Release Notes For GenBank Release 129

GBREL.TXT          Genetic Sequence Data Bank
                         April 15 2002

               NCBI-GenBank Flat File Release 129.0

                    Distribution Release Notes

 16769983 loci, 19072679701 bases, from 16769983 reported sequences

  This document describes the format and content of the flat files that
comprise releases of the GenBank database. If you have any questions or
comments about GenBank or this document, please contact NCBI via email
at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 129.0
1.2 Cutoff Date
1.3 Important Changes in Release 129.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 129.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 129.0 is a release of sequence data by NCBI in the GenBank
flat file format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Sequence data is also incorporated from the Genome Sequence Data Base
(GSDB), Santa Fe, NM.  Patent sequences are incorporated through arrangements
with the U.S. Patent and Trademark Office, and via the collaborating
international databases from other international patent offices.  The database
is converted to various output formats, including the Flat File and Abstract
Syntax Notation 1 (ASN.1) versions.  The ASN.1 and Flat File forms of the data
are available at NCBI's anonymous FTP server: ftp.ncbi.nih.gov .

1.2 Cutoff Date

  This full release, 129.0, incorporates data available to the collaborating
databases as of April 22, 2002.  For more recent data, users are advised to:

  o Download the GenBank Update files by anonymous FTP to 'ftp.ncbi.nih.gov':

	ftp://ftp.ncbi.nih.gov/ncbi-asn1 (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank   (flatfile format)

    Mirrors of the GenBank FTP site at the NCBI are available from the San Diego
    Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

    Some users who experience slow FTP transfers of large files (entire releases,
    the GenBank Cumulative Update, etc) might realize an improvement in transfer
    rates from these alternate sites when traffic at the NCBI is high.

  o Use the Network-Entrez or Web-Entrez applications to query interactively
    the Entrez: Nucleotides database (see Section 6.4 of this document).

  o Use the NCBI 'query' email server to search the GenBank Updates. Instructions
    regarding the use of the e-mail server can be obtained by sending an email
    message with the word 'help' in it to:  query@ncbi.nlm.nih.gov

1.3 Important Changes in Release 129.0

1.3.1 Organizational changes

  Due to database growth, the EST division is now being split into 161 pieces.

  Due to database growth, the GSS division is now being split into 51 pieces.

  Due to database growth, the HTG division is now being split into 33 pieces.

  Due to database growth, the PRI division is now being split into 19 pieces.

  Due to database growth, the ROD division is now being split into 3 pieces.

  Due to database growth, the VRL division is now being split into 3 pieces.

1.3.2 New REFERENCE type for on-line journals

  Agreement was reached at the May 1999 collaborative DDBJ/EMBL/GenBank
meeting that an effort should be made to accomodate references which are
published only on-line. Until specifications for such references are
available from library organizations, GenBank will begin to present them in
the following manner, as of this April 2002 GenBank Release :

	REFERENCE   1  (bases 1 to 2858)
	  AUTHORS   Smith, J.
	  TITLE     Cloning and expression of a phospholipase gene
	  JOURNAL   Online Publication
	  REMARK    Online-Journal-name; Article Identifier; URL

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in one of two different systems,
depending on their origin. One recent change to release processing involves
the parallelization of the dumps from those systems. Because the second dump
(for example) has no prior knowledge of exactly how many GSS files will be
dumped from the first, it doesn't know how to number it's own output files.
There is thus a discrepancy between the filenames and file headers of eight
GSS flatfiles in Release 129.0. Consider the gbgss44.seq file:

GBGSS1.SEQ           Genetic Sequence Data Bank
                           April 15 2002

                 NCBI-GenBank Flat File Release 129

                           GSS Sequences (Part 1)

  Here, the filename and part number in the header is "1", though the file
has been renamed as "44" based on the files dumped from the other system.
We will work to resolve this discrepancy in future releases, but the priority
is admittedly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New CONSRTM linetype for references.

  In order to capture the names of consortia and other groups that are involved
in large-scale sequencing projects, a new linetype called CONSRTM will become
legal in the REFERENCE block of the GenBank flatfile format as of June, 2002 .

  Consider, for example, the literature citation associated with PubMed
identifier 11237011 :

  Nature 2001 Feb 15;409(6822):860-921
  Initial sequencing and analysis of the human genome.

In addition to the very long list of author names, a consortium is associated
with this publication:

  International Human Genome Sequencing Consortium

  With the addition of a CONSRTM linetype, collective names like this will
have a dedicated location in the flatfile format. Records which currently
attempt to force consortium names into the last entry of the AUTHORS line
will be updated to utilize the new linetype.

  Note that multiple consortia for a REFERENCE may exist, in which case
they will be separated by a semi-colon. It is also possible that references
with a CONSRTM linetype will not have any individual AUTHORS at all.

1.4.2 Selenocysteine representation

  Selenocysteine residues within the protein translations of coding
region features have been represented in GenBank via the letter 'X'
and a /transl_except qualifier. At the May 1999 DDBJ/EMBL/GenBank
collaborative meeting, it was learned that IUPAC plans to adopt the
letter 'U' for selenocysteine.

  DDBJ, EMBL, and GenBank will thus use this new amino acid abbreviation
for its /translation qualifiers. Although a timetable for its appearance
has not been finalized, we are mentioning this now because the introduction
of a new residue abbreviation is a fairly fundamental change.

  Details about the use of 'U' will be made available via these release
notes and the GenBank newsgroup as they become available.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

  The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 296 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

1.  gbrel.txt	- Release notes (this document).
2.  gbsdr.txt 	- Short directory of the data bank.
3.  gbacc.idx 	- Index of the entries according to accession number.
4.  gbkey.idx 	- Index of the entries according to keyword phrase.
5.  gbaut1.idx 	- Index of the entries according to author, part 1.
6.  gbaut2.idx 	- Index of the entries according to author, part 2.
7.  gbaut3.idx 	- Index of the entries according to author, part 3.
8.  gbaut4.idx 	- Index of the entries according to author, part 4.
9.  gbaut5.idx 	- Index of the entries according to author, part 5.
10. gbaut6.idx 	- Index of the entries according to author, part 6.
11. gbaut7.idx 	- Index of the entries according to author, part 7.
12. gbaut8.idx 	- Index of the entries according to author, part 8.
13. gbaut9.idx 	- Index of the entries according to author, part 9.
14. gbaut10.idx - Index of the entries according to author, part 10.
15. gbaut11.idx - Index of the entries according to author, part 11.
16. gbjou.idx 	- Index of the entries according to journal citation.
17. gbgen.idx 	- Index of the entries according to gene names.
18. gbsec.idx	- Index of the entries according to secondary accession number.
19. gbpri1.seq 	- Primate sequence entries, part 1.
20. gbpri2.seq 	- Primate sequence entries, part 2.
21. gbpri3.seq 	- Primate sequence entries, part 3.
22. gbpri4.seq 	- Primate sequence entries, part 4.
23. gbpri5.seq 	- Primate sequence entries, part 5.
24. gbpri6.seq 	- Primate sequence entries, part 6.
25. gbpri7.seq 	- Primate sequence entries, part 7.
26. gbpri8.seq 	- Primate sequence entries, part 8.
27. gbpri9.seq 	- Primate sequence entries, part 9.
28. gbpri10.seq	- Primate sequence entries, part 10.
29. gbpri11.seq	- Primate sequence entries, part 11.
30. gbpri12.seq	- Primate sequence entries, part 12.
31. gbpri13.seq	- Primate sequence entries, part 13.
32. gbpri14.seq	- Primate sequence entries, part 14.
33. gbpri15.seq	- Primate sequence entries, part 15.
34. gbpri16.seq	- Primate sequence entries, part 16.
35. gbpri17.seq	- Primate sequence entries, part 17.
36. gbpri18.seq	- Primate sequence entries, part 18.
37. gbpri19.seq	- Primate sequence entries, part 19.
38. gbrod1.seq 	- Rodent sequence entries, part 1.
39. gbrod2.seq 	- Rodent sequence entries, part 2.
40. gbrod3.seq 	- Rodent sequence entries, part 3.
41. gbmam.seq 	- Other mammalian sequence entries.
42. gbvrt.seq 	- Other vertebrate sequence entries.
43. gbinv1.seq 	- Invertebrate sequence entries, part 1.
44. gbinv2.seq 	- Invertebrate sequence entries, part 2.
45. gbinv3.seq 	- Invertebrate sequence entries, part 3.
46. gbinv4.seq 	- Invertebrate sequence entries, part 4.
47. gbinv5.seq 	- Invertebrate sequence entries, part 5.
48. gbpln1.seq 	- Plant sequence entries (including fungi and algae), part 1.
49. gbpln2.seq 	- Plant sequence entries (including fungi and algae), part 2.
50. gbpln3.seq 	- Plant sequence entries (including fungi and algae), part 3.
51. gbpln4.seq 	- Plant sequence entries (including fungi and algae), part 4.
52. gbpln5.seq 	- Plant sequence entries (including fungi and algae), part 5.
53. gbbct1.seq 	- Bacterial sequence entries, part 1.
54. gbbct2.seq 	- Bacterial sequence entries, part 2.
55. gbbct3.seq 	- Bacterial sequence entries, part 3.
56. gbbct4.seq 	- Bacterial sequence entries, part 4.
57. gbbct5.seq 	- Bacterial sequence entries, part 5.
58. gbvrl1.seq 	- Viral sequence entries, part 1.
59. gbvrl2.seq 	- Viral sequence entries, part 2.
60. gbvrl3.seq 	- Viral sequence entries, part 3.
61. gbphg.seq 	- Phage sequence entries.
62. gbsyn.seq 	- Synthetic and chimeric sequence entries.
63. gbuna.seq 	- Unannotated sequence entries.
64. gbest1.seq  - EST (expressed sequence tag) sequence entries, part 1.
65. gbest2.seq  - EST (expressed sequence tag) sequence entries, part 2.
66. gbest3.seq  - EST (expressed sequence tag) sequence entries, part 3.
67. gbest4.seq  - EST (expressed sequence tag) sequence entries, part 4.
68. gbest5.seq  - EST (expressed sequence tag) sequence entries, part 5.
69. gbest6.seq  - EST (expressed sequence tag) sequence entries, part 6.
70. gbest7.seq  - EST (expressed sequence tag) sequence entries, part 7.
71. gbest8.seq  - EST (expressed sequence tag) sequence entries, part 8.
72. gbest9.seq  - EST (expressed sequence tag) sequence entries, part 9.
73. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
74. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
75. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
76. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
77. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
78. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
79. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
80. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
81. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
82. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
83. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
84. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
85. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
86. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
87. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
88. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
89. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
90. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
91. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
92. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
93. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
94. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
95. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
96. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
97. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
98. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
99. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
100. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
101. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
102. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
103. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
104. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
105. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
106. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
107. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
108. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
109. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
110. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
111. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
112. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
113. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
114. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
115. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
116. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
117. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
118. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
119. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
120. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
121. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
122. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
123. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
124. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
125. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
126. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
127. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
128. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
129. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
130. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
131. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
132. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
133. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
134. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
135. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
136. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
137. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
138. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
139. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
140. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
141. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
142. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
143. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
144. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
145. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
146. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
147. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
148. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
149. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
150. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
151. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
152. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89
153. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
154. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
155. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
156. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
157. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
158. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
159. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
160. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
161. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
162. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
163. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
164. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
165. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
166. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
167. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
168. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
169. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
170. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
171. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
172. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
173. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
174. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
175. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
176. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
177. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
178. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
179. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
180. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
181. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
182. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
183. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
184. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
185. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
186. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
187. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
188. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
189. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
190. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
191. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
192. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
193. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
194. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
195. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
196. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
197. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
198. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
199. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
200. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
201. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
202. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
203. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
204. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
205. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
206. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
207. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
208. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
209. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
210. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
211. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
212. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
213. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
214. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
215. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
216. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
217. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
218. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
219. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
220. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
221. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
222. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
223. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
224. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
225. gbpat1.seq  - Patent sequence entries, part 1.
226. gbpat2.seq  - Patent sequence entries, part 2.
227. gbpat3.seq  - Patent sequence entries, part 3.
228. gbpat4.seq  - Patent sequence entries, part 4.
229. gbsts1.seq  - STS (sequence tagged site) sequence entries, part 1.
230. gbsts2.seq  - STS (sequence tagged site) sequence entries, part 2.
231. gbgss1.seq  - GSS (genome survey sequence) sequence entries, part 1.
232. gbgss2.seq  - GSS (genome survey sequence) sequence entries, part 2.
233. gbgss3.seq  - GSS (genome survey sequence) sequence entries, part 3.
234. gbgss4.seq  - GSS (genome survey sequence) sequence entries, part 4.
235. gbgss5.seq  - GSS (genome survey sequence) sequence entries, part 5.
236. gbgss6.seq  - GSS (genome survey sequence) sequence entries, part 6.
237. gbgss7.seq  - GSS (genome survey sequence) sequence entries, part 7.
238. gbgss8.seq  - GSS (genome survey sequence) sequence entries, part 8.
239. gbgss9.seq  - GSS (genome survey sequence) sequence entries, part 9.
240. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
241. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
242. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
243. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
244. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
245. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
246. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
247. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
248. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
249. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
250. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
251. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
252. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
253. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
254. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
255. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
256. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
257. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
258. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
259. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
260. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
261. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
262. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
263. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
264. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
265. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
266. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
267. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
268. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
269. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
270. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
271. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
272. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
273. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
274. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
275. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
276. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
277. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
278. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
279. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
280. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
281. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
282. gbhtg1.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 1.
283. gbhtg2.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 2.
284. gbhtg3.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 3.
285. gbhtg4.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 4.
286. gbhtg5.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 5.
287. gbhtg6.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 6.
288. gbhtg7.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 7.
289. gbhtg8.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 8.
290. gbhtg9.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 9.
291. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
292. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
293. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
294. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
295. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
296. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
297. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
298. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
299. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
300. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
301. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
302. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
303. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
304. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
305. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
306. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
307. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
308. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
309. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
310. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
311. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
312. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
313. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
314. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
315. gbhtc.seq	 - HTC (high throughput cDNA sequencing) entries.

  Three supplemental files provide the accession numbers of GenBank entries
that are new, updated, or deleted since the previous release:

a.  gbchg.txt	- Entries updated since the previous release.
b.  gbdel.txt	- Entries deleted since the previous release.
c.  gbnew.txt	- Entries new since the previous release.

  An experimental file called gbcon.seq provides an alternative representation
for complex sequences, such as "segmented sets" and complete-genomes that have
been split into pieces. The GenBank README describes the experimental CON
division of GenBank in more detail:

	ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 129.0 flatfiles require roughly 66.43 GB (sequence
files only) or 74.72 GB (including the 'short directory' and 'index' files).
The following table contains the approximate sizes of the individual files in
this release.  Since minor changes to some of the files might have occurred
after these release notes were written, these sizes should not be used to
determine file integrity; they are provided as an aid to planning only.

File Size      File Name

546075172      gbacc.idx
505202340      gbaut1.idx
517749450      gbaut10.idx
441655380      gbaut11.idx
509825238      gbaut2.idx
501262350      gbaut3.idx
500000795      gbaut4.idx
504806540      gbaut5.idx
512648554      gbaut6.idx
500049572      gbaut7.idx
511433848      gbaut8.idx
502456074      gbaut9.idx
250020730      gbbct1.seq
250001857      gbbct2.seq
250000149      gbbct3.seq
250003263      gbbct4.seq
 65651295      gbbct5.seq
  2755180      gbchg.txt
    27847      gbdel.txt
230690037      gbest1.seq
230690177      gbest10.seq
230689375      gbest100.seq
230689844      gbest101.seq
230688702      gbest102.seq
230298195      gbest103.seq
229425956      gbest104.seq
230687904      gbest105.seq
230687579      gbest106.seq
230688010      gbest107.seq
230687600      gbest108.seq
230688907      gbest109.seq
230689299      gbest11.seq
230689839      gbest110.seq
230689449      gbest111.seq
230687539      gbest112.seq
230689781      gbest113.seq
230687906      gbest114.seq
230689164      gbest115.seq
230688706      gbest116.seq
230688594      gbest117.seq
230687788      gbest118.seq
230688652      gbest119.seq
230687593      gbest12.seq
230690186      gbest120.seq
230689962      gbest121.seq
230688026      gbest122.seq
230689603      gbest123.seq
230689661      gbest124.seq
230689199      gbest125.seq
230687813      gbest126.seq
230688986      gbest127.seq
230689432      gbest128.seq
230688615      gbest129.seq
230688012      gbest13.seq
230687633      gbest130.seq
230690399      gbest131.seq
230688522      gbest132.seq
230687945      gbest133.seq
230689392      gbest134.seq
230689082      gbest135.seq
230688023      gbest136.seq
230688311      gbest137.seq
230689625      gbest138.seq
230691269      gbest139.seq
230688159      gbest14.seq
230691275      gbest140.seq
230687946      gbest141.seq
230689452      gbest142.seq
230689108      gbest143.seq
230689199      gbest144.seq
230690108      gbest145.seq
230690284      gbest146.seq
230689677      gbest147.seq
230688186      gbest148.seq
230691120      gbest149.seq
230689291      gbest15.seq
230690055      gbest150.seq
230689193      gbest151.seq
230689246      gbest152.seq
230687765      gbest153.seq
230689121      gbest154.seq
230688743      gbest155.seq
230690034      gbest156.seq
230690303      gbest157.seq
230689604      gbest158.seq
222068412      gbest159.seq
230690648      gbest16.seq
230689952      gbest160.seq
228754063      gbest161.seq
230689381      gbest17.seq
230689433      gbest18.seq
230687542      gbest19.seq
230408502      gbest2.seq
230688299      gbest20.seq
230689113      gbest21.seq
230690388      gbest22.seq
230690697      gbest23.seq
230689983      gbest24.seq
230690350      gbest25.seq
230689043      gbest26.seq
230687630      gbest27.seq
230690200      gbest28.seq
230687570      gbest29.seq
230689666      gbest3.seq
230688910      gbest30.seq
230688080      gbest31.seq
230689328      gbest32.seq
216976910      gbest33.seq
190977502      gbest34.seq
193755382      gbest35.seq
217226196      gbest36.seq
216152452      gbest37.seq
216102447      gbest38.seq
216875925      gbest39.seq
230687645      gbest4.seq
230688363      gbest40.seq
230689840      gbest41.seq
221451342      gbest42.seq
230687848      gbest43.seq
230688997      gbest44.seq
230688873      gbest45.seq
230687645      gbest46.seq
230687703      gbest47.seq
230689292      gbest48.seq
230689629      gbest49.seq
163939285      gbest5.seq
230690309      gbest50.seq
230689771      gbest51.seq
230688524      gbest52.seq
230689594      gbest53.seq
230688626      gbest54.seq
230688996      gbest55.seq
229935890      gbest56.seq
230689058      gbest57.seq
225362984      gbest58.seq
209582361      gbest59.seq
181532829      gbest6.seq
208879568      gbest60.seq
208636970      gbest61.seq
209125908      gbest62.seq
210342239      gbest63.seq
209352115      gbest64.seq
208119596      gbest65.seq
209752893      gbest66.seq
210091724      gbest67.seq
205476725      gbest68.seq
207080375      gbest69.seq
230689161      gbest7.seq
207591910      gbest70.seq
208587171      gbest71.seq
217602105      gbest72.seq
230689937      gbest73.seq
230689393      gbest74.seq
229390215      gbest75.seq
214794889      gbest76.seq
213053286      gbest77.seq
216908837      gbest78.seq
230687671      gbest79.seq
230689378      gbest8.seq
230687596      gbest80.seq
230688596      gbest81.seq
230688412      gbest82.seq
230688897      gbest83.seq
230688286      gbest84.seq
230690316      gbest85.seq
230688463      gbest86.seq
230688702      gbest87.seq
230690006      gbest88.seq
230689949      gbest89.seq
230690427      gbest9.seq
230689210      gbest90.seq
230689392      gbest91.seq
230689218      gbest92.seq
230687862      gbest93.seq
230689516      gbest94.seq
230688442      gbest95.seq
230688967      gbest96.seq
230689451      gbest97.seq
230691265      gbest98.seq
230688881      gbest99.seq
 20397431      gbgen.idx
209716673      gbgss1.seq
209716580      gbgss10.seq
209716260      gbgss11.seq
209716769      gbgss12.seq
209718544      gbgss13.seq
209717291      gbgss14.seq
209718371      gbgss15.seq
209715988      gbgss16.seq
209717008      gbgss17.seq
209718383      gbgss18.seq
209718425      gbgss19.seq
209716102      gbgss2.seq
209718203      gbgss20.seq
209716501      gbgss21.seq
209719589      gbgss22.seq
209716179      gbgss23.seq
209717858      gbgss24.seq
209719159      gbgss25.seq
209718032      gbgss26.seq
209716387      gbgss27.seq
209717221      gbgss28.seq
209717083      gbgss29.seq
209718114      gbgss3.seq
209716836      gbgss30.seq
209716421      gbgss31.seq
209716068      gbgss32.seq
209716266      gbgss33.seq
209716531      gbgss34.seq
209716801      gbgss35.seq
209716889      gbgss36.seq
209718457      gbgss37.seq
209718038      gbgss38.seq
209717095      gbgss39.seq
209718028      gbgss4.seq
209718555      gbgss40.seq
209716401      gbgss41.seq
209717109      gbgss42.seq
 53451126      gbgss43.seq
250002706      gbgss44.seq
250000011      gbgss45.seq
250000964      gbgss46.seq
250003217      gbgss47.seq
250001763      gbgss48.seq
250002787      gbgss49.seq
209716965      gbgss5.seq
250001534      gbgss50.seq
147656200      gbgss51.seq
209716541      gbgss6.seq
209716635      gbgss7.seq
209718414      gbgss8.seq
209718559      gbgss9.seq
169011343      gbhtc.seq
250002604      gbhtg1.seq
250167846      gbhtg10.seq
250081160      gbhtg11.seq
250207044      gbhtg12.seq
250121304      gbhtg13.seq
250071153      gbhtg14.seq
250008330      gbhtg15.seq
250095068      gbhtg16.seq
250131899      gbhtg17.seq
250094767      gbhtg18.seq
250116997      gbhtg19.seq
250058307      gbhtg2.seq
250014680      gbhtg20.seq
250025788      gbhtg21.seq
250018994      gbhtg22.seq
250189438      gbhtg23.seq
250091533      gbhtg24.seq
250233222      gbhtg25.seq
250119254      gbhtg26.seq
250156927      gbhtg27.seq
250020739      gbhtg28.seq
250112408      gbhtg29.seq
250162414      gbhtg3.seq
250049818      gbhtg30.seq
250087340      gbhtg31.seq
250050827      gbhtg32.seq
232770079      gbhtg33.seq
250165035      gbhtg4.seq
250101618      gbhtg5.seq
250025049      gbhtg6.seq
250008334      gbhtg7.seq
250123667      gbhtg8.seq
250222479      gbhtg9.seq
250080350      gbinv1.seq
250005380      gbinv2.seq
250005793      gbinv3.seq
250000171      gbinv4.seq
 62930345      gbinv5.seq
488889583      gbjou.idx
379728008      gbkey.idx
124325028      gbmam.seq
 20348004      gbnew.txt
250000567      gbpat1.seq
250002541      gbpat2.seq
250000873      gbpat3.seq
190644566      gbpat4.seq
 17453564      gbphg.seq
250000485      gbpln1.seq
250000599      gbpln2.seq
250001980      gbpln3.seq
250075837      gbpln4.seq
184364440      gbpln5.seq
250024323      gbpri1.seq
250030034      gbpri10.seq
250070026      gbpri11.seq
250010925      gbpri12.seq
250019233      gbpri13.seq
250208526      gbpri14.seq
250001377      gbpri15.seq
250132895      gbpri16.seq
250000771      gbpri17.seq
250005747      gbpri18.seq
171814573      gbpri19.seq
250042097      gbpri2.seq
250197404      gbpri3.seq
250120762      gbpri4.seq
250043052      gbpri5.seq
250072560      gbpri6.seq
250014249      gbpri7.seq
250116491      gbpri8.seq
250051218      gbpri9.seq
   115655      gbrel.txt
250206475      gbrod1.seq
250002741      gbrod2.seq
 84180176      gbrod3.seq
134161813      gbsdr.txt
  1281941      gbsec.idx
250000460      gbsts1.seq
 72529844      gbsts2.seq
 30805120      gbsyn.seq
  1401880      gbuna.seq
250002684      gbvrl1.seq
250001589      gbvrl2.seq
 16018267      gbvrl3.seq
243829185      gbvrt.seq

2.2.6 Per-Division Statistics 

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each sequence
data file:

Division     Entries    Bases

BCT1         18304      103702046
BCT2         46962      94865361
BCT3         25403      102133037
BCT4         35350      93373870
BCT5         13213      24058125
EST1         68773      26545772
EST10        76874      29906577
EST100       71027      37675749
EST101       70442      45757685
EST102       77060      34945134
EST103       75022      27916560
EST104       76207      26099686
EST105       73997      41449259
EST106       67026      33128783
EST107       79270      50111691
EST108       79919      45589922
EST109       72920      45771962
EST11        76745      29137247
EST110       69712      42735598
EST111       73541      47883909
EST112       68483      44615634
EST113       73626      44914285
EST114       78061      45177405
EST115       72405      49583936
EST116       75508      48234060
EST117       76616      47709159
EST118       78032      33106652
EST119       79129      32272702
EST12        77244      30897406
EST120       80473      47621334
EST121       75416      42872096
EST122       65300      35511215
EST123       73946      38315030
EST124       69177      40192080
EST125       66338      36057030
EST126       72246      43784415
EST127       72817      44564585
EST128       68225      39501971
EST129       74187      41268472
EST13        78722      30401539
EST130       71065      44082918
EST131       63333      39217068
EST132       78153      42489515
EST133       102889     56996459
EST134       80158      43271446
EST135       108462     57223134
EST136       93420      54230156
EST137       67370      35814543
EST138       65872      30615827
EST139       57234      28888617
EST14        79017      31589426
EST140       62781      31047381
EST141       60313      30760649
EST142       67674      35500360
EST143       73586      52082822
EST144       65489      44686167
EST145       82879      48894609
EST146       58601      29939135
EST147       63042      32136056
EST148       67627      40496249
EST149       67374      39825192
EST15        73159      31047300
EST150       62804      40994438
EST151       74995      40897139
EST152       65396      44754302
EST153       95994      37641129
EST154       109865     38963125
EST155       74029      26040777
EST156       73116      27097847
EST157       74359      26377573
EST158       73006      26497367
EST159       78455      26422019
EST16        75572      33117590
EST160       72744      29124142
EST161       74358      28251692
EST17        85372      34392440
EST18        79095      32474941
EST19        81635      33973443
EST2         75524      28992456
EST20        72957      29578237
EST21        72781      33612084
EST22        77348      30802883
EST23        76686      31815373
EST24        75905      34707944
EST25        73547      30923483
EST26        76044      31247758
EST27        80583      36179968
EST28        83001      42232507
EST29        76294      62119067
EST3         74271      30174902
EST30        87747      50914348
EST31        103009     48161992
EST32        97889      50305437
EST33        84721      33131050
EST34        69405      18533128
EST35        72103      19524885
EST36        56199      17221384
EST37        43634      11904573
EST38        43147      11899553
EST39        43118      11369500
EST4         74696      28150982
EST40        86993      36748140
EST41        96570      44262795
EST42        90905      47518714
EST43        85959      40377512
EST44        106539     56599673
EST45        92587      44476463
EST46        75347      31861592
EST47        69102      30715052
EST48        71419      30968172
EST49        74191      31217784
EST5         48621      15381716
EST50        83262      32871614
EST51        71838      28090419
EST52        64763      29310564
EST53        74558      32234660
EST54        74820      35259156
EST55        76806      33703833
EST56        74514      25992516
EST57        81794      32867790
EST58        66694      28182180
EST59        40120      11363822
EST6         56835      18519864
EST60        40260      11730093
EST61        40457      12615641
EST62        40655      12276541
EST63        40599      12683509
EST64        40603      12791656
EST65        40563      12266467
EST66        40279      12343217
EST67        40520      12429527
EST68        41366      12075938
EST69        41283      12756873
EST7         74831      29464448
EST70        41209      13027427
EST71        41113      13147369
EST72        44497      12147635
EST73        42385      22336347
EST74        41478      23569452
EST75        43938      18078706
EST76        50509      23088276
EST77        51772      21465213
EST78        53483      21739401
EST79        76025      32577342
EST8         76996      30943639
EST80        74222      29572664
EST81        74559      32719818
EST82        77477      46327018
EST83        78476      41175924
EST84        76728      39597367
EST85        78782      39201579
EST86        71496      41845208
EST87        74335      32646155
EST88        75737      41051143
EST89        71389      35299462
EST9         78054      30171213
EST90        78118      50497948
EST91        65640      34471399
EST92        72312      37173050
EST93        74659      44874345
EST94        73504      43751563
EST95        71516      42945793
EST96        74904      39741561
EST97        70625      30995025
EST98        67265      31941403
EST99        66500      38969533
GSS1         83934      35983236
GSS10        67041      35998094
GSS11        70629      39711333
GSS12        61939      32354027
GSS13        68344      35531620
GSS14        68329      34807380
GSS15        66062      29672635
GSS16        64261      31970705
GSS17        72704      43558868
GSS18        65755      30767142
GSS19        57765      26812693
GSS2         83798      36237477
GSS20        52357      27204271
GSS21        53009      25506487
GSS22        53987      22986771
GSS23        59547      37882577
GSS24        57229      26658904
GSS25        53433      25475901
GSS26        64468      41354731
GSS27        60906      24413080
GSS28        53786      23467218
GSS29        60120      29489327
GSS3         83165      38791543
GSS30        62142      30365126
GSS31        64559      35950683
GSS32        81792      36223282
GSS33        69550      37351212
GSS34        66426      41784200
GSS35        67203      38172493
GSS36        74194      37329570
GSS37        70362      37480383
GSS38        76022      42789714
GSS39        86247      57278891
GSS4         75075      38549398
GSS40        85729      55672831
GSS41        80974      43080131
GSS42        79914      44453358
GSS43        20927      9154859
GSS44        84330      64382427
GSS45        81028      60806354
GSS46        81982      65791173
GSS47        76621      63789887
GSS48        74611      63003311
GSS49        66552      64688072
GSS50        86830      54795745
GSS51        58207      25873791
GSS5         72281      38653019
GSS6         70389      35250127
GSS7         72399      36335319
GSS8         71867      36782226
GSS9         68981      34212049
HTC          24688      32587397
HTG1         1294       191116621
HTG10        1280       188549011
HTG11        1082       191310005
HTG12        1344       188729068
HTG13        1459       187787555
HTG14        1190       191154874
HTG15        1352       184472564
HTG16        1430       185071889
HTG17        1474       185532979
HTG18        1963       180354713
HTG19        2259       175178637
HTG2         1757       189570950
HTG20        1631       185128642
HTG21        1361       185596584
HTG22        1382       185633800
HTG23        1564       184109746
HTG24        1547       182861157
HTG25        1643       184265110
HTG26        1622       184145687
HTG27        1809       182837012
HTG28        1675       183512599
HTG29        1223       191865233
HTG3         2676       187371292
HTG30        1030       194353997
HTG31        1053       193598818
HTG32        1262       191068609
HTG33        1215       178439544
HTG4         2192       189924802
HTG5         2209       189529417
HTG6         1304       188477462
HTG7         1228       188765946
HTG8         1244       188722919
HTG9         1225       188962134
INV1         7679       178665420
INV2         5977       164456393
INV3         69805      79195797
INV4         30397      119922816
INV5         9608       29807606
MAM          38579      40437316
PAT1         222846     70205773
PAT2         151989     84948509
PAT3         116290     111850006
PAT4         129294     49423723
PHG          2031       6682639
PLN1         22667      137038289
PLN2         77066      78587348
PLN3         17977      139388857
PLN4         62727      79535930
PLN5         32884      75158092
PRI1         10757      159813985
PRI10        33825      134587294
PRI11        17637      148301846
PRI12        1571       179274266
PRI13        1749       180407226
PRI14        2220       186592010
PRI15        15596      156606840
PRI16        17194      158861870
PRI17        39629      128743510
PRI18        33342      128476983
PRI19        41926      67084484
PRI2         1391       174029963
PRI3         1301       184407038
PRI4         1183       173412067
PRI5         1157       176958235
PRI6         1224       179072788
PRI7         1297       168807549
PRI8         1378       176185898
PRI9         1417       173353418
ROD1         25838      146817032
ROD2         31709      136351480
ROD3         23953      28043992
STS1         86703      35190051
STS2         30577      11701811
SYN          6804       12648688
UNA          667        330581
VRL1         74997      62887775
VRL2         74742      66698004
VRL3         3353       5750746
VRT          72625      78959948

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 129.0 (chloroplast and mitochon-
drial sequences not included):

Entries      Bases   Species

5601283 8623240944   Homo sapiens
3588915 2954595785   Mus musculus
407545  1741736289   Rattus norvegicus
331346   675223629   Drosophila melanogaster
305886   318277639   Arabidopsis thaliana
72664    223326041   Oryza sativa (japonica cultivar-group)
197991   221490064   Caenorhabditis elegans
299850   195242860   Brassica oleracea
137414   190743748   Oryza sativa
189090   168566491   Tetraodon nigroviridis
160373   153731744   Pan troglodytes
244485   143288192   Danio rerio
238832   122702872   Bos taurus
256123   118077717   Glycine max
247110   111304151   Zea mays
201305   102882494   Xenopus laevis
155256    95745650   Anopheles gambiae
174486    91194491   Ciona intestinalis
162001    84127124   Lycopersicon esculentum
144094    84096583   Dictyostelium discoideum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, each of the 296 files of a
GenBank release begins with the same header, except for the first line,
which contains the file name, and the sixth line, which contains the
title of the file. The first line of the file contains the file name
in character positions 1 to 9 and the full database name (Genetic Sequence
Data Bank) starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 April 2002

                NCBI-GenBank Flat File Release 129.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes four subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Mandatory
subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 129.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Tanya Barrett, Lori Black, Larissa Brown, Larry Chlumsky, Karen
	Clark, Irene Fang, Michael Fetchko, Belinda Jackson, Anjanette
	Johnston, Dione Kampa, Pierre Ledoux, Richard McVeigh, Leonie 
	Misquitta, Ilene Mizrachi, DeAnne Olsen Cravaritis, Quy Phung, 
	David Rasko, Leigh Riley, Paola Roncaglia, Gert Roosen, Susan 
	Schafer, Suh-suh Wang, Jane Weisemann, Steven Wilhite, and 
	Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Anton Butanaev, Mark Cavanaugh,
	Hsiu-Chuan Chen, Jonathan Kans, Michael Kimelman, Jim Ostell,
	Joel Plotkin, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Tatiana Tatusov, Carolyn Tolstoshev, Jane Weisemann, Eugene Yaschenko

Database Administration
	Helen Epting, Slava Khotomliansky, Tony Stearman

User Support
        Nancy Allmang, Medha Bhagwat, Peter Cooper, Susan Dombrowski, 
        Renata Geer, Dawn Lipshultz, Eugenia Posey-Marcos, Scott McGinnis,
        Vyvy Pham, Barbara Rapp, Monica Romiti, Tao Tao, Rose Marie Woodsmall, 		
	David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center