NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|769829439|ref|YP_009128364|]
View 

NADH dehydrogenase subunit 3 (mitochondrion) [Tribolium confusum]

Protein Classification

NADH dehydrogenase subunit 3( domain architecture ID 10009588)

NADH dehydrogenase subunit 3 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that couples the transfer of electrons from NADH to quinone with the translocation of protons across the membrane

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ND3 MTH00148
NADH dehydrogenase subunit 3; Provisional
1-116 2.68e-40

NADH dehydrogenase subunit 3; Provisional


:

Pssm-ID: 214433 [Multi-domain]  Cd Length: 117  Bit Score: 129.98  E-value: 2.68e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   1 MTTLTIMSLVIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVT 80
Cdd:MTH00148   1 MLSILLSLLFALILSPVLLLLGLVLSKRSYSDREKSSPFECGFDPISSARSPFSLRFFLLAILFLVFDVEIVLLFPVLQS 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 769829439  81 LKINSPISYMPTLTLFIIILMMGLIHEWKQGALNWT 116
Cdd:MTH00148  81 LGSSFSVWSLTSLFIFLLILILGLFHEWNEGSLDWV 116
 
Name Accession Description Interval E-value
ND3 MTH00148
NADH dehydrogenase subunit 3; Provisional
1-116 2.68e-40

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 214433 [Multi-domain]  Cd Length: 117  Bit Score: 129.98  E-value: 2.68e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   1 MTTLTIMSLVIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVT 80
Cdd:MTH00148   1 MLSILLSLLFALILSPVLLLLGLVLSKRSYSDREKSSPFECGFDPISSARSPFSLRFFLLAILFLVFDVEIVLLFPVLQS 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 769829439  81 LKINSPISYMPTLTLFIIILMMGLIHEWKQGALNWT 116
Cdd:MTH00148  81 LGSSFSVWSLTSLFIFLLILILGLFHEWNEGSLDWV 116
Oxidored_q4 pfam00507
NADH-ubiquinone/plastoquinone oxidoreductase, chain 3;
29-114 3.61e-28

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3;


Pssm-ID: 425725 [Multi-domain]  Cd Length: 94  Bit Score: 98.26  E-value: 3.61e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   29 SISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKINSPISYMPTLtLFIIILMMGLIHEW 108
Cdd:pfam00507  10 KRPNPEKLSPYECGFDPVGDARLRFSVRFYLVAILFLIFDVEVVFLFPWAVSFRELGWFGFVEML-IFIAILLVGLVYAW 88

                  ....*.
gi 769829439  109 KQGALN 114
Cdd:pfam00507  89 KKGALE 94
NuoA COG0838
NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Energy production and conversion];
6-115 3.76e-18

NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Energy production and conversion];


Pssm-ID: 223908 [Multi-domain]  Cd Length: 123  Bit Score: 73.79  E-value: 3.76e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   6 IMSLVIMMISSILIVLLNLTSKKSiSDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKINS 85
Cdd:COG0838   13 IFLVVALLLGVLMLFLSKLLGPRR-PNPEKLSPYECGNPPFGGARLRFSVQYYLVAILFVVFDVEVVFLFPWAVSFKELG 91
                         90       100       110
                 ....*....|....*....|....*....|
gi 769829439  86 PISYMPTLtLFIIILMMGLIHEWKQGALNW 115
Cdd:COG0838   92 LFGFLEML-VFIFVLLVGFVYAWKKGALEW 120
 
Name Accession Description Interval E-value
ND3 MTH00148
NADH dehydrogenase subunit 3; Provisional
1-116 2.68e-40

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 214433 [Multi-domain]  Cd Length: 117  Bit Score: 129.98  E-value: 2.68e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   1 MTTLTIMSLVIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVT 80
Cdd:MTH00148   1 MLSILLSLLFALILSPVLLLLGLVLSKRSYSDREKSSPFECGFDPISSARSPFSLRFFLLAILFLVFDVEIVLLFPVLQS 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 769829439  81 LKINSPISYMPTLTLFIIILMMGLIHEWKQGALNWT 116
Cdd:MTH00148  81 LGSSFSVWSLTSLFIFLLILILGLFHEWNEGSLDWV 116
ND3 MTH00161
NADH dehydrogenase subunit 3; Provisional
3-115 1.15e-37

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177217 [Multi-domain]  Cd Length: 113  Bit Score: 122.96  E-value: 1.15e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   3 TLTIMSLVIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLK 82
Cdd:MTH00161   1 MILIILLIILLISIILMILASLLSKKSIMDREKSSPFECGFDPKSSARLPFSLRFFLIAIIFLIFDVEIALLLPMIFIFK 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 769829439  83 INSPISYMPTLTLFIIILMMGLIHEWKQGALNW 115
Cdd:MTH00161  81 TSNMMSWLITSSFFILILLLGLYYEWNQGALEW 113
ND3 MTH00202
NADH dehydrogenase subunit 3; Provisional
1-117 1.81e-35

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 214455 [Multi-domain]  Cd Length: 117  Bit Score: 117.40  E-value: 1.81e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   1 MTTLTIMSLVIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVT 80
Cdd:MTH00202   1 MLLILFMSILSILISSLLFLVSWMLSFRSLMDREKSSPFECGFDPKESARLPFSMRFFLLAVIFLVFDIEIALLLPLPLV 80
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 769829439  81 LKINSPISYMPTLTLFIIILMMGLIHEWKQGALNWTY 117
Cdd:MTH00202  81 LKSSWSKGGLLGGTIFLLILIGGLIHEWKEGSLDWVK 117
ND3 MTH00042
NADH dehydrogenase subunit 3; Validated
1-115 2.48e-31

NADH dehydrogenase subunit 3; Validated


Pssm-ID: 177117 [Multi-domain]  Cd Length: 116  Bit Score: 106.99  E-value: 2.48e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   1 MTTLTIMSLVIMMISSILIVLLNLTSKKSIsDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVT 80
Cdd:MTH00042   1 MTNLIFFLLIILILTSLLLLAGHFLPSRSP-DLEKSSPYECGFDPLNSARLPFSFRFFLVAILFLLFDLEIALLFPLPPA 79
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 769829439  81 LKINSPISYMPTLTLFIIILMMGLIHEWKQGALNW 115
Cdd:MTH00042  80 TLITNPSTLLPISLIFLIILTIGLVYEWVNGGLEW 114
ND3 MTH00012
NADH dehydrogenase subunit 3; Validated
1-116 5.23e-30

NADH dehydrogenase subunit 3; Validated


Pssm-ID: 164588 [Multi-domain]  Cd Length: 117  Bit Score: 103.78  E-value: 5.23e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   1 MTTLTIMSLVIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVT 80
Cdd:MTH00012   1 MSLMMIPMMISLILPPLVLGAAWVLAARSTADREKTSPFECGFDPHKTARIPFSLRFFLLAIIFIVFDIEIVLLMPVPTI 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 769829439  81 LKINSPISYMPTLTLFIIILMMGLIHEWKQGALNWT 116
Cdd:MTH00012  81 LMTSTSKTVVYTSILFLLILVIGLIHEWREGSLDWS 116
Oxidored_q4 pfam00507
NADH-ubiquinone/plastoquinone oxidoreductase, chain 3;
29-114 3.61e-28

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3;


Pssm-ID: 425725 [Multi-domain]  Cd Length: 94  Bit Score: 98.26  E-value: 3.61e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   29 SISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKINSPISYMPTLtLFIIILMMGLIHEW 108
Cdd:pfam00507  10 KRPNPEKLSPYECGFDPVGDARLRFSVRFYLVAILFLIFDVEVVFLFPWAVSFRELGWFGFVEML-IFIAILLVGLVYAW 88

                  ....*.
gi 769829439  109 KQGALN 114
Cdd:pfam00507  89 KKGALE 94
ND3 MTH00136
NADH dehydrogenase subunit 3; Provisional
7-115 5.11e-28

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177194 [Multi-domain]  Cd Length: 116  Bit Score: 98.45  E-value: 5.11e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   7 MSLV--IMMISSILIVLLNLTS---KKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTL 81
Cdd:MTH00136   1 MNLIttILTITIALSLILAIVSfwlPQMTPDHEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLEIALLLPLPWGD 80
                         90       100       110
                 ....*....|....*....|....*....|....
gi 769829439  82 KINSPISYMPTLTLFIIILMMGLIHEWKQGALNW 115
Cdd:MTH00136  81 QLPSPLLTFFWATAVLILLTLGLIYEWLQGGLEW 114
ND3 MTH00203
NADH dehydrogenase subunit 3; Provisional
3-115 4.02e-27

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 214456 [Multi-domain]  Cd Length: 112  Bit Score: 96.12  E-value: 4.02e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   3 TLTIMSLVIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLK 82
Cdd:MTH00203   2 NLIMLFFLIALLLSLILLFIAFWLPKVNPDGEKLSPYECGFDPLGSARLPFSLQFFLVALSFLLFDLEIALLLPLPWSNQ 81
                         90       100       110
                 ....*....|....*....|....*....|...
gi 769829439  83 INSPISYMptLTLFIIILMMGLIHEWKQGALNW 115
Cdd:MTH00203  82 LSSLSLLL--AFLFLILLTLGLIYEWLQGGLEW 112
ND3 MTH00069
NADH dehydrogenase subunit 3; Provisional
7-115 7.24e-27

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177141 [Multi-domain]  Cd Length: 114  Bit Score: 95.83  E-value: 7.24e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   7 MSLVIMMISSILIVLLNLTS---KKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKI 83
Cdd:MTH00069   1 LIMLMLLISTILSLILITISfwlPLNNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPTPWASQL 80
                         90       100       110
                 ....*....|....*....|....*....|..
gi 769829439  84 NSPISYMPTLTLFIIILMMGLIHEWKQGALNW 115
Cdd:MTH00069  81 NTPTNTLFWSTLILILLTLGLIYEWIQGGLEW 112
ND3 MTH00113
NADH dehydrogenase subunit 3; Provisional
4-116 6.86e-26

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177175 [Multi-domain]  Cd Length: 114  Bit Score: 93.02  E-value: 6.86e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   4 LTIMSLVIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKI 83
Cdd:MTH00113   2 NLISMLTISLALSTILTTLNFWLTQTKPDNEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAINL 81
                         90       100       110
                 ....*....|....*....|....*....|...
gi 769829439  84 NSPISYMPTLTLFIIILMMGLIHEWKQGALNWT 116
Cdd:MTH00113  82 TTPTTTLTWATIILTLLTLGLIYEWLQGGLEWA 114
ND3 MTH00106
NADH dehydrogenase subunit 3; Provisional
6-116 1.00e-25

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177168 [Multi-domain]  Cd Length: 115  Bit Score: 92.70  E-value: 1.00e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   6 IMSLVIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKINS 85
Cdd:MTH00106   4 MLTLLTNTLLASLLVLIAFWLPQLNIYSEKASPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTNN 83
                         90       100       110
                 ....*....|....*....|....*....|.
gi 769829439  86 PISYMPTLTLFIIILMMGLIHEWKQGALNWT 116
Cdd:MTH00106  84 LNTMLTMALLLISLLALSLAYEWTQKGLEWT 114
PRK06602 PRK06602
NADH:ubiquinone oxidoreductase subunit A; Validated
9-116 5.35e-23

NADH:ubiquinone oxidoreductase subunit A; Validated


Pssm-ID: 180638 [Multi-domain]  Cd Length: 121  Bit Score: 86.07  E-value: 5.35e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   9 LVIMMISSILIVLLNLTSK---KSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKINS 85
Cdd:PRK06602  12 LIFLIVAIGLGILLLVAGKllgPRAPDREKNSPYESGFEAFGDARMKFDVRFYLVAILFVIFDLEAAFLFPWAVSFREIG 91
                         90       100       110
                 ....*....|....*....|....*....|.
gi 769829439  86 PISYMpTLTLFIIILMMGLIHEWKQGALNWT 116
Cdd:PRK06602  92 WLGFV-EAMIFILVLLVGLVYLWRKGALDWE 121
ND3 MTH00018
NADH dehydrogenase subunit 3; Validated
9-115 1.13e-22

NADH dehydrogenase subunit 3; Validated


Pssm-ID: 164592 [Multi-domain]  Cd Length: 113  Bit Score: 85.11  E-value: 1.13e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   9 LVIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKINSPIS 88
Cdd:MTH00018   7 LIFSVVLSALFSGASYFLGVKQPDREKVSAYECGFDPFGFPGRPFSIRFFLIGILFLIFDLEISFLFPWCVLYNQIAPFG 86
                         90       100
                 ....*....|....*....|....*..
gi 769829439  89 YMpTLTLFIIILMMGLIHEWKQGALNW 115
Cdd:MTH00018  87 FW-TMVGFLFILTLGLIYEWIKGGLEW 112
ND3 MTH00055
NADH dehydrogenase subunit 3; Provisional
32-115 1.05e-21

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177128 [Multi-domain]  Cd Length: 118  Bit Score: 82.84  E-value: 1.05e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439  32 DREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKINSPISYMpTLTLFIIILMMGLIHEWKQG 111
Cdd:MTH00055  35 DSEKVSVYECGFDPFESSRIPFSVRFFLVGILFLIFDLEISFLFPWCVVYNQIGLFGFW-VMYLFLIILTIGLIYEWVKG 113

                 ....
gi 769829439 112 ALNW 115
Cdd:MTH00055 114 GLEW 117
NuoA COG0838
NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Energy production and conversion];
6-115 3.76e-18

NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Energy production and conversion];


Pssm-ID: 223908 [Multi-domain]  Cd Length: 123  Bit Score: 73.79  E-value: 3.76e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   6 IMSLVIMMISSILIVLLNLTSKKSiSDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKINS 85
Cdd:COG0838   13 IFLVVALLLGVLMLFLSKLLGPRR-PNPEKLSPYECGNPPFGGARLRFSVQYYLVAILFVVFDVEVVFLFPWAVSFKELG 91
                         90       100       110
                 ....*....|....*....|....*....|
gi 769829439  86 PISYMPTLtLFIIILMMGLIHEWKQGALNW 115
Cdd:COG0838   92 LFGFLEML-VFIFVLLVGFVYAWKKGALEW 120
ND3 MTH00030
NADH dehydrogenase subunit 3; Provisional
10-115 1.24e-16

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 164603 [Multi-domain]  Cd Length: 123  Bit Score: 69.96  E-value: 1.24e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439  10 VIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKINSPISY 89
Cdd:MTH00030  18 IILLLVSISFTLGNSRIGLTKPDSEKSSIYECGFDPFGKIRTPFTIKFVLVGILFMIFDIEISFLFPWSIVFNQLNLFSF 97
                         90       100
                 ....*....|....*....|....*.
gi 769829439  90 MPTLTlFIIILMMGLIHEWKQGALNW 115
Cdd:MTH00030  98 WIVYT-FLIVLAIGLAYEWIKGGLEW 122
ndhC CHL00022
NADH dehydrogenase subunit 3
9-116 3.48e-12

NADH dehydrogenase subunit 3


Pssm-ID: 176964 [Multi-domain]  Cd Length: 120  Bit Score: 58.46  E-value: 3.48e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   9 LVIMMISSILIVLLNLTSKKSISDR---EKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKINS 85
Cdd:CHL00022  11 WAFLIISSLIPILAFLISGLLAPISkgpEKLSSYESGIEPMGDAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLG 90
                         90       100       110
                 ....*....|....*....|....*....|.
gi 769829439  86 PISYMPTLtLFIIILMMGLIHEWKQGALNWT 116
Cdd:CHL00022  91 VSAFIEAL-IFVLILIVGLVYAWRKGALEWS 120
PRK08489 PRK08489
NAD(P)H-quinone oxidoreductase subunit 3;
35-115 6.46e-12

NAD(P)H-quinone oxidoreductase subunit 3;


Pssm-ID: 181448 [Multi-domain]  Cd Length: 129  Bit Score: 57.75  E-value: 6.46e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439  35 KSSPFECGFDP-KSSTRLpfSLHFFLIAIIFLIFDVEITLLFPLIVTLKINSPISYMPTLtLFIIILMMGLIHEWKQGAL 113
Cdd:PRK08489  47 KLAIYECGPEPvKQPNRI--SSHFYIMALLFILFDVEIVFMFPWAVDFKLLGLFGLIEML-LFIVLLTIGFIYAWKKGAL 123

                 ..
gi 769829439 114 NW 115
Cdd:PRK08489 124 EW 125
PRK07756 PRK07756
NADH-quinone oxidoreductase subunit A;
32-115 2.39e-09

NADH-quinone oxidoreductase subunit A;


Pssm-ID: 169084 [Multi-domain]  Cd Length: 122  Bit Score: 50.90  E-value: 2.39e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439  32 DREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKiNSPISYMPTLTLFIIILMMGLIHEWKQG 111
Cdd:PRK07756  39 SAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETLFLYPWAVAYD-KLGLFALIEMLIFVVMLLVGLAYAWKKK 117

                 ....
gi 769829439 112 ALNW 115
Cdd:PRK07756 118 VLQW 121
PRK07928 PRK07928
NADH dehydrogenase subunit A; Validated
32-116 3.08e-09

NADH dehydrogenase subunit A; Validated


Pssm-ID: 181171 [Multi-domain]  Cd Length: 119  Bit Score: 50.44  E-value: 3.08e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439  32 DREKSSPFECGFDPKSSTRLP--FSLHFFLIAIIFLIFDVEITLLFPLIVTLKiNSPISYMPTLTLFIIILMMGLIHEWK 109
Cdd:PRK07928  34 NRAKLEAYECGIEPTPQPAGGgrFPVKYYLTAMLFIVFDIEIVFLYPWAVSFD-ALGVFGLVEMALFMLTVFVAYAYVWR 112

                 ....*..
gi 769829439 110 QGALNWT 116
Cdd:PRK07928 113 RGGLEWD 119
ND3 MTH00092
NADH dehydrogenase subunit 3; Provisional
6-117 5.06e-07

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177155  Cd Length: 111  Bit Score: 44.50  E-value: 5.06e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439   6 IMSLVIMMISSILIVLLNLTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVtlkinS 85
Cdd:MTH00092   5 IFVFLFTLLLLMLLYLLNFFLSVKKFDLLKVSSFECGFESVGKIQNSFSIHFFKIMLMFVIFDLEIVMFLGLLV-----S 79
                         90       100       110
                 ....*....|....*....|....*....|..
gi 769829439  86 PISYMPTLTLFIIILMMGLIHEWKQGALNWTY 117
Cdd:MTH00092  80 DFSSLISFFMLMIFIFFGFYMEWWYGKLIWVI 111
ND3 MTH00060
NADH dehydrogenase subunit 3; Provisional
24-117 4.34e-06

NADH dehydrogenase subunit 3; Provisional


Pssm-ID: 177132  Cd Length: 116  Bit Score: 42.19  E-value: 4.34e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439  24 LTSKKSISDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLL--FPLIVTLKINSPISYmptltLFIIILM 101
Cdd:MTH00060  26 WNNKIYSGGFSWVSSFECGFFSSGLSENCFSFTYFFLLVFFVIFDLEISLLlnMPFQGLLFYNFWYYY-----FFLLLLF 100
                         90
                 ....*....|....*.
gi 769829439 102 MGLIHEWKQGALNWTY 117
Cdd:MTH00060 101 LGFVVELFSGYVRWVY 116
PRK06432 PRK06432
NADH dehydrogenase subunit A; Validated
31-115 2.37e-04

NADH dehydrogenase subunit A; Validated


Pssm-ID: 102372  Cd Length: 144  Bit Score: 38.25  E-value: 2.37e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 769829439  31 SDREKSSPFECGFDPKSSTRLPFSLHFFLIAIIFLIFDVEITLLFPLIVTLKINSPISYMPTLtLFIIILMMGLIHEWKQ 110
Cdd:PRK06432  59 SDQSYLEPYESGEVAREIWGGPSINQYYIVVLLFVVFDVDMLLLFPWAFDFKRLGLIPFIETL-IFLAMPLFAVYYAFKM 137

                 ....*
gi 769829439 111 GALNW 115
Cdd:PRK06432 138 GYMRW 142
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH