVKLGPMPPGGPDPRGGFRRVPPGDLHTPAPSAAAL 945
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  896 AAYCSPETVAELVDHPLFPEAWRPALTFDPAALATVAARRTGPPAREGARFGALAPSGPLRRRAAWMRQVPDPEDVRIVV 975
Cdd:PHA03307  946 AAYCPPEVVAELVDHPLFPEPWRPALAFDPEALAEIAARCGGPPPRSGSAFGPLRASGPLRRRAAWMRQIPDPEDVRVVV 1025
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  976 LYHPLPGEDllgGLPAGGAAGREGGPRWSERKGGLSALLAALGNRLLTRGSHCWAGNWTGPPDVSALNRQGVLLLSTGDL 1055
Cdd:PHA03307 1026 LYSPLPGEH---LFGVPAPDASPGGPAWSPERGGLSFLLAALGNRLCLPDSHAWAGNWTGAPDVSALNAQGVLLLSTRDL 1102
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769 1056 AFAGCVEYLCLRLGSARRRLIVLDAVDPEDWPADGPAVGQYHLYMRARLTPRAACAVRWPAERDLSRAVLTSGSVFGPVF 1135
Cdd:PHA03307 1103 AFAGAVEYLCLRLGSARRRLIVLDTVDPEDWPADGPAVSQYHVYLRCAVLPRAQCAVRWPAARDLARAVLTSSRVFGPGL 1182
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769 1136 FARVEAAFARLHPGLEAPRLCRAGNVAYVVETRAGERTRVPMPPRDYRQRVLPVYDGCKDMGAQSRGLAVFDPDFDEGAA 1215
Cdd:PHA03307 1183 FARVEAAFARLYPDAPPLRLCRGANVRYTVRTRLGPRTRVPLPPREYRQAVLPALDGCKDMAAQAEGLGLGAPDFLEGEA 1262
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769 1216 RSHRAANRWGLGAPLRPLYLAAGRRGAldesAAPADLLPPALREFCRVALLEPDLEAGPTVLRVG---EELPARAPHVEW 1292
Cdd:PHA03307 1263 HSHRAANRWGLGAPLRPVYLAEGRRAA----IAGPDELPAVVRAFCRAALLEPDPEAPPLVLPPSaaaEAAHARAPRVTW 1338

                  ...
gi 675510769 1293 EPG 1295
Cdd:PHA03307 1339 AKS 1341
 
Name Accession Description Interval E-value
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
189-1295 0e+00

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 987.75  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  189 PAPSGDGARRPPPPGSRPALPPGDRVLQYLESVREAALARTLEAPDGgapspspRAPPPAALGGPPPPSGASKRKRSRPV 268
Cdd:PHA03307  289 SSPRERSPSPSPSSPGSGPAPSSPRASSSSSSSRESSSSSTSSSSES-------SRGAAVSPGPSPSRSPSPSRPPPPAD 361
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  269 PAFLQAAPRTPSPPADRSSPQRRRSPPQPSSPPLPQQPQRRRRESSGAGRPSGPGPDAAREPAAGPA-EPLLTPAGDPWP 347
Cdd:PHA03307  362 PSSPRKRPRPSRAPSSPAASAGRPTRRRARAAVAGRARRRDATGRFPAGRPRPSPLDAGAASGAFYArYPLLTPSGEPWP 441
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  348 GSDPPPKGRVRYGGTGDSREGLWDDPEILLAAERYEAAGGPVPVYVPEMGDSGKQYRALVRLIFENQ-DAMSWLQNSKLS 426
Cdd:PHA03307  442 GSPPPPPGRVRYGGLGDSRPGLWDAPEVREAAARYEASPGPVPVYVPEMGDSAKQYAALVRLLYTPDrEAMGWLQNPKLT 521
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  427 GPEHNLAQFCQKFIHAPRGHGSFITGSVANPLPHVGDAMARGDALWALPHAAASVAMSRRYDRTQKMFILQSLRRAYSDM 506
Cdd:PHA03307  522 GPDQALDQFCQKKFQAPRGSGSFITGSVARPVPHIGDAMAAGNALWALPHAAAAVAMSRRYDRAQKGFLLQSLRRAYAPM 601
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  507 AFPRPEGEgapaaepgsppgpgpaapsprHDASSSSPTAGAPRSPPqararvrdayarvcaalgarrapgepgepgAARR 586
Cdd:PHA03307  602 AYPENAAD---------------------TGAGAAAPAPAAPRPDA------------------------------AAAG 630
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  587 HPGGARVKELGDACVLACHAALEALLRLRGGAAAVPGLqpgELPTPACPPEALCGNPGGLRAAAAAIYELRDLVERARLL 666
Cdd:PHA03307  631 GASARPLRELADACVLACRAVLEALLEGPDGLSAVPGL---AFPRPACPPRALEACPARLESWLRELRDLRDAVYLARLR 707
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  667 GpqDPGARLGDDDLRLAVRAVLVTARTVAPLVRYNPESARARASAWTLTRAALSIPSLAARQMAEAVAAL--------PG 738
Cdd:PHA03307  708 G--DLPVAGGREERVAAVRAVSLVARTVAPLVRYSPRRARARASAWDITDALFSNPSLVPAKLAEALALLepaepqrgAG 785
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  739 APRPREAAEEGEADHLPPLWAHPPQPQPPGPPSPAAHRAPSPGRGPAPAAPCASPAAARGLPEASEAASPRCLGRLPERR 818
Cdd:PHA03307  786 SSPPVRAEAAFRRPGRLRRSGPAADAASRTASKRKSRSHTPDGGSESSGPARPPGAAARPPPARSSESSKSKPAAAGGRA 865
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  819 PRQRGKRRSEPPRPDEGTDDSEERAGAATPP---APKRRPGAPPPRALGPMPAGGPDPRGGFRRVPRGESHTPAPGEAAR 895
Cdd:PHA03307  866 RGKNGRRRPRPPEPRARPGAAAPPKAAAAAPpagAPAPRPRPAPRVKLGPMPPGGPDPRGGFRRVPPGDLHTPAPSAAAL 945
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  896 AAYCSPETVAELVDHPLFPEAWRPALTFDPAALATVAARRTGPPAREGARFGALAPSGPLRRRAAWMRQVPDPEDVRIVV 975
Cdd:PHA03307  946 AAYCPPEVVAELVDHPLFPEPWRPALAFDPEALAEIAARCGGPPPRSGSAFGPLRASGPLRRRAAWMRQIPDPEDVRVVV 1025
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  976 LYHPLPGEDllgGLPAGGAAGREGGPRWSERKGGLSALLAALGNRLLTRGSHCWAGNWTGPPDVSALNRQGVLLLSTGDL 1055
Cdd:PHA03307 1026 LYSPLPGEH---LFGVPAPDASPGGPAWSPERGGLSFLLAALGNRLCLPDSHAWAGNWTGAPDVSALNAQGVLLLSTRDL 1102
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769 1056 AFAGCVEYLCLRLGSARRRLIVLDAVDPEDWPADGPAVGQYHLYMRARLTPRAACAVRWPAERDLSRAVLTSGSVFGPVF 1135
Cdd:PHA03307 1103 AFAGAVEYLCLRLGSARRRLIVLDTVDPEDWPADGPAVSQYHVYLRCAVLPRAQCAVRWPAARDLARAVLTSSRVFGPGL 1182
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769 1136 FARVEAAFARLHPGLEAPRLCRAGNVAYVVETRAGERTRVPMPPRDYRQRVLPVYDGCKDMGAQSRGLAVFDPDFDEGAA 1215
Cdd:PHA03307 1183 FARVEAAFARLYPDAPPLRLCRGANVRYTVRTRLGPRTRVPLPPREYRQAVLPALDGCKDMAAQAEGLGLGAPDFLEGEA 1262
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769 1216 RSHRAANRWGLGAPLRPLYLAAGRRGAldesAAPADLLPPALREFCRVALLEPDLEAGPTVLRVG---EELPARAPHVEW 1292
Cdd:PHA03307 1263 HSHRAANRWGLGAPLRPVYLAEGRRAA----IAGPDELPAVVRAFCRAALLEPDPEAPPLVLPPSaaaEAAHARAPRVTW 1338

                  ...
gi 675510769 1293 EPG 1295
Cdd:PHA03307 1339 AKS 1341
Herpes_ICP4_C pfam03585
Herpesvirus ICP4-like protein C-terminal region; The immediate-early protein ICP4 ...
875-1301 2.09e-146

Herpesvirus ICP4-like protein C-terminal region; The immediate-early protein ICP4 (infected-cell polypeptide 4) is required for efficient transcription of early and late viral genes and is thus essential for productive infection. ICP4 is a large phosphoprotein that binds DNA in a sequence specific manner as a homodimer. ICP4 represses transcription from LAT, ICP4 and ORF-P that have high-affinity a ICP4 binding site that spans the transcription initiation site. ICP4 proteins have two highly conserved regions, this family contains the C-terminal region that probably acts as an enhancer for the N-terminal region.


Pssm-ID: 281570  Cd Length: 444  Bit Score: 452.53  E-value: 2.09e-146
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769   875 GGFRRVPRGESHTPAPGEAARAAYCSPETVAELVDHPLFPEAWRPALTFDPAALATVAARRTGP-------------PAR 941
Cdd:pfam03585    1 GGFRRFPVGTVHTQTPPQSALNAYCPPGAFAELVDFPLFPEPWRPALRFDPEALADIAARVANAlpgggdynsneiiTSA 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769   942 EGARFGALAPSGPLRRRAAWMRQVPDPEDVRIVVLYHPLPGEDLLGGLPAGGAagreggPRWSERKGGLSALLAALGNRL 1021
Cdd:pfam03585   81 ASRAFGPPTATSKLRRRTAWMRQIPDPEDVRIVVLYSPLPGEDLFCVPAPDTP------PKWSNKRGGLSFLLAALSNRL 154
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  1022 LTRGSHCWAGNWTGPPDVSALNRQGVLLLSTGDLAFAGCVEYLCLRLGSARRRLIVLDAVDPEDWPADGPAVGQYHLYMR 1101
Cdd:pfam03585  155 CLPKTSAWAGNWTGAPDVSALTAMGVLLLSTRDLAFAGAVEYLGRQCMKRKRRLIVMDTVEDRYWPPDGPAISEEHTYMK 234
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  1102 ARLTPRAACAVRWPAERDLSRAVLTSGSVFGPVFFARVEAAFARLHPGLEAPRLCRAGNVAYVVETRAGERTRVPMPPRD 1181
Cdd:pfam03585  235 CIISPRSQCCVRWPGLLDLGRTVIASRRVFGPLTFARLEQAYAELYPEDSPLNLCRGGNVRYTVETRLGPVTCVPTSPRE 314
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  1182 YRQRVLPVYDGCKDMGAQSRGLAVFDPDFDEGAARSHRAANRWGLGAPLRPLYLAAGRRGALdesAAPADLLPPALREFC 1261
Cdd:pfam03585  315 YRAAVLPVFDGCKDLARQSRGLGLGAPDFLCEEAHSHRAARRWGLGAPLRPVYVIEGRMNAI---AGPSFLHVPTARNFC 391
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|..
gi 675510769  1262 RVALLEPDLEAGPTVLRVGEELPARA------------PHVEWEPGFGARST 1301
Cdd:pfam03585  392 RSALLEPDPEARPLVLHIPEGTCSALaedmvasalppcPRITWGQGFGHEEG 443
 
Name Accession Description Interval E-value
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
189-1295 0e+00

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 987.75  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  189 PAPSGDGARRPPPPGSRPALPPGDRVLQYLESVREAALARTLEAPDGgapspspRAPPPAALGGPPPPSGASKRKRSRPV 268
Cdd:PHA03307  289 SSPRERSPSPSPSSPGSGPAPSSPRASSSSSSSRESSSSSTSSSSES-------SRGAAVSPGPSPSRSPSPSRPPPPAD 361
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  269 PAFLQAAPRTPSPPADRSSPQRRRSPPQPSSPPLPQQPQRRRRESSGAGRPSGPGPDAAREPAAGPA-EPLLTPAGDPWP 347
Cdd:PHA03307  362 PSSPRKRPRPSRAPSSPAASAGRPTRRRARAAVAGRARRRDATGRFPAGRPRPSPLDAGAASGAFYArYPLLTPSGEPWP 441
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  348 GSDPPPKGRVRYGGTGDSREGLWDDPEILLAAERYEAAGGPVPVYVPEMGDSGKQYRALVRLIFENQ-DAMSWLQNSKLS 426
Cdd:PHA03307  442 GSPPPPPGRVRYGGLGDSRPGLWDAPEVREAAARYEASPGPVPVYVPEMGDSAKQYAALVRLLYTPDrEAMGWLQNPKLT 521
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  427 GPEHNLAQFCQKFIHAPRGHGSFITGSVANPLPHVGDAMARGDALWALPHAAASVAMSRRYDRTQKMFILQSLRRAYSDM 506
Cdd:PHA03307  522 GPDQALDQFCQKKFQAPRGSGSFITGSVARPVPHIGDAMAAGNALWALPHAAAAVAMSRRYDRAQKGFLLQSLRRAYAPM 601
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  507 AFPRPEGEgapaaepgsppgpgpaapsprHDASSSSPTAGAPRSPPqararvrdayarvcaalgarrapgepgepgAARR 586
Cdd:PHA03307  602 AYPENAAD---------------------TGAGAAAPAPAAPRPDA------------------------------AAAG 630
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  587 HPGGARVKELGDACVLACHAALEALLRLRGGAAAVPGLqpgELPTPACPPEALCGNPGGLRAAAAAIYELRDLVERARLL 666
Cdd:PHA03307  631 GASARPLRELADACVLACRAVLEALLEGPDGLSAVPGL---AFPRPACPPRALEACPARLESWLRELRDLRDAVYLARLR 707
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  667 GpqDPGARLGDDDLRLAVRAVLVTARTVAPLVRYNPESARARASAWTLTRAALSIPSLAARQMAEAVAAL--------PG 738
Cdd:PHA03307  708 G--DLPVAGGREERVAAVRAVSLVARTVAPLVRYSPRRARARASAWDITDALFSNPSLVPAKLAEALALLepaepqrgAG 785
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  739 APRPREAAEEGEADHLPPLWAHPPQPQPPGPPSPAAHRAPSPGRGPAPAAPCASPAAARGLPEASEAASPRCLGRLPERR 818
Cdd:PHA03307  786 SSPPVRAEAAFRRPGRLRRSGPAADAASRTASKRKSRSHTPDGGSESSGPARPPGAAARPPPARSSESSKSKPAAAGGRA 865
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  819 PRQRGKRRSEPPRPDEGTDDSEERAGAATPP---APKRRPGAPPPRALGPMPAGGPDPRGGFRRVPRGESHTPAPGEAAR 895
Cdd:PHA03307  866 RGKNGRRRPRPPEPRARPGAAAPPKAAAAAPpagAPAPRPRPAPRVKLGPMPPGGPDPRGGFRRVPPGDLHTPAPSAAAL 945
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  896 AAYCSPETVAELVDHPLFPEAWRPALTFDPAALATVAARRTGPPAREGARFGALAPSGPLRRRAAWMRQVPDPEDVRIVV 975
Cdd:PHA03307  946 AAYCPPEVVAELVDHPLFPEPWRPALAFDPEALAEIAARCGGPPPRSGSAFGPLRASGPLRRRAAWMRQIPDPEDVRVVV 1025
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  976 LYHPLPGEDllgGLPAGGAAGREGGPRWSERKGGLSALLAALGNRLLTRGSHCWAGNWTGPPDVSALNRQGVLLLSTGDL 1055
Cdd:PHA03307 1026 LYSPLPGEH---LFGVPAPDASPGGPAWSPERGGLSFLLAALGNRLCLPDSHAWAGNWTGAPDVSALNAQGVLLLSTRDL 1102
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769 1056 AFAGCVEYLCLRLGSARRRLIVLDAVDPEDWPADGPAVGQYHLYMRARLTPRAACAVRWPAERDLSRAVLTSGSVFGPVF 1135
Cdd:PHA03307 1103 AFAGAVEYLCLRLGSARRRLIVLDTVDPEDWPADGPAVSQYHVYLRCAVLPRAQCAVRWPAARDLARAVLTSSRVFGPGL 1182
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769 1136 FARVEAAFARLHPGLEAPRLCRAGNVAYVVETRAGERTRVPMPPRDYRQRVLPVYDGCKDMGAQSRGLAVFDPDFDEGAA 1215
Cdd:PHA03307 1183 FARVEAAFARLYPDAPPLRLCRGANVRYTVRTRLGPRTRVPLPPREYRQAVLPALDGCKDMAAQAEGLGLGAPDFLEGEA 1262
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769 1216 RSHRAANRWGLGAPLRPLYLAAGRRGAldesAAPADLLPPALREFCRVALLEPDLEAGPTVLRVG---EELPARAPHVEW 1292
Cdd:PHA03307 1263 HSHRAANRWGLGAPLRPVYLAEGRRAA----IAGPDELPAVVRAFCRAALLEPDPEAPPLVLPPSaaaEAAHARAPRVTW 1338

                  ...
gi 675510769 1293 EPG 1295
Cdd:PHA03307 1339 AKS 1341
Herpes_ICP4_C pfam03585
Herpesvirus ICP4-like protein C-terminal region; The immediate-early protein ICP4 ...
875-1301 2.09e-146

Herpesvirus ICP4-like protein C-terminal region; The immediate-early protein ICP4 (infected-cell polypeptide 4) is required for efficient transcription of early and late viral genes and is thus essential for productive infection. ICP4 is a large phosphoprotein that binds DNA in a sequence specific manner as a homodimer. ICP4 represses transcription from LAT, ICP4 and ORF-P that have high-affinity a ICP4 binding site that spans the transcription initiation site. ICP4 proteins have two highly conserved regions, this family contains the C-terminal region that probably acts as an enhancer for the N-terminal region.


Pssm-ID: 281570  Cd Length: 444  Bit Score: 452.53  E-value: 2.09e-146
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769   875 GGFRRVPRGESHTPAPGEAARAAYCSPETVAELVDHPLFPEAWRPALTFDPAALATVAARRTGP-------------PAR 941
Cdd:pfam03585    1 GGFRRFPVGTVHTQTPPQSALNAYCPPGAFAELVDFPLFPEPWRPALRFDPEALADIAARVANAlpgggdynsneiiTSA 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769   942 EGARFGALAPSGPLRRRAAWMRQVPDPEDVRIVVLYHPLPGEDLLGGLPAGGAagreggPRWSERKGGLSALLAALGNRL 1021
Cdd:pfam03585   81 ASRAFGPPTATSKLRRRTAWMRQIPDPEDVRIVVLYSPLPGEDLFCVPAPDTP------PKWSNKRGGLSFLLAALSNRL 154
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  1022 LTRGSHCWAGNWTGPPDVSALNRQGVLLLSTGDLAFAGCVEYLCLRLGSARRRLIVLDAVDPEDWPADGPAVGQYHLYMR 1101
Cdd:pfam03585  155 CLPKTSAWAGNWTGAPDVSALTAMGVLLLSTRDLAFAGAVEYLGRQCMKRKRRLIVMDTVEDRYWPPDGPAISEEHTYMK 234
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  1102 ARLTPRAACAVRWPAERDLSRAVLTSGSVFGPVFFARVEAAFARLHPGLEAPRLCRAGNVAYVVETRAGERTRVPMPPRD 1181
Cdd:pfam03585  235 CIISPRSQCCVRWPGLLDLGRTVIASRRVFGPLTFARLEQAYAELYPEDSPLNLCRGGNVRYTVETRLGPVTCVPTSPRE 314
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  1182 YRQRVLPVYDGCKDMGAQSRGLAVFDPDFDEGAARSHRAANRWGLGAPLRPLYLAAGRRGALdesAAPADLLPPALREFC 1261
Cdd:pfam03585  315 YRAAVLPVFDGCKDLARQSRGLGLGAPDFLCEEAHSHRAARRWGLGAPLRPVYVIEGRMNAI---AGPSFLHVPTARNFC 391
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|..
gi 675510769  1262 RVALLEPDLEAGPTVLRVGEELPARA------------PHVEWEPGFGARST 1301
Cdd:pfam03585  392 RSALLEPDPEARPLVLHIPEGTCSALaedmvasalppcPRITWGQGFGHEEG 443
Herpes_ICP4_N pfam03584
Herpesvirus ICP4-like protein N-terminal region; The immediate-early protein ICP4 ...
351-509 1.28e-61

Herpesvirus ICP4-like protein N-terminal region; The immediate-early protein ICP4 (infected-cell polypeptide 4) is required for efficient transcription of early and late viral genes and is thus essential for productive infection. ICP4 is a large phosphoprotein that binds DNA in a sequence specific manner as a homodimer. ICP4 represses transcription from LAT, ICP4 and ORF-P that have high-affinity a ICP4 binding site that spans the transcription initiation site. ICP4 proteins have two highly conserved regions, this family contains the N-terminal region that contains sites for DNA binding and homodimerization.


Pssm-ID: 367571 [Multi-domain]  Cd Length: 163  Bit Score: 207.76  E-value: 1.28e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769   351 PPPKGRVRYGGTGDSREGLWDDPEILLAAERYEAAGGPVPVYVPEMGDSGKQYRALVRLIFE-NQDAMSWLQNSKLSGPE 429
Cdd:pfam03584    1 PPPPGRVLYGGLGDSRPGLWGAPEVREARARFEASGAPAPVYVPELGDAAQQYAALVNLLYTpDAEPLGWLQNPRLNPGD 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769   430 HNLAQFCQKFIHAPRGHGSFITGSVANPLPHVGDAMARGDALWALPHAAASVAMSRRYDRTQKMFILQSLRRAYSDMAFP 509
Cdd:pfam03584   81 VALNQICQKISGAARNSGSAVTGSVARAVPHIGYAMAAGRALWALPHAAAAVAMSRRYDRAQKTFLLTSLRRAYAPLAFP 160
PHA03308 PHA03308
transcriptional regulator ICP4; Provisional
351-1085 2.00e-13

transcriptional regulator ICP4; Provisional


Pssm-ID: 165563 [Multi-domain]  Cd Length: 1463  Bit Score: 75.61  E-value: 2.00e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  351 PPPKGRVrYGGTGdSREGLWDDPEILLAAERYEAAGGPVPVYVPEMGDSGKQYRALVR--LIFENQDAMSWLQNSKLSGP 428
Cdd:PHA03308  358 PPSRGQV-YHGSG-YRQSLVDDPQVREAAAEFHANPKSASVYLEEYGMPVEQLERLVEefMVHPLSRVSYGYGGPKLSPR 435
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  429 EHNLAQFCqkfihAPRGHGSFITG----SVANPLPHVGDAMARGDALWALPHAAASVAMSRRYDRTQKMFILQSLRRAYS 504
Cdd:PHA03308  436 DKRLCELC-----ALRGPGSSEGGlsrsAVPTCLPHVAHAMRDGRVSLALPHLTELVRVCRRYDHPQKTYLLAALRRAFV 510
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  505 DMAFP----RPEGEGAPAAEPGSPPGPGPAAPSPRHDASSSSPTAGAPRSpPQARARVRD------AYARVCAALGARRA 574
Cdd:PHA03308  511 PFVFPgaavDPTAASASGDHPVLVGARRIARATRELEAAAKEPPAATPEK-LSSSALLRHtrtcivAAADLMAALTAIDC 589
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  575 PgePGEPGAARRHPGGARVKELGDACVLACHAALEALlrlrgGAAAVPGLQPGELPTPACPPEAL-------------CG 641
Cdd:PHA03308  590 P--PVTINPAKRRPDLYQALSRAPKTVFTWERAMPYC-----AASLWSRLVIGSLPLPSTDDVTLlveameaavgvlgCS 662
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  642 NPGGLRAAAAAIYElrdlverarllGPQDPGARLGDDDlrlAVRAVLVTARTVAPLVRYNPESARARASAWTLTRAAL-- 719
Cdd:PHA03308  663 DEGDVRPSIAYAAS-----------GWRMIATMLGDDS---APGSEHVTDDCPADDDTHHHDRRKRRGGRRTTCRYDLpp 728
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  720 SIPSLAARQMaeavaaLPGAPRPREAAEEGEADHLPPLWAHPPQPQPPGPPSPAAHRAPSPGRgpapaAPCASPAAARGL 799
Cdd:PHA03308  729 GTPDRAAHLL------LYGSPGGGDGAEPSAAQESPANPWPRAPPCDEQEPLSVSPYGPEPDR-----PPDDDFETRKGL 797
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  800 PEAS--EAASPRCLGRLPERRPRQRGKRRSEPPRPDEgtddsEERAGAATPPAPKRRPGAP-PPRALGPMPAGGPDPRGG 876
Cdd:PHA03308  798 KRKSseDHADPIPEGNATKKTCGLQGLPDSLPPAVPE-----TDRDNPLLPPCPITPEGPPcPPREEPQQPQEPQEPQSP 872
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  877 -----------FRRVP---------------RGESHTP---------APGEAARAAYCSPETVAELVDH----------- 910
Cdd:PHA03308  873 sfhiseigealFHSTPvsptilfapegfipnQGDVYRPhgknlgvalSAGEPYVPAHRARPALERLANYlrglssgpags 952
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  911 --PLFPEAWRPALTFDPAALATVAARRTgpPAREGARFgalapsgPLRRRAAW-MRQVPDPEDVRIVVLYHPLPGEdllg 987
Cdd:PHA03308  953 ysATGPADWLPAFARDPVALGEFCKRIS--PVNRGGRC-------VLEERLSWtLRHPADKIYDLIILVSERAPGE---- 1019
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  988 glpaggaagreggprWSERkgglSALLAALGNRLLTRGSHCWAGNWTG------PPDVSALNRQgVLLLSTGDLAFAGCV 1061
Cdd:PHA03308 1020 ---------------FLER----AYAYAALCGRACMPGGACWPESWTRgeypyiPPDEKDPGRS-VAILCTTDLGYAGAV 1079
                         810       820
                  ....*....|....*....|....*
gi 675510769 1062 EYLCLR-LGSARRRLIVLDAVDPED 1085
Cdd:PHA03308 1080 EWMLERaLSTSGRACVVVDARDPGD 1104
PHA03309 PHA03309
transcriptional regulator ICP4; Provisional
351-509 4.59e-08

transcriptional regulator ICP4; Provisional


Pssm-ID: 165564 [Multi-domain]  Cd Length: 2033  Bit Score: 57.94  E-value: 4.59e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  351 PPPKGRVRYGGTGdSREGLWDDPEILLAAERYEAAGGPVPVYVPEMGDSGKQYRALV-RLIFENQDAMSW-LQNSKLSGP 428
Cdd:PHA03309  632 PPAADYVYYGKTG-YRPSMAAHPDVRRAAEEFSASDAAARVYVEEFGMAVEQHERLVaEFMLQPLSRVSHsYGGSRLNKT 710
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  429 EHNLAQFCQK-----------FIHAPRGHGSFITG--SVANPLPHVGDAMARGDALWALPHAAASVAMSRRYDRTQKMFI 495
Cdd:PHA03309  711 EKNLCKICLPpdggddrdgggKSRGGRGGGSKDASrtAMATGVPHIVHAMRDGRAALALPHLMDVIRVCRRYDASQKTYL 790
                         170
                  ....*....|....
gi 675510769  496 LQSLRRAYSDMAFP 509
Cdd:PHA03309  791 LSCLRLAFAPLVFP 804
PHA03247 PHA03247
large tegument protein UL36; Provisional
689-968 8.45e-07

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 53.79  E-value: 8.45e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  689 VTARTVAPLVryNPESARARASAWTLTRAALSIPSLAARQMAEAVAALPGAPRPReAAEEGEADHLPPLWAHPPQPQPPG 768
Cdd:PHA03247 2582 VTSRARRPDA--PPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPA-ANEPDPHPPPTVPPPERPRDDPAP 2658
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  769 PPSPAAHRAPSPGRgPAPAAPCASPAAARGLPEA----SEAASPRCLGRLPERRPRQRGKRRSEPPRPDEGTDDSEERAG 844
Cdd:PHA03247 2659 GRVSRPRRARRLGR-AAQASSPPQRPRRRAARPTvgslTSLADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALPA 2737
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  845 AATPPAP---------KRRPGAPPPRALGPMPAGGPDPRGGFRR---VPRGESHTPAPGEAARAAYCSPETVAELVDHPL 912
Cdd:PHA03247 2738 APAPPAVpagpatpggPARPARPPTTAGPPAPAPPAAPAAGPPRrltRPAVASLSESRESLPSPWDPADPPAAVLAPAAA 2817
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 675510769  913 FPEAWRPALTFDP--AALATVAARRTGPPAREGARFGALAPSGPLRRRAAWMRQVPDP 968
Cdd:PHA03247 2818 LPPAASPAGPLPPptSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAAKP 2875
PHA03247 PHA03247
large tegument protein UL36; Provisional
509-903 1.37e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.86  E-value: 1.37e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  509 PRPEGEGAPAAEPGSPPGPGPAAPSPRHDASSSSPTAGAPRSPPQARARVRDayarvcAALGARRAPGEPGEPGAA---- 584
Cdd:PHA03247 2575 PRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDP------PPPSPSPAANEPDPHPPPtvpp 2648
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  585 ----RRHPGGARVKELGDACVLACHAALEALLR------LRGGAAAVPGLQ----PGELPTPACPP--EALCGNPGGLRA 648
Cdd:PHA03247 2649 perpRDDPAPGRVSRPRRARRLGRAAQASSPPQrprrraARPTVGSLTSLAdpppPPPTPEPAPHAlvSATPLPPGPAAA 2728
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  649 AAAAIYELRDLVERARLLGPQDPGArlgddDLRLAVRAVLVTARTVAPlVRYNPESARARASAWTLTRAALSIPSLAARQ 728
Cdd:PHA03247 2729 RQASPALPAAPAPPAVPAGPATPGG-----PARPARPPTTAGPPAPAP-PAAPAAGPPRRLTRPAVASLSESRESLPSPW 2802
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  729 MAEAVAALPGAPRPREAAEEGEADHLPPLWAHPPQPQPPGPPSPAAHRAP-------------SPGRGPAPAAPCASPAA 795
Cdd:PHA03247 2803 DPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLggsvapggdvrrrPPSRSPAAKPAAPARPP 2882
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  796 ARGLPEASEAASPRCLGRLPERRPRQRGKRRSEPPRPdegTDDSEERAGAATPPAPKRRPGAPPPRALGPMPAGGPDPRG 875
Cdd:PHA03247 2883 VRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQP---QPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGAV 2959
                         410       420       430
                  ....*....|....*....|....*....|....*...
gi 675510769  876 ----------GFRRVPRGESHTPAPGEAARAAYCSPET 903
Cdd:PHA03247 2960 pqpwlgalvpGRVAVPRFRVPQPAPSREAPASSTPPLT 2997
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
538-929 3.56e-04

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 44.98  E-value: 3.56e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  538 ASSSSPTAGAPRSPPQARARVRDAYARVCAALGARRA-PGEPGEPGAARRHPGGARVKELGDACVLACHAALEALLRLRG 616
Cdd:PRK07764  391 AGAPAAAAPSAAAAAPAAAPAPAAAAPAAAAAPAPAAaPQPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPAPAP 470
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  617 GAAAVPGLQPGELPTPACPPEALCGNP------------GGLRAAAAAIYEL---------RDLVERARLLGPQDP---- 671
Cdd:PRK07764  471 AAAPEPTAAPAPAPPAAPAPAAAPAAPaapaapagaddaATLRERWPEILAAvpkrsrktwAILLPEATVLGVRGDtlvl 550
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  672 -------GARLGDDD----LRLAVRAVLvtARTVAPLVRYNPESARARAsawtlTRAALSIPSLAARQMAEAVAalPGAP 740
Cdd:PRK07764  551 gfstgglARRFASPGnaevLVTALAEEL--GGDWQVEAVVGPAPGAAGG-----EGPPAPASSGPPEEAARPAA--PAAP 621
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  741 RPREAAEEGEADHLPPLWAHPPQPQPPGPPSPAAHRA-PSPGRGPAPAAPCASPAAARGLPEASEAASPRCLGRLPERRP 819
Cdd:PRK07764  622 AAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAvPDASDGGDGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQP 701
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  820 RQRGKRRSEPPRPDEGTDDSEERAGAATPPAPKRRPGAPPPRALGPMPAGGPDPRGGfrrVPRGESHTPAPGEAARAAYC 899
Cdd:PRK07764  702 APAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPPDPAGAPAQP---PPPPAPAPAAAPAAAPPPSP 778
                         410       420       430
                  ....*....|....*....|....*....|..
gi 675510769  900 SPETVAELVD--HPLFPEAWRPALTFDPAALA 929
Cdd:PRK07764  779 PSEEEEMAEDdaPSMDDEDRRDAEEVAMELLE 810
PHA03247 PHA03247
large tegument protein UL36; Provisional
808-968 4.53e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 44.93  E-value: 4.53e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  808 PRCLGRLPERRPRQRGKRRSEPP---RPDEGTDDSEERAGAATPPAPKRRPGAPPPRALGPMPAGGPDPRGGFRRVPRGE 884
Cdd:PHA03247 2571 PRPAPRPSEPAVTSRARRPDAPPqsaRPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHPPPTVPPPE 2650
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  885 --SHTPAPGEAARAAYCSPETVAELVDHPlfPEAWRPALTFDPAALATVAARRTGPPAREGARFGALAPSGPLRRRAAWM 962
Cdd:PHA03247 2651 rpRDDPAPGRVSRPRRARRLGRAAQASSP--PQRPRRRAARPTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPAAA 2728

                  ....*.
gi 675510769  963 RQVPDP 968
Cdd:PHA03247 2729 RQASPA 2734
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
495-909 1.14e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 43.44  E-value: 1.14e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  495 ILQSLRRAYSDMAFPRPEGEGAPAAEPGSPPGPgpaapsprhdASSSSPTAGAPRSPPQARARVRDAYARVCAALGARRA 574
Cdd:PRK07764  374 LLARLERLERRLGVAGGAGAPAAAAPSAAAAAP----------AAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPS 443
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  575 PGEPGEPGAARRHPGGARvkelGDACVLACHAALEALLRLRGGAAAVPGLQPGELPTPACPPEALCGNPG-GLRAAAAAI 653
Cdd:PRK07764  444 PAGNAPAGGAPSPPPAAA----PSAQPAPAPAAAPEPTAAPAPAPPAAPAPAAAPAAPAAPAAPAGADDAaTLRERWPEI 519
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  654 YEL---------RDLVERARLLGPQDP-----------GARLGDDD----LRLAVRAVLvtARTVAPLVRYNPESARARA 709
Cdd:PRK07764  520 LAAvpkrsrktwAILLPEATVLGVRGDtlvlgfstgglARRFASPGnaevLVTALAEEL--GGDWQVEAVVGPAPGAAGG 597
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  710 sawtlTRAALSIPSLAARQMAEAVAalPGAPRPREAAEEGEADHLPPLWAHPPQPQPPGPPSPAAHRA-PSPGRGPAPAA 788
Cdd:PRK07764  598 -----EGPPAPASSGPPEEAARPAA--PAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAvPDASDGGDGWP 670
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  789 PCASPAAARGLPEASEAASPRCLGRLPERRPRQRGKRRSEPPRPDEGTDDSEERAGAATPPAPKRRPGAPPPRALGPMPA 868
Cdd:PRK07764  671 AKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPPD 750
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|.
gi 675510769  869 GGPDPRGGfrrVPRGESHTPAPGEAARAAYCSPETVAELVD 909
Cdd:PRK07764  751 PAGAPAQP---PPPPAPAPAAAPAAAPPPSPPSEEEEMAED 788
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
702-874 1.34e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 43.30  E-value: 1.34e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  702 PESARARASAWTLTRAALSIPSLAARQMAEAVAALPGAPRPREAAEEGEADHLPPLWAHPPQPQPPGPPSPAAHRAPSPG 781
Cdd:PRK07003  372 VPARVAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPAPPATADRGDDAADGDAPVPA 451
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  782 RGPAPAAPCASPAAARGLPEASEAASPRCLGRLPERRPRQRGKRRSEPPRPDEGTDDSEERAGAATPPAPKRRPGAPPPR 861
Cdd:PRK07003  452 KANARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDARAPAAASREDAPAAAAPPAPE 531
                         170
                  ....*....|...
gi 675510769  862 ALGPMPAGGPDPR 874
Cdd:PRK07003  532 ARPPTPAAAAPAA 544
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
540-945 6.81e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 40.74  E-value: 6.81e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  540 SSSPTAGAPRSPPQARARVRDAY--ARVCAALGARRAPGEPGEPGAARRHPGGARVKElgdacvlacHAALEALLRLRGG 617
Cdd:PRK07764  383 RRLGVAGGAGAPAAAAPSAAAAApaAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPA---------PPSPAGNAPAGGA 453
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  618 AAAVPGLQPGELPTPACPPealcGNPGGLRAAAAAIYELRDLVERARLLGPQDPGARLGDDDLRLA---VRAVLVTA-RT 693
Cdd:PRK07764  454 PSPPPAAAPSAQPAPAPAA----APEPTAAPAPAPPAAPAPAAAPAAPAAPAAPAGADDAATLRERwpeILAAVPKRsRK 529
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  694 VAPLVRYNPESARARASAWTLTRAAlsiPSLAAR--------QMAEAVAALPGAPRPREAAEEGEADHLPPLWAHPPQPQ 765
Cdd:PRK07764  530 TWAILLPEATVLGVRGDTLVLGFST---GGLARRfaspgnaeVLVTALAEELGGDWQVEAVVGPAPGAAGGEGPPAPASS 606
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  766 PPGPPSPAAHRAPSPGRGPAPAAPCASpaaarglPEASEAASPRCLGRLPERRPRQRGKRRSEPPRPDEGTDDSEERAGA 845
Cdd:PRK07764  607 GPPEEAARPAAPAAPAAPAAPAPAGAA-------AAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPA 679
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675510769  846 ATPPAPKRRPGAPPPRALGPMPAGGPDPRGGFRRVPRGESHTPAPGEAARAAYCSPETVAELVDHPLFPEAWRPALTFDP 925
Cdd:PRK07764  680 APPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPPDPAGAPAQPP 759
                         410       420
                  ....*....|....*....|
gi 675510769  926 AALATVAARRTGPPAREGAR 945
Cdd:PRK07764  760 PPPAPAPAAAPAAAPPPSPP 779
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH