Release Notes For GenBank Release 125

GBREL.TXT          Genetic Sequence Data Bank
                         Aug 15 2001

               NCBI-GenBank Flat File Release 125.0

                    Distribution Release Notes

 12813516 loci, 13543364296 bases, from 12813516 reported sequences

  This document describes the format and content of the flat files that
comprise releases of the GenBank database. If you have any questions or
comments about GenBank or this document, please contact NCBI via email
at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 125.0
1.2 Cutoff Date
1.3 Important Changes in Release 125.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 125.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 125.0 is a release of sequence data by NCBI in the GenBank
flat file format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Sequence data is also incorporated from the Genome Sequence Data Base
(GSDB), Santa Fe, NM.  Patent sequences are incorporated through arrangements
with the U.S. Patent and Trademark Office, and via the collaborating
international databases from other international patent offices.  The database
is converted to various output formats, including the Flat File and Abstract
Syntax Notation 1 (ASN.1) versions.  The ASN.1 and Flat File forms of the data
are available at NCBI's anonymous FTP server: ftp.ncbi.nih.gov .

1.2 Cutoff Date

  This full release, 125.0, incorporates data available to the collaborating
databases as of August 19, 2001.  For more recent data, users are advised to:

  o Download the GenBank Update files by anonymous FTP to 'ftp.ncbi.nih.gov':

	ftp://ftp.ncbi.nih.gov/ncbi-asn1 (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank   (flatfile format)

    Mirrors of the GenBank FTP site at the NCBI are available from the San Diego
    Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

    Some users who experience slow FTP transfers of large files (entire releases,
    the GenBank Cumulative Update, etc) might realize an improvement in transfer
    rates from these alternate sites when traffic at the NCBI is high.

  o Use the Network-Entrez or Web-Entrez applications to query interactively
    the Entrez: Nucleotides database (see Section 6.4 of this document).

  o Use the NCBI 'query' email server to search the GenBank Updates. Instructions
    regarding the use of the e-mail server can be obtained by sending an email
    message with the word 'help' in it to:  query@ncbi.nlm.nih.gov

1.3 Important Changes in Release 125.0

1.3.1 Organizational changes

  Due to database growth, the EST division is now being split into 123 pieces.

  Due to database growth, the GSS division is now being split into 40 pieces.

  Due to database growth, the PRI division is now being split into 13 pieces.

1.3.2 NCBI's ftp address has changed

  NCBI's FTP server has a new address:

	old address: ncbi.nlm.nih.gov
	new address: ftp.ncbi.nih.gov

  For the moment, the old address still works. But due to the volume of FTP
traffic at our site, we cannot continue to support the old address much beyond
October 15, 2001.

(In fact, if FTP traffic levels increase substantially, we may not be able to
 continue supporting the old address even that long.)

  So we urge all users of the NCBI FTP server to switch to the new address
sooner, rather than later. Please contact the NCBI Service Desk if you have
any questions about this change:

	info@ncbi.nlm.nih.gov

1.4 Upcoming Changes

1.4.1 LOCUS line format change : to accomodate longer names and sequences

  When the LOCUS line format for the GenBank flatfile was designed nearly
two decades ago, sequences over 10 Mbp in length were not anticipated. As
a result, the maximum length of a LOCUS name is nine characters, and the
maximum length of a sequence is 9,999,999 bases :

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
LOCUS       AB000383     5423 bp    DNA   circular  VRL       05-FEB-1999

Positions  Contents
---------  --------
01-05      LOCUS
06-12      spaces
13-21      Locus name
22-22      space
23-29      Length of sequence, right-justified
31-32      bp
34-36      Blank, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
37-42      Blank, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA
43-52      Blank (implies linear) or circular
53-55      The division code (see Section 3.3)
63-73      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  This has led to several problems: a) meaningful names of more than nine
characters cannot be utilized; b) the nine-character limit causes LOCUS
names to be truncated for many segmented sets of more than ten members
(see AF272557, AF272558, etc); c) invalid LOCUS lines result when the
GenBank flatfile format is used to display other types of sequence data.

  For (c), consider human contig Hs22_11677 derived from primary (archival)
sequences in the HTG division of GenBank:

LOCUS       Hs22_1167722998459 bp    DNA            PRI       10-FEB-2001
DEFINITION  Homo sapiens chromosome 22 working draft sequence segment.
ACCESSION   NT_011520

  The LOCUS name ( Hs22_11677 ) collides with the sequence length ( 22998459 )
due to the restrictions of the LOCUS line format.

  To address the LOCUS problems, a new LOCUS line format which allows names
of up to 16 characters, sequences of up to 99,999,999,999 bases, and a uniform
number of data values (eight) will be utilized for all GenBank records starting
with Release 127.0 in December 2001.

  There have been several changes to this new format since it was originally
announced in April 2001. Because a new molecule type of snoRNA was approved at
a recent GenBank/EMBL/DDBJ collaborative meeting, the molecule type has been
increased to 6 characters. An additional space was reserved in case 7 character
molecule types ever appear. This reduced the space available for LOCUS names
from 18 character to 16 characters. Lastly, we realized that the presence of
spaces for linear molecules and 'circular' for circular molecules makes simple
token-based parsing of the LOCUS line a harder task. So 'linear' will be
present in the new LOCUS format.

  The last change is also to encourage software developers to switch to a
token-based LOCUS parsing approach, rather than a column-specific approach.
If this is done, then future changes to the LOCUS line that affect only the
spacing of its data values will not require any modifications to software.

  Because of these changes, we are delaying the introduction of the new format
by two more months (Release 127.0 in December 2001). Here is the revised LOCUS
line format:

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
LOCUS       16Char_LocusName 99999999999 bp ss-snoRNA  circular DIV DD-MMM-YYYY

Positions  Contents
---------  --------
01-05      LOCUS
06-12      spaces
13-28      Locus name
31-31      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Here's how two existing records will appear using this new format:

LOCUS       AB000383                5423 bp    DNA     circular VRL 05-FEB-1999
DEFINITION  Leucania seperata nuclear polyhedrosis virus DNA for p13, xe,
            envelope protein, complete cds.
ACCESSION   AB000383

LOCUS       AF345888                 147 bp ss-RNA     linear   VRL 21-JUN-2001
DEFINITION  Chikungunya virus nonstructural protein 4 gene, partial cds.
ACCESSION   AF345888

  Sample GenBank flatfiles utilizing the new LOCUS line format will be made
available after Releases 125.0 (August) and 126.0 (October), so that developers
can test software that parses GenBank flatfiles. Further announcements about
the LOCUS line change will be made via these release notes and the GenBank
newsgroup (bionet.molbio.genbank).

1.4.2 Selenocysteine representation

  Selenocysteine residues within the protein translations of coding
region features have been represented in GenBank via the letter 'X'
and a /transl_except qualifier. At the May 1999 DDBJ/EMBL/GenBank
collaborative meeting, it was learned that IUPAC plans to adopt the
letter 'U' for selenocysteine.

  DDBJ, EMBL, and GenBank will thus use this new amino acid abbreviation
for its /translation qualifiers. Although a timetable for its appearance
has not been finalized, we are mentioning this now because the introduction
of a new residue abbreviation is a fairly fundamental change.

  Details about the use of 'U' will be made available via these release
notes and the GenBank newsgroup as they become available.

1.4.3 New REFERENCE type for on-line journals

  Agreement was reached at the May 1999 collaborative DDBJ/EMBL/GenBank
meeting that an effort should be made to accomodate references which are
published only on-line. Until specifications for such references are
available from library organizations, GenBank will present them in a manner
like this:

	REFERENCE   1  (bases 1 to 2858)
	  AUTHORS   Smith, J.
	  TITLE     Cloning and expression of a phospholipase gene
	  JOURNAL   Online Publication
	  REMARK    Online-Journal-name; Article Identifier; URL

  This format is still tentative; additional information about this new
reference type will be made available via these release notes.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that the data enter the database as soon
as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

  The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.


2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 243 files. The list
that follows describes each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

1.  gbrel.txt	- Release notes (this document).
2.  gbsdr.txt 	- Short directory of the data bank.
3.  gbacc.idx 	- Index of the entries according to accession number.
4.  gbkey.idx 	- Index of the entries according to keyword phrase.
5.  gbaut1.idx 	- Index of the entries according to author, part 1.
6.  gbaut2.idx 	- Index of the entries according to author, part 2.
7.  gbaut3.idx 	- Index of the entries according to author, part 3.
8.  gbaut4.idx 	- Index of the entries according to author, part 4.
9.  gbaut5.idx 	- Index of the entries according to author, part 5.
10. gbaut6.idx 	- Index of the entries according to author, part 6.
11. gbaut7.idx 	- Index of the entries according to author, part 7.
12. gbaut8.idx 	- Index of the entries according to author, part 8.
13. gbaut9.idx 	- Index of the entries according to author, part 9.
14. gbjou.idx 	- Index of the entries according to journal citation.
15. gbgen.idx 	- Index of the entries according to gene names.
16. gbsec.idx	- Index of the entries according to secondary accession number.
17. gbpri1.seq 	- Primate sequence entries, part 1.
18. gbpri2.seq 	- Primate sequence entries, part 2.
19. gbpri3.seq 	- Primate sequence entries, part 3.
20. gbpri4.seq 	- Primate sequence entries, part 4.
21. gbpri5.seq 	- Primate sequence entries, part 5.
22. gbpri6.seq 	- Primate sequence entries, part 6.
23. gbpri7.seq 	- Primate sequence entries, part 7.
24. gbpri8.seq 	- Primate sequence entries, part 8.
25. gbpri9.seq 	- Primate sequence entries, part 9.
26. gbpri10.seq	- Primate sequence entries, part 10.
27. gbpri11.seq	- Primate sequence entries, part 11.
28. gbpri12.seq	- Primate sequence entries, part 12.
29. gbpri13.seq	- Primate sequence entries, part 13.
30. gbrod1.seq 	- Rodent sequence entries, part 1.
31. gbrod2.seq 	- Rodent sequence entries, part 2.
32. gbmam.seq 	- Other mammalian sequence entries.
33. gbvrt.seq 	- Other vertebrate sequence entries.
34. gbinv1.seq 	- Invertebrate sequence entries, part 1.
35. gbinv2.seq 	- Invertebrate sequence entries, part 2.
36. gbinv3.seq 	- Invertebrate sequence entries, part 3.
37. gbinv4.seq 	- Invertebrate sequence entries, part 4.
38. gbpln1.seq 	- Plant sequence entries (including fungi and algae), part 1.
39. gbpln2.seq 	- Plant sequence entries (including fungi and algae), part 2.
40. gbpln3.seq 	- Plant sequence entries (including fungi and algae), part 3.
41. gbpln4.seq 	- Plant sequence entries (including fungi and algae), part 4.
42. gbbct1.seq 	- Bacterial sequence entries, part 1.
43. gbbct2.seq 	- Bacterial sequence entries, part 2.
44. gbbct3.seq 	- Bacterial sequence entries, part 3.
45. gbbct4.seq 	- Bacterial sequence entries, part 4.
46. gbvrl1.seq 	- Viral sequence entries, part 1.
47. gbvrl2.seq 	- Viral sequence entries, part 2.
48. gbphg.seq 	- Phage sequence entries.
49. gbsyn.seq 	- Synthetic and chimeric sequence entries.
50. gbuna.seq 	- Unannotated sequence entries.
51. gbest1.seq  - EST (expressed sequence tag) sequence entries, part 1.
52. gbest2.seq  - EST (expressed sequence tag) sequence entries, part 2.
53. gbest3.seq  - EST (expressed sequence tag) sequence entries, part 3.
54. gbest4.seq  - EST (expressed sequence tag) sequence entries, part 4.
55. gbest5.seq  - EST (expressed sequence tag) sequence entries, part 5.
56. gbest6.seq  - EST (expressed sequence tag) sequence entries, part 6.
57. gbest7.seq  - EST (expressed sequence tag) sequence entries, part 7.
58. gbest8.seq  - EST (expressed sequence tag) sequence entries, part 8.
59. gbest9.seq  - EST (expressed sequence tag) sequence entries, part 9.
60. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
61. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
62. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
63. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
64. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
65. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
66. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
67. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
68. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
69. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
70. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
71. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
72. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
73. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
74. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
75. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
76. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
77. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
78. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
79. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
80. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
81. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
82. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
83. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
84. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
85. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
86. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
87. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
88. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
89. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
90. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
91. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
92. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
93. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
94. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
95. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
96. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
97. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
98. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
99. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
100. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
101. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
102. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
103. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
104. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
105. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
106. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
107. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
108. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
109. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
110. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
111. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
112. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
113. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
114. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
115. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
116. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
117. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
118. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
119. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
120. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
121. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
122. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
123. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
124. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
125. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
126. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
127. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
128. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
129. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
130. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
131. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
132. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
133. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
134. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
135. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
136. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
137. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
138. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
139. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89
140. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
141. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
142. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
143. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
144. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
145. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
146. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
147. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
148. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
149. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
150. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
151. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
152. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
153. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
154. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
155. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
156. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
157. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
158. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
159. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
160. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
161. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
162. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
163. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
164. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
165. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
166. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
167. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
168. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
169. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
170. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
171. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
172. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
173. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
174. gbpat1.seq  - Patent sequence entries, part 1.
175. gbpat2.seq  - Patent sequence entries, part 2.
176. gbpat3.seq  - Patent sequence entries, part 3.
177. gbsts1.seq  - STS (sequence tagged site) sequence entries, part 1.
178. gbsts2.seq  - STS (sequence tagged site) sequence entries, part 2.
179. gbgss1.seq  - GSS (genome survey sequence) sequence entries, part 1.
180. gbgss2.seq  - GSS (genome survey sequence) sequence entries, part 2.
181. gbgss3.seq  - GSS (genome survey sequence) sequence entries, part 3.
182. gbgss4.seq  - GSS (genome survey sequence) sequence entries, part 4.
183. gbgss5.seq  - GSS (genome survey sequence) sequence entries, part 5.
184. gbgss6.seq  - GSS (genome survey sequence) sequence entries, part 6.
185. gbgss7.seq  - GSS (genome survey sequence) sequence entries, part 7.
186. gbgss8.seq  - GSS (genome survey sequence) sequence entries, part 8.
187. gbgss9.seq  - GSS (genome survey sequence) sequence entries, part 9.
188. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
189. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
190. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
191. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
192. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
193. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
194. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
195. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
196. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
197. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
198. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
199. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
200. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
201. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
202. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
203. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
204. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
205. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
206. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
207. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
208. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
209. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
210. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
211. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
212. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
213. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
214. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
215. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
216. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
217. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
218. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
219. gbhtg1.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 1.
220. gbhtg2.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 2.
221. gbhtg3.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 3.
222. gbhtg4.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 4.
223. gbhtg5.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 5.
224. gbhtg6.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 6.
225. gbhtg7.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 7.
226. gbhtg8.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 8.
227. gbhtg9.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 9.
228. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
229. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
230. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
231. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
232. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
233. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
234. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
235. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
236. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
237. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
238. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
239. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
240. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
241. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
242. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
243. gbhtc.seq	 - HTC (high throughput cDNA sequencing) entries.

  Three supplemental files provide the accession numbers of GenBank entries
that are new, updated, or deleted since the previous release:

a.  gbchg.txt	- Entries updated since the previous release.
b.  gbdel.txt	- Entries deleted since the previous release.
c.  gbnew.txt	- Entries new since the previous release.

  An experimental file called gbcon.seq provides an alternative representation
for complex sequences, such as "segmented sets" and complete-genomes that have
been split into pieces. The GenBank README describes the experimental CON
division of GenBank in more detail:

	ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 125.0 flatfiles require roughly 49.72 GB
(sequence files only) or 55.23 GB (including the 'index' files).  The
following table contains the approximate sizes of the individual files
in this release.  Since minor changes to some of the files may occur
after these release notes have been written, these sizes should not be
used to determine file integrity; they are provided as an aid to planning
only.

File Size      File Name

415551377      gbacc.idx
509545709      gbaut1.idx
500320717      gbaut2.idx
520850350      gbaut3.idx
513997873      gbaut4.idx
503919929      gbaut5.idx
512977568      gbaut6.idx
502635939      gbaut7.idx
526484260      gbaut8.idx
315809592      gbaut9.idx
250001505      gbbct1.seq
250000763      gbbct2.seq
250002031      gbbct3.seq
 77453268      gbbct4.seq
  2128975      gbchg.txt
 12121082      gbcon.seq
   206432      gbdel.txt
229699405      gbest1.seq
230689260      gbest10.seq
230690081      gbest100.seq
230689240      gbest101.seq
230689373      gbest102.seq
230691153      gbest103.seq
230688904      gbest104.seq
230688064      gbest105.seq
230690226      gbest106.seq
230690040      gbest107.seq
230689643      gbest108.seq
222953837      gbest109.seq
230688539      gbest11.seq
230688841      gbest110.seq
230689984      gbest111.seq
230688011      gbest112.seq
230690074      gbest113.seq
230687514      gbest114.seq
230690318      gbest115.seq
230687920      gbest116.seq
230688139      gbest117.seq
230689526      gbest118.seq
230688975      gbest119.seq
230689321      gbest12.seq
218805282      gbest120.seq
230688185      gbest121.seq
230689599      gbest122.seq
  4787390      gbest123.seq
230688004      gbest13.seq
230690066      gbest14.seq
230689661      gbest15.seq
230688121      gbest16.seq
230687555      gbest17.seq
230689614      gbest18.seq
230688150      gbest19.seq
226815975      gbest2.seq
230688954      gbest20.seq
230690408      gbest21.seq
230690098      gbest22.seq
230689863      gbest23.seq
230690679      gbest24.seq
230689981      gbest25.seq
230689369      gbest26.seq
230689476      gbest27.seq
230688299      gbest28.seq
230689051      gbest29.seq
227288259      gbest3.seq
230689870      gbest30.seq
230688967      gbest31.seq
187441250      gbest32.seq
186727779      gbest33.seq
201427324      gbest34.seq
211758944      gbest35.seq
212040316      gbest36.seq
212804146      gbest37.seq
217188648      gbest38.seq
230689235      gbest39.seq
230687771      gbest4.seq
230688175      gbest40.seq
220238207      gbest41.seq
230689373      gbest42.seq
230688753      gbest43.seq
230689321      gbest44.seq
230688927      gbest45.seq
230688589      gbest46.seq
230688258      gbest47.seq
230689485      gbest48.seq
230688985      gbest49.seq
162059463      gbest5.seq
230689454      gbest50.seq
230692093      gbest51.seq
230687890      gbest52.seq
228669958      gbest53.seq
230691735      gbest54.seq
205114707      gbest55.seq
205336073      gbest56.seq
204648444      gbest57.seq
204163750      gbest58.seq
204285397      gbest59.seq
174881145      gbest6.seq
204364685      gbest60.seq
204730185      gbest61.seq
203955866      gbest62.seq
205497050      gbest63.seq
203205954      gbest64.seq
200984738      gbest65.seq
201847146      gbest66.seq
202735105      gbest67.seq
205230263      gbest68.seq
219139203      gbest69.seq
230690272      gbest7.seq
230688548      gbest70.seq
230688872      gbest71.seq
230687687      gbest72.seq
230689609      gbest73.seq
230690304      gbest74.seq
230688760      gbest75.seq
230688670      gbest76.seq
230687602      gbest77.seq
230689259      gbest78.seq
230688863      gbest79.seq
230687659      gbest8.seq
230688117      gbest80.seq
230687511      gbest81.seq
230688775      gbest82.seq
230689254      gbest83.seq
230690340      gbest84.seq
230689889      gbest85.seq
230688589      gbest86.seq
230687483      gbest87.seq
230690592      gbest88.seq
230687714      gbest89.seq
230687727      gbest9.seq
230688136      gbest90.seq
230689054      gbest91.seq
230688584      gbest92.seq
230687924      gbest93.seq
229002803      gbest94.seq
230687721      gbest95.seq
230688357      gbest96.seq
230690364      gbest97.seq
230688176      gbest98.seq
230688161      gbest99.seq
 16868256      gbgen.idx
209715976      gbgss1.seq
209716412      gbgss10.seq
209716824      gbgss11.seq
209717098      gbgss12.seq
209716037      gbgss13.seq
209716713      gbgss14.seq
209718789      gbgss15.seq
209717892      gbgss16.seq
209717494      gbgss17.seq
209718941      gbgss18.seq
209718041      gbgss19.seq
209717880      gbgss2.seq
209717068      gbgss20.seq
209716564      gbgss21.seq
209717785      gbgss22.seq
209717730      gbgss23.seq
209716099      gbgss24.seq
209718580      gbgss25.seq
209716172      gbgss26.seq
209717262      gbgss27.seq
209719272      gbgss28.seq
209717109      gbgss29.seq
209718557      gbgss3.seq
209717812      gbgss30.seq
209718309      gbgss31.seq
209717405      gbgss32.seq
209718384      gbgss33.seq
173086900      gbgss34.seq
250002178      gbgss35.seq
250001794      gbgss36.seq
250000536      gbgss37.seq
250000545      gbgss38.seq
250001229      gbgss39.seq
209716942      gbgss4.seq
 93868826      gbgss40.seq
209716175      gbgss5.seq
209716154      gbgss6.seq
209718276      gbgss7.seq
209717190      gbgss8.seq
209718650      gbgss9.seq
148125207      gbhtc.seq
250092614      gbhtg1.seq
250000628      gbhtg10.seq
250001339      gbhtg11.seq
250122547      gbhtg12.seq
250001391      gbhtg13.seq
250224113      gbhtg14.seq
250160904      gbhtg15.seq
250198348      gbhtg16.seq
250031101      gbhtg17.seq
250178937      gbhtg18.seq
250074766      gbhtg19.seq
250021523      gbhtg2.seq
250104597      gbhtg20.seq
250060458      gbhtg21.seq
250203652      gbhtg22.seq
250161725      gbhtg23.seq
185232989      gbhtg24.seq
250118796      gbhtg3.seq
250096257      gbhtg4.seq
250063803      gbhtg5.seq
250118928      gbhtg6.seq
250035262      gbhtg7.seq
250108393      gbhtg8.seq
250164070      gbhtg9.seq
250108512      gbinv1.seq
250001150      gbinv2.seq
250004671      gbinv3.seq
111635608      gbinv4.seq
372543608      gbjou.idx
291582329      gbkey.idx
103956607      gbmam.seq
  8981568      gbnew.txt
250001699      gbpat1.seq
250001726      gbpat2.seq
 60277116      gbpat3.seq
 14113749      gbphg.seq
250001074      gbpln1.seq
250360688      gbpln2.seq
250006202      gbpln3.seq
190077636      gbpln4.seq
250044615      gbpri1.seq
250116044      gbpri10.seq
250001055      gbpri11.seq
250006270      gbpri12.seq
 66181839      gbpri13.seq
250210576      gbpri2.seq
250013896      gbpri3.seq
250024978      gbpri4.seq
250180097      gbpri5.seq
250021281      gbpri6.seq
250078796      gbpri7.seq
250022067      gbpri8.seq
250002589      gbpri9.seq
   113495      gbrel.txt
250004494      gbrod1.seq
 90906020      gbrod2.seq
102509618      gbsdr.txt
  1165029      gbsec.idx
250001994      gbsts1.seq
 56921895      gbsts2.seq
 28435096      gbsyn.seq
  1391274      gbuna.seq
250000122      gbvrl1.seq
184926469      gbvrl2.seq
187332886      gbvrt.seq

2.2.6 Per-Division Statistics 

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each sequence
data file:

Division     Entries    Bases

BCT1         19084      103402613
BCT2         46428      96634046
BCT3         34546      95018383
BCT4         13977      28539861
EST1         68601      26480147
EST10        77314      30162416
EST100       72644      49663300
EST101       72643      44949919
EST102       75140      50580099
EST103       70271      43029223
EST104       75492      42721611
EST105       76581      47573824
EST106       72799      49183624
EST107       71281      48736620
EST108       77351      39743488
EST109       74197      23950669
EST11        76220      29024712
EST110       78299      50756878
EST111       75678      43319244
EST112       65142      35843746
EST113       73497      38374870
EST114       92384      39696569
EST115       111792     39557699
EST116       75117      26219203
EST117       73181      27084486
EST118       74323      26389350
EST119       73327      26648854
EST12        77935      31056598
EST120       77433      26006556
EST121       72993      29081124
EST122       74159      28313545
EST123       2327       863592
EST13        77636      29430950
EST14        80183      32515967
EST15        73289      31017599
EST16        75855      33374193
EST17        84204      34433625
EST18        80666      32614014
EST19        81169      33688146
EST2         74406      28543891
EST20        72831      29155088
EST21        73273      34190627
EST22        77049      30667698
EST23        77333      32139125
EST24        76027      34464654
EST25        73060      31070634
EST26        76364      31396227
EST27        79152      35116199
EST28        77288      40563508
EST29        79510      59623884
EST3         73415      29792834
EST30        107057     45631654
EST31        96315      55149718
EST32        68802      18448401
EST33        69106      17828840
EST34        74377      21475476
EST35        43539      10996201
EST36        43436      10748475
EST37        43030      10976748
EST38        49633      14735039
EST39        101800     44495682
EST4         74838      28475760
EST40        100672     47934901
EST41        88596      46751361
EST42        76458      33441010
EST43        67014      28917506
EST44        73574      32590002
EST45        71302      30270370
EST46        80841      32842100
EST47        76190      29968616
EST48        71391      28807906
EST49        65460      30896068
EST5         48080      15263775
EST50        75181      33673572
EST51        78466      34960942
EST52        73800      29251182
EST53        76950      26619789
EST54        86494      40916131
EST55        40132      10323069
EST56        40060      10044980
EST57        40050      11637369
EST58        40434      11298743
EST59        40480      10797722
EST6         54658      17345037
EST60        40393      11450277
EST61        40156      11694868
EST62        40422      11100711
EST63        40039      10833348
EST64        40765      11485363
EST65        41310      10813750
EST66        41089      11332815
EST67        40867      11556579
EST68        42130      11671242
EST69        51241      13444624
EST7         75059      29565091
EST70        75829      32436733
EST71        74466      29496128
EST72        77948      34071177
EST73        78810      47514376
EST74        77420      41406286
EST75        79545      40187023
EST76        76930      41360600
EST77        73771      40316326
EST78        73974      31741118
EST79        76006      45132308
EST8         76556      30831484
EST80        70967      31898439
EST81        78421      49829967
EST82        66368      36086142
EST83        73646      37620331
EST84        74709      44499892
EST85        73770      43856173
EST86        74595      51433285
EST87        75221      33951997
EST88        71409      30042462
EST89        65349      33034155
EST9         78355      30191952
EST90        68705      40348462
EST91        75760      44139043
EST92        72445      38462258
EST93        76371      34881067
EST94        73817      30246185
EST95        75154      32829047
EST96        74169      37602436
EST97        69420      40496674
EST98        82021      45625509
EST99        79185      44569464
GSS1         84108      36038446
GSS10        66894      36373232
GSS11        70903      39399306
GSS12        62187      32625618
GSS13        68186      35442150
GSS14        68549      34738922
GSS15        66213      29689089
GSS16        64699      32292270
GSS17        72372      43421087
GSS18        65956      30796959
GSS19        57437      26674057
GSS2         83815      36323911
GSS20        52429      27261400
GSS21        53109      25493918
GSS22        54121      22888244
GSS23        60164      38321156
GSS24        56845      26441769
GSS25        53719      26798024
GSS26        65296      40575310
GSS27        60121      24015105
GSS28        53815      23644453
GSS29        61250      29894188
GSS3         83429      38869620
GSS30        61050      29883992
GSS31        67369      36388214
GSS32        80849      36398499
GSS33        69230      37691436
GSS34        56268      33362298
GSS35        86832      65988199
GSS36        77030      64071489
GSS37        74768      63073581
GSS38        66851      64900501
GSS39        87626      53362910
GSS4         75144      38619433
GSS40        36045      16006473
GSS5         72547      38766800
GSS6         70298      35169120
GSS7         72658      36481103
GSS8         71925      36839920
GSS9         69070      34194607
HTC          21326      26832389
HTG1         1301       191870779
HTG10        2620       186773132
HTG11        23669      153321633
HTG12        14914      167782336
HTG13        4120       184180004
HTG14        4804       185594091
HTG15        5740       183106469
HTG16        3519       184626679
HTG17        3494       184733991
HTG18        1285       192217025
HTG19        1276       192170944
HTG2         1272       190033768
HTG20        1146       192908581
HTG21        1115       193366494
HTG22        1150       193251264
HTG23        1157       190244371
HTG24        949        139195790
HTG3         1708       189524909
HTG4         2675       187639380
HTG5         2167       190654971
HTG6         2176       190226351
HTG7         1237       189561591
HTG8         1305       188477230
HTG9         1195       189645538
INV1         7602       174550629
INV2         32473      129764813
INV3         32965      122089523
INV4         22513      44736371
MAM          33540      32180633
PAT1         216211     70993297
PAT2         137763     82884727
PAT3         62264      15180153
PHG          1776       5380969
PLN1         31535      127895410
PLN2         52131      106963988
PLN3         50994      97905650
PLN4         33902      78234090
PRI1         9591       162395996
PRI10        16462      159129095
PRI11        24413      140779637
PRI12        43737      117400697
PRI13        19340      21894837
PRI2         1386       174161098
PRI3         1333       184578343
PRI4         1210       181395288
PRI5         1344       181364507
PRI6         41010      119224862
PRI7         1534       173660056
PRI8         1752       175118031
PRI9         10666      165764929
ROD1         43231      116894027
ROD2         26164      30243427
STS1         86733      35135462
STS2         24902      8869605
SYN          6439       11640904
UNA          669        335453
VRL1         75248      62842553
VRL2         54835      51758296
VRT          59686      55853377

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 125.0 (chloroplast and mitochon-
drial sequences not included):

Entries      Bases   Species

4907241 7766719367   Homo sapiens
3081562 1792036375   Mus musculus
233922   559041023   Drosophila melanogaster
187202   253425735   Arabidopsis thaliana
183760   242010436   Oryza sativa
140659   187096259   Caenorhabditis elegans
189002   165543637   Tetraodon nigroviridis
273142   147435333   Rattus norvegicus
176453    83954580   Bos taurus
188253    83026773   Glycine max
140785    72291932   Medicago truncatula
139933    70696366   Lycopersicon esculentum
107914    62970446   Danio rerio
119488    55785927   Zea mays
86955     54523426   Strongylocentrotus purpuratus
59478     53179588   Entamoeba histolytica
106462    52904860   Xenopus laevis
91404     52585768   Trypanosoma brucei
83934     51765718   Chlamydomonas reinhardtii
70385     49952840   Hordeum vulgare

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, each of the 243 files of a
GenBank release begins with the same header, except for the first line,
which contains the file name, and the sixth line, which contains the
title of the file. The first line of the file contains the file name
in character positions 1 to 9 and the full database name (Genetic Sequence
Data Bank) starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 August 2001

                NCBI-GenBank Flat File Release 125.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Beneath each index key, the identifiers of the
sequence entries containing that index key are listed (LOCUS name,
division abbreviation, and primary accession number). The following
codes are used to designate the data file divisions:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
term is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the term:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index terms can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed term (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes four subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Mandatory
subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The pieces of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always ten characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 29.
The letters `bp' are in positions 31 to 32. Positions 34 to 36 give
the number of strands of the sequence. Positions 37 to 40 give the
topology of molecule sequenced. If the sequence is of a special type,
a notation (such as `circular') is included in positions 43 to 52.

  GenBank sequence entries are divided among sixteen different
divisions. Each entry's division is specified by a three-letter code
in positions 53 to 55. See Section 3.3 for an explanation of division
codes.

  Positions 63 to 73 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS record is as follows:

Positions   	Contents

1-12	LOCUS
13-22	Locus name
23-29	Length of sequence, right-justified
31-32	bp
34-36	Blank, ss- (single-stranded), ds- (double-stranded), or
	 ms- (mixed-stranded)
37-41	Blank, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
	mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA, or scRNA
43-52	Blank (implies linear) or circular
53-55	The division code (see Section 3.3)
63-73	Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail to info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 125.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Tanya Barrett, Maureen Beanan, Lori Black, Larissa Brown, Tatiana
	Cassol, Larry Chlumsky, Karen Clark, Kathy Dixon, Irene Fang, Michael
	Fetchko, Jeff Gilmour, Anjanette Johnston, Irene Kim, Pierre Ledoux,
	Richard McVeigh, Leonie Misquitta, Ilene Mizrachi, Michael Murphy, Quy
	Phung, Leigh Riley, Paola Roncagli, Gert Roosen, Susan Schafer, Suh-suh
	Wang, Jane Weisemann, Steven Wilhite, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Anton Butanaev, Mark Cavanaugh,
	Hsiu-Chuan Chen, Jonathan Kans, Michael Kimelman, Jim Ostell,
	Joel Plotkin, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Tatiana Tatusov, Carolyn Tolstoshev, Jane Weisemann, Eugene Yaschenko

Database Administration
	Helen Epting, Slava Khotomliansky, Tony Stearman

Production and User Support
        Dennis Benson, Peter Cooper, Jim Fleshman, Renata McCarthy,
	Scott McGinnis, Monica Romiti, Barbara Rapp, Steven Rosenthal,
	Rose Marie Woodsmall, David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

Contractor support for GenBank production and distribution 
has been provided by Management Systems Designers, Inc., 
ComputerCraft Corporation, and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center