Conserved Protein Domain Family
SIC
?
pfam03482: SIC 
sic protein repeat
Serotype M1 group A Streptococcus strains cause epidemic waves of human infections. This 30 aa repeat occurs in the sic protein, an extracellular protein (streptococcal inhibitor of complement) that inhibits human complement.
Links
?
Statistics
?
PSSM-Id: 281480
Aligned: 2 rows
Threshold Bit Score: 46.6115
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
Q7DAL1  96 DDWSSDKKDETEDKTrPPYGEALGTGYEKR 125 Streptococcus pyogenes serotype M1
Q7DAL1 126 DDWGGPGTVATDPYT-PPYGGALGTGYEKR 154 Streptococcus pyogenes serotype M1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap