Release Notes For GenBank Release 138

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2003

               NCBI-GenBank Flat File Release 138.0

                    Distribution Release Notes

 29819397 loci, 35599621471 bases, from 29819397 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank database. If you have any questions or
comments about GenBank or this document, please contact NCBI via email
at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 138.0
1.2 Cutoff Date
1.3 Important Changes in Release 138.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 138.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 138.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server: ftp.ncbi.nih.gov .

1.2 Cutoff Date

  This full release, 138.0, incorporates data available to the collaborating
databases as of October 20, 2003.  For more recent data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

    Mirrors of the GenBank FTP site at the NCBI are available from the San Diego
    Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

    Some users who experience slow FTP transfers of large files might realize
    an improvement in transfer rates from these alternate sites when traffic at
    the NCBI is high.

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 138.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 29 with this release:

  - the EST division is now comprised of 279 files (+9)
  - the GSS division is now comprised of 102 files (+18)
  - the ROD division is now comprised of 10  files (+1)
  - the VRT division is now comprised of 4   files (+1)

  Updates to a significant number of HTC sequences has resulted in a
  *decrease* in the overall number of HTC sequence files, from four
  to three. The changes reduced the sizes of the records, such that
  they now fit into only three files.

1.3.2 BASECOUNT line dropped

  The BASECOUNT line of the GenBank flatfile format provides totals for
the number of A, T, G, C, and 'other' basepairs that are present within
the sequence of a database record. For example:

LOCUS       AY244763                5686 bp    DNA     linear   BCT 10-APR-2003
DEFINITION  Rhodococcus sp. DS7 cysDNCQ operon, complete sequence.
ACCESSION   AY244763
VERSION     AY244763.1  GI:29725657
....
BASE COUNT     1137 a   1661 c   1821 g   1066 t      1 others
ORIGIN      
        1 cgcggtttgt gacgtctgat tgccggtcat tgacctttgg gtagaacgag ttctattctg
       61 tgattgcgtt caatttagaa ccagtccggt acataaatgt accgatgcgg aaatggtgtt
....
     5281 tgtcagctcg gtgtctggng gcgaggctaa gcaccaacgg cttcggtagc agaaccacat

  This information is computationally expensive to produce for very large
sequences, and for sequences in the CON division. In the CON division case,
a record might be comprised of 'pointers' to hundreds, or even thousands,
of underlying GenBank records. So to calculate the BASECOUNT line content,
retrievals of sequence data for those many records must be performed. This
can noticeably impact the response time for flatfile generation within the
Entrez application.

As of this October 2003 GenBank Release (138.0), the BASECOUNT linetype
is no longer present in GenBank Release and GenBank Update products.

Depending on demand, a display option might be implemented in Entrez which
allows users to choose to have BASECOUNT shown.

1.3.3 New oriT feature

  As of this October 2003 Release 138.0, a new feature key (oriT) is be
legal for the feature table:

	Feature Key            oriT

	Definition             origin of transfer; region of a DNA molecule where transfer is
                               initiated during the process of conjugation or mobilization.

	Mandatory qualifiers:  None

	Optional Qualifiers:   /bound_moiety="text"
                               /citation=[number]
                               /db_xref="<database>:<identifier>"
                               /direction=value
                               /evidence=<evidence_value>
                               /gene="text"
                               /label=feature_label
                               /locus_tag="text" (single token)
                               /map="text"
                               /note="text"
                               /rpt_family="text"
                               /rpt_type=<repeat_type>
                               /rpt_unit=<feature_label>
                               /standard_name="text"
                               /usedin=accnum:feature_label

	Molecule Scope:        DNA

	Comments:              rep_origin should be used for origins of replication; /direction
                               has legal values RIGHT, LEFT and BOTH, however only RIGHT and LEFT
                               are valid when used in conjunction with the oriT feature; origins
                               of transfer can be present in the chromosome; plasmids can contain
                               multiple origins of transfer

1.3.4 New /ecotype qualifier

  As of this October 2003 GenBank Release 138.0, a new source feature
qualifier called /ecotype is legal. The definition for /ecotype is:

        Qualifier       /ecotype=    
        Definition      A distinct population of organisms of a
                        widespread species that has adapted
                        genetically to its own local habitat.
                        Nevertheless, they can still reproduce
                        with members of other ecotypes of the
                        same species.
        Value format    "text"
        Example         /ecotype="Columbia"

        Comment         'Ecotype' is often applied to standard
                        genetic stocks of Arabidopsis thaliana,
                        but it can be applied to any organism,
                        especially sessile organisms like plants.


1.3.5 Change to value format of /rpt_unit

  As of this October 2003 Release 138.0, the value-format of the /rpt_unit
qualifier has been changed to allow 'text' . The previously documented
format was:

	Value format    <feature_label>  or  <base_range>
	Example         /rpt_unit=Alu_rpt1
	                /rpt_unit=202..245
	Comment         used to indicate feature which defines (or base range of) the
	                repeat unit of which a repeat region is made

  However, a very common value for /rpt_unit is a literal sequence
string that represents the repeating unit(s). For example:

	/rpt_unit=ta
	/rpt_unit=ac;ag

So the format of this qualifier has been changed to:

	Value format    "text"  or  <feature_label>  or  <base_range>

Existing feature label and base range values are now presented as
text values.

1.3.6 New operon feature

  Starting with this October 2003 Release 138.0, a new type of feature 
is legal for the feature table:

	Feature Key:           operon

	Definition:            region containing polycistronic transcripts
                               and regulatory sequences containing genes
                               that encode enzymes that are in the same
                               metabolic pathway  

	Mandatory qualifiers:  /operon

	Optional qualifiers:   /allele="text"
                               /citation=[number]
                               /db_xref="<database>:<identifier>"
                               /evidence=<evidence_value>
                               /function="text"
                               /operon="text"
                               /label=feature_label
                               /locus_tag="text" (single token)
                               /map="text"
                               /note="text"
                               /product="text"
                               /pseudo
                               /phenotype="text"
                               /standard_name="text"
                               /usedin=accnum:feature_label

  In bacteria, many genes encoding for specific biosynthetic pathways are
transcribed in polycistronic operons. It has been challenging to reflect
this biology within the GenBank flatfile format. GenBank has been using
a gene feature that spans the entire regulatory region and all of the coding
regions and then gene features corresponding to the individual genes spaning
the coding genes.

  The new operon feature will simplify the annotation of cases like these.

1.3.7 [er] prefix for JOURNAL line

  As of this October 2003 Release 138.0, a new prefix is legal for the
JOURNAL line:  [er] .

  This prefix is an abbreviation for Electronic Resource, which is a 
term that describes journal articles that are available on-line.

  In 1999, an interim 'Online Publication' REFERENCE format was adopted for
use at GenBank in order to cite articles appearing only electronically:

      REFERENCE   1  (bases 1 to 2858)
        AUTHORS   Smith, J.
        TITLE     Cloning and expression of a phospholipase gene
        JOURNAL   Online Publication
        REMARK    Online-Journal-name; Article Identifier; URL

  In subsequent years, no standards for citing on-line journal articles
have emerged from library organizations.

  One such library organization (National Library of Medicine, NIH) is now
assigning identifiers (Medline UIs and PubMed Ids) to articles published
on-line, and it is presenting these articles in a manner that is identical
to print-journal articles. For example:

      REFERENCE   1
        AUTHORS   Haas,B.J., Volfovsky,N., Town,C.D., Troukhan,M., Alexandrov,N.,
                  Feldmann,K.A., Flavell,R.B., White,O. and Salzberg,S.L.
        TITLE     Full-length messenger RNA sequences greatly improve genome
                  annotation
        JOURNAL   Genome Biol. 3 (6), RESEARCH0029 (2002)
        MEDLINE   22088475
         PUBMED   12093376

  Although these citations may contain journal abbreviations, volume numbers,
issue/part/supplement numbers, pages, and year (just like a print-journal
citation), there is no guarantee that the contents of these fields will be 
comparable to those of print-journal citations.

  In the case above, although the page number is a bit unusual
("RESEARCH0029"), software that processes the JOURNAL line would probably
still be able to parse its contents. But there is also a possibility that
these fields could contain unusual characters (embedded spaces, commas,
parentheses), and possibly even URLs. So the presence of [er] :

        JOURNAL   [er] Genome Biol. 3 (6), RESEARCH0029 (2002)

will act as a warning (primarily to software) that the contents of the
JOURNAL line might not be as parsable as a print-journal JOURNAL line.

1.3.8 GSS File Header Problem

  GSS sequences at GenBank are maintained in one of two different systems,
depending on their origin. One recent change to release processing involves
the parallelization of the dumps from those systems. Because the second dump
(for example) has no prior knowledge of exactly how many GSS files will be
dumped from the first, it doesn't know how to number it's own output files.

  There is thus a discrepancy between the filenames and file headers of eleven
GSS flatfiles in Release 138.0. Consider the gbgss74.seq file:

GBGSS1.SEQ           Genetic Sequence Data Bank
                           October 15 2003

                NCBI-GenBank Flat File Release 138.0

                           GSS Sequences (Part 1)

   87880 loci,    66457089 bases, from    87880 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "92" based on the files dumped from the other system.

  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 **Sequence Length Limitation To Be Removed In June 2004**

  At the May 2003 collaborative meeting among representatives of GenBank,
EMBL, and DDBJ, it was decided that the 350 kilobase limit on the sequence
length of database records will be removed as of June 2004.

  Individual, complete sequences are currently expected to be a maximum
of 350 kbp in length. One major reason for the existence of this limit is
as an aid to users of sequence analysis software, some of which might not
be capable of processing megabase-scale sequences.

  However, very significant exceptions to the 350 kbp limit have existed
for several years; Phase 1 (unordered, unoriented) and Phase 2 (ordered,
oriented) high-throughput genomic sequences (HTGS) generated by efforts
such as the Human Genome Project; large dispersed eukaryotic genes with
an intron/exon structure that spans more than 350 kbp; and sequences
which result from assemblies of Whole Genome Shotgun (WGS) project data.

  Given these exceptions, and the technological advances which have made
large-scale sequencing practical for an increasing number of researchers,
the collaboration has decided that the 350 kbp limit must be removed.

  As of June 2004, the length of database sequences will be limited only
by the natural structures of an organism's genome. For example, a single
record might be used to represent all of human chromosome 1, which is
approximately 245 Mbp in length.

  Software developers for some of the larger commercial sequence analysis
packages were recently asked what timeframe would be appropriate for this
change. Answers ranged from "immediately", to "several months", to "one year".
So the one-year timeframe was selected, to provide ample time to implement
changes which megabase-scale sequences may require.

  Some sample records with very large sequences have been made available
so that developers can begin to test their software modifications:

	ftp://ftp.ncbi.nih.gov/genbank/LargeSeqs

  Many changes are expected after the removal of the length limit. For 
example, complete bacterial genomes (typically on the order of several
megabases) will be re-assembled into single sequence records. The submission
process for such genomes will become much more streamlined, since database
staff will no longer have to split the genomes into pieces. BLAST services
will be enchanced, so that hits reported within very large sequences will
be presented in a meaningful context.

  All such changes will be discussed more fully in future release notes,
the NCBI newsletter, and the GenBank newsgroup.

1.4.2 Accession format of WGS records

  Whole Genome Shotgun (WGS) sequences utilize an accession number format which
is different from those used for non-WGS GenBank sequences. This format is
referred to as 4 + 2 + 6, and is comprised of:

  - a 4-letter WGS project code
  - a 2-digit assembly-version number
  - a 6 (and sometimes 7) digit sequence number

  Because of their unique nature, WGS sequences are kept separate from other
GenBank products:

	ftp://ftp.ncbi.nih.gov/genbank/wgs

  For example, sequences much larger than the current 350 kbp limit can be
generated during the WGS assembly phase. In addition, there is no tracking
of nucleotide sequences from one assembly to the next. So the accessions
of one:

	AAAB01000001
	AAAB01000002
	AAAB01000003
	....

are not necessarily related in any way to those of the next assembly:

	AAAB02000001
	AAAB02000002
	AAAB02000003
	....

  When a WGS project is completed, it is possible that the submittors may chose
to submit a single finished WGS sequence with a 4 + 2 + 6 accession, at which
point it could appear in the non-WGS portion of GenBank.

  Alternately, the submittors might chose to submit the completed genome via
a non-WGS method, in which case a de-novo non-WGS accession would be assigned.
That record would then have one or more 2 + 4 + 6 WGS accessions as
secondary accessions.

  Both scenarios are possible, especially after the 350 kbp sequence length
restriction is lifted. So we felt it was important to alert users that
WGS accessions may eventually be encountered in the non-WGS portion of
of GenBank, as primary or secondary accession numbers.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

  The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 562 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

1.  gbrel.txt	- Release notes (this document).
2.  gbsdr.txt 	- Short directory of the data bank.
3.  gbacc.idx 	- Index of the entries according to accession number.
4.  gbkey.idx 	- Index of the entries according to keyword phrase.
5.  gbaut1.idx 	- Index of the entries according to author, part 1.
6.  gbaut2.idx 	- Index of the entries according to author, part 2.
7.  gbaut3.idx 	- Index of the entries according to author, part 3.
8.  gbaut4.idx 	- Index of the entries according to author, part 4.
9.  gbaut5.idx 	- Index of the entries according to author, part 5.
10. gbaut6.idx 	- Index of the entries according to author, part 6.
11. gbaut7.idx 	- Index of the entries according to author, part 7.
12. gbaut8.idx 	- Index of the entries according to author, part 8.
13. gbaut9.idx 	- Index of the entries according to author, part 9.
14. gbaut10.idx - Index of the entries according to author, part 10.
15. gbaut11.idx - Index of the entries according to author, part 11.
16. gbaut12.idx - Index of the entries according to author, part 12.
17. gbaut13.idx - Index of the entries according to author, part 13.
18. gbaut14.idx - Index of the entries according to author, part 14.
19. gbaut15.idx - Index of the entries according to author, part 15.
20. gbaut16.idx - Index of the entries according to author, part 16.
21. gbaut17.idx - Index of the entries according to author, part 17.
22. gbaut18.idx - Index of the entries according to author, part 18.
23. gbaut19.idx - Index of the entries according to author, part 19.
24. gbaut20.idx - Index of the entries according to author, part 20.
25. gbaut21.idx - Index of the entries according to author, part 21.
26. gbaut22.idx - Index of the entries according to author, part 22.
27. gbjou.idx 	- Index of the entries according to journal citation.
28. gbgen.idx 	- Index of the entries according to gene names.
29. gbsec.idx	- Index of the entries according to secondary accession number.
30. gbpri1.seq 	- Primate sequence entries, part 1.
31. gbpri2.seq 	- Primate sequence entries, part 2.
32. gbpri3.seq 	- Primate sequence entries, part 3.
33. gbpri4.seq 	- Primate sequence entries, part 4.
34. gbpri5.seq 	- Primate sequence entries, part 5.
35. gbpri6.seq 	- Primate sequence entries, part 6.
36. gbpri7.seq 	- Primate sequence entries, part 7.
37. gbpri8.seq 	- Primate sequence entries, part 8.
38. gbpri9.seq 	- Primate sequence entries, part 9.
39. gbpri10.seq	- Primate sequence entries, part 10.
40. gbpri11.seq	- Primate sequence entries, part 11.
41. gbpri12.seq	- Primate sequence entries, part 12.
42. gbpri13.seq	- Primate sequence entries, part 13.
43. gbpri14.seq	- Primate sequence entries, part 14.
44. gbpri15.seq	- Primate sequence entries, part 15.
45. gbpri16.seq	- Primate sequence entries, part 16.
46. gbpri17.seq	- Primate sequence entries, part 17.
47. gbpri18.seq	- Primate sequence entries, part 18.
48. gbpri19.seq	- Primate sequence entries, part 19.
49. gbpri20.seq	- Primate sequence entries, part 20.
50. gbpri21.seq	- Primate sequence entries, part 21.
51. gbpri22.seq	- Primate sequence entries, part 22.
52. gbpri23.seq	- Primate sequence entries, part 23.
53. gbpri24.seq	- Primate sequence entries, part 24.
54. gbpri25.seq	- Primate sequence entries, part 25.
55. gbpri26.seq	- Primate sequence entries, part 26.
56. gbrod1.seq 	- Rodent sequence entries, part 1.
57. gbrod2.seq 	- Rodent sequence entries, part 2.
58. gbrod3.seq 	- Rodent sequence entries, part 3.
59. gbrod4.seq 	- Rodent sequence entries, part 4.
60. gbrod5.seq 	- Rodent sequence entries, part 5.
61. gbrod6.seq 	- Rodent sequence entries, part 6.
62. gbrod7.seq 	- Rodent sequence entries, part 7.
63. gbrod8.seq 	- Rodent sequence entries, part 8.
64. gbrod9.seq 	- Rodent sequence entries, part 9.
65. gbrod10.seq - Rodent sequence entries, part 10.
66. gbmam.seq 	- Other mammalian sequence entries.
67. gbvrt1.seq 	- Other vertebrate sequence entries, part 1.
68. gbvrt2.seq 	- Other vertebrate sequence entries, part 2.
69. gbvrt3.seq 	- Other vertebrate sequence entries, part 3.
70. gbvrt4.seq 	- Other vertebrate sequence entries, part 4.
71. gbinv1.seq 	- Invertebrate sequence entries, part 1.
72. gbinv2.seq 	- Invertebrate sequence entries, part 2.
73. gbinv3.seq 	- Invertebrate sequence entries, part 3.
74. gbinv4.seq 	- Invertebrate sequence entries, part 4.
75. gbinv5.seq 	- Invertebrate sequence entries, part 5.
76. gbinv6.seq 	- Invertebrate sequence entries, part 6.
77. gbpln1.seq 	- Plant sequence entries (including fungi and algae), part 1.
78. gbpln2.seq 	- Plant sequence entries (including fungi and algae), part 2.
79. gbpln3.seq 	- Plant sequence entries (including fungi and algae), part 3.
80. gbpln4.seq 	- Plant sequence entries (including fungi and algae), part 4.
81. gbpln5.seq 	- Plant sequence entries (including fungi and algae), part 5.
82. gbpln6.seq 	- Plant sequence entries (including fungi and algae), part 6.
83. gbpln7.seq 	- Plant sequence entries (including fungi and algae), part 7.
84. gbpln8.seq 	- Plant sequence entries (including fungi and algae), part 8.
85. gbpln9.seq 	- Plant sequence entries (including fungi and algae), part 9.
86. gbbct1.seq 	- Bacterial sequence entries, part 1.
87. gbbct2.seq 	- Bacterial sequence entries, part 2.
88. gbbct3.seq 	- Bacterial sequence entries, part 3.
89. gbbct4.seq 	- Bacterial sequence entries, part 4.
90. gbbct5.seq 	- Bacterial sequence entries, part 5.
91. gbbct6.seq 	- Bacterial sequence entries, part 6.
92. gbbct7.seq 	- Bacterial sequence entries, part 7.
93. gbbct8.seq 	- Bacterial sequence entries, part 8.
94. gbvrl1.seq 	- Viral sequence entries, part 1.
95. gbvrl2.seq 	- Viral sequence entries, part 2.
96. gbvrl3.seq 	- Viral sequence entries, part 3.
97. gbphg.seq 	- Phage sequence entries.
98. gbsyn.seq 	- Synthetic and chimeric sequence entries.
99. gbuna.seq 	- Unannotated sequence entries.
100. gbest1.seq  - EST (expressed sequence tag) sequence entries, part 1.
101. gbest2.seq  - EST (expressed sequence tag) sequence entries, part 2.
102. gbest3.seq  - EST (expressed sequence tag) sequence entries, part 3.
103. gbest4.seq  - EST (expressed sequence tag) sequence entries, part 4.
104. gbest5.seq  - EST (expressed sequence tag) sequence entries, part 5.
105. gbest6.seq  - EST (expressed sequence tag) sequence entries, part 6.
106. gbest7.seq  - EST (expressed sequence tag) sequence entries, part 7.
107. gbest8.seq  - EST (expressed sequence tag) sequence entries, part 8.
108. gbest9.seq  - EST (expressed sequence tag) sequence entries, part 9.
109. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
110. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
111. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
112. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
113. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
114. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
115. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
116. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
117. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
118. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
119. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
120. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
121. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
122. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
123. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
124. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
125. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
126. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
127. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
128. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
129. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
130. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
131. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
132. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
133. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
134. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
135. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
136. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
137. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
138. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
139. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
140. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
141. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
142. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
143. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
144. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
145. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
146. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
147. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
148. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
149. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
150. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
151. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
152. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
153. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
154. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
155. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
156. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
157. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
158. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
159. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
160. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
161. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
162. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
163. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
164. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
165. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
166. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
167. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
168. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
169. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
170. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
171. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
172. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
173. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
174. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
175. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
176. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
177. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
178. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
179. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
180. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
181. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
182. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
183. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
184. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
185. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
186. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
187. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
188. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89
189. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
190. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
191. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
192. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
193. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
194. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
195. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
196. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
197. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
198. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
199. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
200. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
201. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
202. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
203. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
204. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
205. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
206. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
207. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
208. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
209. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
210. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
211. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
212. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
213. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
214. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
215. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
216. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
217. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
218. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
219. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
220. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
221. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
222. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
223. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
224. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
225. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
226. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
227. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
228. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
229. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
230. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
231. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
232. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
233. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
234. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
235. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
236. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
237. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
238. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
239. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
240. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
241. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
242. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
243. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
244. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
245. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
246. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
247. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
248. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
249. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
250. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
251. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
252. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
253. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
254. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
255. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
256. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
257. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
258. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
259. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
260. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
261. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
262. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
263. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
264. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
265. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
266. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
267. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
268. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
269. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
270. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
271. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
272. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
273. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
274. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
275. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
276. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
277. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
278. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
279. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
280. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
281. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
282. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
283. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
284. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
285. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
286. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
287. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
288. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
289. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
290. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
291. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
292. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
293. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
294. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
295. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
296. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
297. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
298. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
299. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
300. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
301. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
302. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
303. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
304. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
305. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
306. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
307. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
308. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
309. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
310. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
311. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
312. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
313. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
314. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
315. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
316. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
317. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
318. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
319. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
320. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
321. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
322. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
323. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
324. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
325. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
326. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
327. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
328. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
329. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
330. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
331. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
332. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
333. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
334. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
335. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
336. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
337. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
338. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
339. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
340. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
341. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
342. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
343. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
344. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
345. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
346. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
347. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
348. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
349. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
350. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
351. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
352. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
353. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
354. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
355. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
356. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
357. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
358. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
359. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
360. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
361. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
362. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
363. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
364. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
365. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
366. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
367. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
368. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
369. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
370. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
371. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
372. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
373. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
374. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
375. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
376. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
377. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
378. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
379. gbpat1.seq  - Patent sequence entries, part 1.
380. gbpat2.seq  - Patent sequence entries, part 2.
381. gbpat3.seq  - Patent sequence entries, part 3.
382. gbpat4.seq  - Patent sequence entries, part 4.
383. gbpat5.seq  - Patent sequence entries, part 5.
384. gbpat6.seq  - Patent sequence entries, part 6.
385. gbpat7.seq  - Patent sequence entries, part 7.
386. gbpat8.seq  - Patent sequence entries, part 8.
387. gbpat9.seq  - Patent sequence entries, part 9.
388. gbpat10.seq - Patent sequence entries, part 10.
389. gbsts1.seq  - STS (sequence tagged site) sequence entries, part 1.
390. gbsts2.seq  - STS (sequence tagged site) sequence entries, part 2.
391. gbsts3.seq  - STS (sequence tagged site) sequence entries, part 3.
392. gbgss1.seq  - GSS (genome survey sequence) sequence entries, part 1.
393. gbgss2.seq  - GSS (genome survey sequence) sequence entries, part 2.
394. gbgss3.seq  - GSS (genome survey sequence) sequence entries, part 3.
395. gbgss4.seq  - GSS (genome survey sequence) sequence entries, part 4.
396. gbgss5.seq  - GSS (genome survey sequence) sequence entries, part 5.
397. gbgss6.seq  - GSS (genome survey sequence) sequence entries, part 6.
398. gbgss7.seq  - GSS (genome survey sequence) sequence entries, part 7.
399. gbgss8.seq  - GSS (genome survey sequence) sequence entries, part 8.
400. gbgss9.seq  - GSS (genome survey sequence) sequence entries, part 9.
401. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
402. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
403. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
404. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
405. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
406. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
407. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
408. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
409. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
410. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
411. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
412. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
413. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
414. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
415. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
416. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
417. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
418. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
419. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
420. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
421. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
422. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
423. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
424. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
425. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
426. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
427. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
428. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
429. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
430. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
431. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
432. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
433. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
434. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
435. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
436. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
437. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
438. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
439. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
440. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
441. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
442. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
443. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
444. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
445. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
446. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
447. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
448. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
449. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
450. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
451. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
452. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
453. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
454. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
455. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
456. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
457. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
458. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
459. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
460. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
461. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
462. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
463. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
464. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
465. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
466. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
467. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
468. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
469. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
470. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
471. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
472. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
473. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
474. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
475. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
476. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
477. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
478. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
479. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
480. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
481. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
482. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
483. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
484. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
485. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
486. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
487. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
488. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
489. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
490. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
491. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
492. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
493. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
494. gbhtg1.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 1.
495. gbhtg2.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 2.
496. gbhtg3.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 3.
497. gbhtg4.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 4.
498. gbhtg5.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 5.
499. gbhtg6.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 6.
500. gbhtg7.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 7.
501. gbhtg8.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 8.
502. gbhtg9.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 9.
503. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
504. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
505. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
506. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
507. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
508. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
509. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
510. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
511. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
512. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
513. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
514. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
515. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
516. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
517. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
518. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
519. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
520. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
521. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
522. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
523. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
524. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
525. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
526. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
527. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
528. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
529. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
530. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
531. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
532. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
533. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
534. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
535. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
536. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
537. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
538. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
539. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
540. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
541. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
542. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
543. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
544. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
545. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
546. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
547. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
548. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
549. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
550. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
551. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
552. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
553. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
554. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
555. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
556. gbhtc1.seq	 - HTC (high throughput cDNA sequencing) entries, part 1.
557. gbhtc2.seq	 - HTC (high throughput cDNA sequencing) entries, part 2.
558. gbhtc3.seq	 - HTC (high throughput cDNA sequencing) entries, part 3.
559. gbcon.seq	 - CON division entries (see description below for details)
560. gbchg.txt   - Accession numbers of entries updated since the previous release.
561. gbdel.txt   - Accession numbers of entries deleted since the previous release.
562. gbnew.txt   - Accession numbers of entries new since the previous release.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the 
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

	ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 138.0 flatfiles require roughly 118 GB (sequence
files only) or 131 GB (including the 'short directory' and 'index' files).
The following table contains the approximate sizes of the individual files in
this release.  Since minor changes to some of the files might have occurred
after these release notes were written, these sizes should not be used to
determine file integrity; they are provided as an aid to planning only.

File Size      File Name

 976643295     gbacc.idx
 500888689     gbaut1.idx
 500063544     gbaut10.idx
 504123577     gbaut11.idx
 500382544     gbaut12.idx
 504358549     gbaut13.idx
 509743479     gbaut14.idx
 506937191     gbaut15.idx
 517551635     gbaut16.idx
 500639230     gbaut17.idx
 504914345     gbaut18.idx
 515004686     gbaut19.idx
 506517350     gbaut2.idx
 500568403     gbaut20.idx
 510812270     gbaut21.idx
 159993728     gbaut22.idx
 509126100     gbaut3.idx
 500078477     gbaut4.idx
 500730088     gbaut5.idx
 549213728     gbaut6.idx
 515037903     gbaut7.idx
 517523972     gbaut8.idx
 507965465     gbaut9.idx
 250014470     gbbct1.seq
 250561827     gbbct2.seq
 250003653     gbbct3.seq
 250132421     gbbct4.seq
 250001341     gbbct5.seq
 250033211     gbbct6.seq
 250003131     gbbct7.seq
  77070470     gbbct8.seq
   2077440     gbchg.txt
  17712843     gbcon.seq
     92480     gbdel.txt
 230689215     gbest1.seq
 230688780     gbest10.seq
 230687559     gbest100.seq
 230691435     gbest101.seq
 230689455     gbest102.seq
 230689415     gbest103.seq
 230689756     gbest104.seq
 230689834     gbest105.seq
 230688618     gbest106.seq
 230004400     gbest107.seq
 230688762     gbest108.seq
 230687964     gbest109.seq
 230687991     gbest11.seq
 230687584     gbest110.seq
 230688736     gbest111.seq
 230689861     gbest112.seq
 230690718     gbest113.seq
 230689610     gbest114.seq
 230689389     gbest115.seq
 230687586     gbest116.seq
 230688120     gbest117.seq
 230688025     gbest118.seq
 230689285     gbest119.seq
 230689583     gbest12.seq
 230688687     gbest120.seq
 230689359     gbest121.seq
 230687860     gbest122.seq
 230688840     gbest123.seq
 230688164     gbest124.seq
 230690574     gbest125.seq
 230690479     gbest126.seq
 230689758     gbest127.seq
 230688530     gbest128.seq
 230689336     gbest129.seq
 230688416     gbest13.seq
 230688459     gbest130.seq
 230689399     gbest131.seq
 230689629     gbest132.seq
 230689901     gbest133.seq
 230689468     gbest134.seq
 230687549     gbest135.seq
 230689124     gbest136.seq
 230691386     gbest137.seq
 230688178     gbest138.seq
 230688316     gbest139.seq
 230687670     gbest14.seq
 230687628     gbest140.seq
 230689111     gbest141.seq
 230690146     gbest142.seq
 230691533     gbest143.seq
 230688886     gbest144.seq
 230692022     gbest145.seq
 230690500     gbest146.seq
 230688669     gbest147.seq
 230688383     gbest148.seq
 230690360     gbest149.seq
 230690003     gbest15.seq
 230687840     gbest150.seq
 230689161     gbest151.seq
 230689252     gbest152.seq
 230688263     gbest153.seq
 230688632     gbest154.seq
 230688828     gbest155.seq
 230687878     gbest156.seq
 230687689     gbest157.seq
 230689009     gbest158.seq
 230688639     gbest159.seq
 230689872     gbest16.seq
 230688638     gbest160.seq
 230688796     gbest161.seq
 230688787     gbest162.seq
 230688476     gbest163.seq
 230689162     gbest164.seq
 230687932     gbest165.seq
 230689869     gbest166.seq
 230688180     gbest167.seq
 230688750     gbest168.seq
 230688032     gbest169.seq
 230689177     gbest17.seq
 230690837     gbest170.seq
 230688890     gbest171.seq
 230688134     gbest172.seq
 230688210     gbest173.seq
 230690548     gbest174.seq
 230688428     gbest175.seq
 230689384     gbest176.seq
 230691184     gbest177.seq
 230687919     gbest178.seq
 230688205     gbest179.seq
 230689635     gbest18.seq
 230690610     gbest180.seq
 230687822     gbest181.seq
 230689566     gbest182.seq
 230689081     gbest183.seq
 230687665     gbest184.seq
 230688697     gbest185.seq
 230688654     gbest186.seq
 230688314     gbest187.seq
 230687687     gbest188.seq
 230689270     gbest189.seq
 230687978     gbest19.seq
 230689524     gbest190.seq
 230690423     gbest191.seq
 230688615     gbest192.seq
 230690742     gbest193.seq
 230689879     gbest194.seq
 165853521     gbest195.seq
 162569777     gbest196.seq
 166032459     gbest197.seq
 170229415     gbest198.seq
 169820773     gbest199.seq
 230689481     gbest2.seq
 230688881     gbest20.seq
 164088413     gbest200.seq
 165261238     gbest201.seq
 164668519     gbest202.seq
 164462296     gbest203.seq
 164686647     gbest204.seq
 164363573     gbest205.seq
 164163922     gbest206.seq
 163548170     gbest207.seq
 168054055     gbest208.seq
 162156063     gbest209.seq
 230689191     gbest21.seq
 164032644     gbest210.seq
 168489720     gbest211.seq
 167296002     gbest212.seq
 165975654     gbest213.seq
 165849449     gbest214.seq
 165523752     gbest215.seq
 165277022     gbest216.seq
 164392147     gbest217.seq
 164452312     gbest218.seq
 165593761     gbest219.seq
 230687746     gbest22.seq
 167587431     gbest220.seq
 180543431     gbest221.seq
 170957317     gbest222.seq
 230689132     gbest223.seq
 230688401     gbest224.seq
 230690525     gbest225.seq
 230690660     gbest226.seq
 230688374     gbest227.seq
 230688280     gbest228.seq
 230688620     gbest229.seq
 230688760     gbest23.seq
 230689429     gbest230.seq
 230687818     gbest231.seq
 230689457     gbest232.seq
 230687450     gbest233.seq
 230688071     gbest234.seq
 230687882     gbest235.seq
 230690494     gbest236.seq
 230690336     gbest237.seq
 230690216     gbest238.seq
 230688345     gbest239.seq
 230689634     gbest24.seq
 230690551     gbest240.seq
 230688555     gbest241.seq
 230688024     gbest242.seq
 230689395     gbest243.seq
 230690787     gbest244.seq
 230690212     gbest245.seq
 230688529     gbest246.seq
 230687958     gbest247.seq
 230689100     gbest248.seq
 230687857     gbest249.seq
 230687460     gbest25.seq
 230688245     gbest250.seq
 212845222     gbest251.seq
 230688921     gbest252.seq
 230687595     gbest253.seq
 230690182     gbest254.seq
 230689699     gbest255.seq
 230689529     gbest256.seq
 230689787     gbest257.seq
 230689071     gbest258.seq
 230689159     gbest259.seq
 230690272     gbest26.seq
 230689208     gbest260.seq
 230688401     gbest261.seq
 230689023     gbest262.seq
 230688697     gbest263.seq
 230687520     gbest264.seq
 230688294     gbest265.seq
 230689128     gbest266.seq
 230687998     gbest267.seq
 230689112     gbest268.seq
 230693222     gbest269.seq
 230689642     gbest27.seq
 230691325     gbest270.seq
 230687614     gbest271.seq
 230687521     gbest272.seq
 230688052     gbest273.seq
 230689600     gbest274.seq
 230688535     gbest275.seq
 227191306     gbest276.seq
 230690547     gbest277.seq
 230688366     gbest278.seq
  42911007     gbest279.seq
 230688505     gbest28.seq
 230688416     gbest29.seq
 230690810     gbest3.seq
 230687960     gbest30.seq
 230688457     gbest31.seq
 230688170     gbest32.seq
 230687525     gbest33.seq
 230688394     gbest34.seq
 230687816     gbest35.seq
 202456789     gbest36.seq
 190720005     gbest37.seq
 200809399     gbest38.seq
 214454629     gbest39.seq
 230687964     gbest4.seq
 216174379     gbest40.seq
 216142377     gbest41.seq
 216597362     gbest42.seq
 230687620     gbest43.seq
 230687511     gbest44.seq
 222283101     gbest45.seq
 230688952     gbest46.seq
 230687455     gbest47.seq
 230688716     gbest48.seq
 230689512     gbest49.seq
 163952500     gbest5.seq
 230691036     gbest50.seq
 230687716     gbest51.seq
 230691010     gbest52.seq
 230689626     gbest53.seq
 230688339     gbest54.seq
 230692127     gbest55.seq
 230690267     gbest56.seq
 230688381     gbest57.seq
 230687897     gbest58.seq
 230689043     gbest59.seq
 180635464     gbest6.seq
 230687631     gbest60.seq
 221532087     gbest61.seq
 209338065     gbest62.seq
 209073066     gbest63.seq
 208873096     gbest64.seq
 209319317     gbest65.seq
 210584555     gbest66.seq
 209266783     gbest67.seq
 208516869     gbest68.seq
 209879037     gbest69.seq
 230689902     gbest7.seq
 210031001     gbest70.seq
 205180581     gbest71.seq
 207564594     gbest72.seq
 207276007     gbest73.seq
 209187254     gbest74.seq
 219418677     gbest75.seq
 230691303     gbest76.seq
 230691549     gbest77.seq
 227237981     gbest78.seq
 216065983     gbest79.seq
 230687820     gbest8.seq
 214005105     gbest80.seq
 222023185     gbest81.seq
 230688082     gbest82.seq
 230690170     gbest83.seq
 230689187     gbest84.seq
 230687707     gbest85.seq
 230689453     gbest86.seq
 230688830     gbest87.seq
 230689245     gbest88.seq
 230687989     gbest89.seq
 230687947     gbest9.seq
 230690336     gbest90.seq
 230689460     gbest91.seq
 230690575     gbest92.seq
 230687956     gbest93.seq
 230687550     gbest94.seq
 230688280     gbest95.seq
 230687534     gbest96.seq
 230688727     gbest97.seq
 230688677     gbest98.seq
 230689020     gbest99.seq
  32547847     gbgen.idx
 209717613     gbgss1.seq
 209717427     gbgss10.seq
 250002442     gbgss100.seq
 250001006     gbgss101.seq
 194845721     gbgss102.seq
 209718082     gbgss11.seq
 209719430     gbgss12.seq
 209716048     gbgss13.seq
 209718327     gbgss14.seq
 209718140     gbgss15.seq
 209717043     gbgss16.seq
 209717166     gbgss17.seq
 209716611     gbgss18.seq
 209718006     gbgss19.seq
 209718258     gbgss2.seq
 209715997     gbgss20.seq
 209719196     gbgss21.seq
 209716318     gbgss22.seq
 209718495     gbgss23.seq
 209716830     gbgss24.seq
 209716050     gbgss25.seq
 209718333     gbgss26.seq
 209718570     gbgss27.seq
 209718368     gbgss28.seq
 209718256     gbgss29.seq
 209716753     gbgss3.seq
 209719110     gbgss30.seq
 209717581     gbgss31.seq
 209717278     gbgss32.seq
 209718320     gbgss33.seq
 209719013     gbgss34.seq
 209716113     gbgss35.seq
 209716058     gbgss36.seq
 209716264     gbgss37.seq
 209716859     gbgss38.seq
 209716316     gbgss39.seq
 209717988     gbgss4.seq
 209717781     gbgss40.seq
 209718269     gbgss41.seq
 209716367     gbgss42.seq
 209717482     gbgss43.seq
 209717226     gbgss44.seq
 209717452     gbgss45.seq
 209716793     gbgss46.seq
 209717486     gbgss47.seq
 209716074     gbgss48.seq
 209718148     gbgss49.seq
 209716920     gbgss5.seq
 209717978     gbgss50.seq
 209715954     gbgss51.seq
 209717448     gbgss52.seq
 209717026     gbgss53.seq
 209718057     gbgss54.seq
 209717836     gbgss55.seq
 209716831     gbgss56.seq
 209718739     gbgss57.seq
 209717218     gbgss58.seq
 209717346     gbgss59.seq
 209718309     gbgss6.seq
 209718740     gbgss60.seq
 209716110     gbgss61.seq
 209716908     gbgss62.seq
 209717765     gbgss63.seq
 209717840     gbgss64.seq
 209716756     gbgss65.seq
 208429601     gbgss66.seq
 209458665     gbgss67.seq
 209716630     gbgss68.seq
 209716605     gbgss69.seq
 209717024     gbgss7.seq
 209717764     gbgss70.seq
 209717105     gbgss71.seq
 209717504     gbgss72.seq
 209717240     gbgss73.seq
 209716792     gbgss74.seq
 209717126     gbgss75.seq
 209716974     gbgss76.seq
 209717811     gbgss77.seq
 209717758     gbgss78.seq
 209717627     gbgss79.seq
 209716751     gbgss8.seq
 209716751     gbgss80.seq
 209716637     gbgss81.seq
 209716232     gbgss82.seq
 209716076     gbgss83.seq
 209717572     gbgss84.seq
 209718594     gbgss85.seq
 209718609     gbgss86.seq
 209716035     gbgss87.seq
 190126067     gbgss88.seq
 178567556     gbgss89.seq
 209717197     gbgss9.seq
 186989876     gbgss90.seq
  60256107     gbgss91.seq
 250001820     gbgss92.seq
 250002122     gbgss93.seq
 250001214     gbgss94.seq
 250002016     gbgss95.seq
 250000886     gbgss96.seq
 250001159     gbgss97.seq
 250000794     gbgss98.seq
 250000880     gbgss99.seq
 250005905     gbhtc1.seq
 250002389     gbhtc2.seq
 235926494     gbhtc3.seq
 250170750     gbhtg1.seq
 250227747     gbhtg10.seq
 250282980     gbhtg11.seq
 250148463     gbhtg12.seq
 250313171     gbhtg13.seq
 250130901     gbhtg14.seq
 250070013     gbhtg15.seq
 250245566     gbhtg16.seq
 250044738     gbhtg17.seq
 250063398     gbhtg18.seq
 250202467     gbhtg19.seq
 250004941     gbhtg2.seq
 250235674     gbhtg20.seq
 250006985     gbhtg21.seq
 250103036     gbhtg22.seq
 250244547     gbhtg23.seq
 250095331     gbhtg24.seq
 250357776     gbhtg25.seq
 250318902     gbhtg26.seq
 250248862     gbhtg27.seq
 250450626     gbhtg28.seq
 250370782     gbhtg29.seq
 250257563     gbhtg3.seq
 250051194     gbhtg30.seq
 250336737     gbhtg31.seq
 250140252     gbhtg32.seq
 250071648     gbhtg33.seq
 250107364     gbhtg34.seq
 250117476     gbhtg35.seq
 250201595     gbhtg36.seq
 250162508     gbhtg37.seq
 250041668     gbhtg38.seq
 250104372     gbhtg39.seq
 250074405     gbhtg4.seq
 250091650     gbhtg40.seq
 250168284     gbhtg41.seq
 250032079     gbhtg42.seq
 250328473     gbhtg43.seq
 250285241     gbhtg44.seq
 250165641     gbhtg45.seq
 250303646     gbhtg46.seq
 250051168     gbhtg47.seq
 250207927     gbhtg48.seq
 250103909     gbhtg49.seq
 250001140     gbhtg5.seq
 250170368     gbhtg50.seq
 250171071     gbhtg51.seq
 250016580     gbhtg52.seq
 250107520     gbhtg53.seq
 250088261     gbhtg54.seq
 250145838     gbhtg55.seq
 250216463     gbhtg56.seq
 250058813     gbhtg57.seq
 250084694     gbhtg58.seq
 250044110     gbhtg59.seq
 250147212     gbhtg6.seq
 250005934     gbhtg60.seq
 250090225     gbhtg61.seq
  72506619     gbhtg62.seq
 250134457     gbhtg7.seq
 250062291     gbhtg8.seq
 250222100     gbhtg9.seq
 250062171     gbinv1.seq
 250437298     gbinv2.seq
 250001646     gbinv3.seq
 250000672     gbinv4.seq
 250178816     gbinv5.seq
  92550636     gbinv6.seq
 751647733     gbjou.idx
 668931437     gbkey.idx
 189361771     gbmam.seq
  39963593     gbnew.txt
 250003065     gbpat1.seq
  29113031     gbpat10.seq
 250000233     gbpat2.seq
 250000608     gbpat3.seq
 250001575     gbpat4.seq
 250000260     gbpat5.seq
 250006192     gbpat6.seq
 250001503     gbpat7.seq
 250001478     gbpat8.seq
 250000458     gbpat9.seq
  27234850     gbphg.seq
 250134975     gbpln1.seq
 250000981     gbpln2.seq
 250000007     gbpln3.seq
 250006991     gbpln4.seq
 250034971     gbpln5.seq
 250001809     gbpln6.seq
 250002159     gbpln7.seq
 250130783     gbpln8.seq
 232266877     gbpln9.seq
 250129389     gbpri1.seq
 250081465     gbpri10.seq
 250004157     gbpri11.seq
 250024234     gbpri12.seq
 250152690     gbpri13.seq
 250003501     gbpri14.seq
 250000006     gbpri15.seq
 250038839     gbpri16.seq
 250166784     gbpri17.seq
 250077228     gbpri18.seq
 250154777     gbpri19.seq
 250192244     gbpri2.seq
 250038717     gbpri20.seq
 250001155     gbpri21.seq
 250115103     gbpri22.seq
 250001263     gbpri23.seq
 250001117     gbpri24.seq
 250001716     gbpri25.seq
 204752491     gbpri26.seq
 250004862     gbpri3.seq
 250076859     gbpri4.seq
 250151822     gbpri5.seq
 250205982     gbpri6.seq
 250066748     gbpri7.seq
 250136205     gbpri8.seq
 250179766     gbpri9.seq
    165723     gbrel.txt
 250161579     gbrod1.seq
  54764704     gbrod10.seq
 250023006     gbrod2.seq
 250001753     gbrod3.seq
 250012585     gbrod4.seq
 250185561     gbrod5.seq
 250082122     gbrod6.seq
 250194290     gbrod7.seq
 250000176     gbrod8.seq
 250000389     gbrod9.seq
2385586594     gbsdr.txt
   1504519     gbsec.idx
 250000148     gbsts1.seq
 250001906     gbsts2.seq
 215955402     gbsts3.seq
  47756860     gbsyn.seq
   2392689     gbuna.seq
 250000589     gbvrl1.seq
 250000498     gbvrl2.seq
 190883146     gbvrl3.seq
 250032854     gbvrt1.seq
 250000507     gbvrt2.seq
 250000319     gbvrt3.seq
  17207685     gbvrt4.seq

2.2.6 Per-Division Statistics 

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each sequence
data file:

Division     Entries    Bases

BCT1         23834      100240531
BCT2         8121       106983411
BCT3         25125      104249793
BCT4         46636      92367228
BCT5         21430      108606633
BCT6         32106      93809510
BCT7         35956      92161609
BCT8         17570      27059854
EST1         68591      26476165
EST10        76943      29967096
EST100       70223      30968090
EST101       66692      31723984
EST102       66462      39178196
EST103       70601      37265642
EST104       70355      45868745
EST105       76548      34768137
EST106       74701      27808962
EST107       75891      26035517
EST108       73836      40366072
EST109       64305      32803555
EST11        76438      29001689
EST110       79361      48083150
EST111       79732      45400791
EST112       72814      45615701
EST113       69171      42931048
EST114       73541      47411646
EST115       68252      45369930
EST116       74052      44040710
EST117       76541      44771086
EST118       72900      49154128
EST119       76041      47940914
EST12        77121      30822961
EST120       73672      47797713
EST121       78775      36396661
EST122       78671      27566462
EST123       80844      49872548
EST124       75129      43048618
EST125       65475      36236112
EST126       72813      36816257
EST127       66527      36936649
EST128       67236      36759849
EST129       70815      43459237
EST13        77801      29972711
EST130       73174      43426742
EST131       68688      41584557
EST132       68090      40648797
EST133       76748      44603187
EST134       69512      42349764
EST135       60265      33962105
EST136       98556      53629018
EST137       83150      47739564
EST138       88706      46027476
EST139       108741     57679012
EST14        79914      32040354
EST140       105385     57213139
EST141       98447      56134077
EST142       78860      47452358
EST143       69222      35046759
EST144       64198      29168008
EST145       55682      25437181
EST146       63964      31061064
EST147       61142      31226944
EST148       66420      35308090
EST149       73783      52416383
EST15        73071      30958585
EST150       64952      44185702
EST151       83442      49447671
EST152       58618      29845011
EST153       62776      31936160
EST154       67563      40631456
EST155       65777      38135879
EST156       63313      42371145
EST157       89664      49029637
EST158       76830      39054145
EST159       67496      45482835
EST16        75643      33227181
EST160       67918      38789638
EST161       62650      42218067
EST162       67574      31785664
EST163       75690      28944830
EST164       71795      45799981
EST165       84018      42021268
EST166       63192      32361012
EST167       68741      46680567
EST168       69631      49024362
EST169       69771      37210498
EST17        84145      34425496
EST170       67316      42824161
EST171       71362      57059376
EST172       68249      32650159
EST173       73326      40038875
EST174       69866      59219024
EST175       67088      51117355
EST176       64239      46768098
EST177       63808      47224354
EST178       65587      46226739
EST179       64915      45355545
EST18        80469      32524212
EST180       64224      49192801
EST181       63599      39741735
EST182       63352      33252913
EST183       63702      37174482
EST184       86552      48849491
EST185       84086      55024977
EST186       74200      43644080
EST187       106349     66503715
EST188       108694     65358182
EST189       102756     61893578
EST19        81187      33754482
EST190       69564      37655769
EST191       69476      61012144
EST192       67589      69096888
EST193       76312      54721345
EST194       80499      39447342
EST195       27430      10135676
EST196       27879      10606409
EST197       27314      10127105
EST198       26589      9693915
EST199       26733      9055166
EST2         75366      28937064
EST20        72882      29242286
EST200       27606      10060452
EST201       27261      9842488
EST202       27285      9866155
EST203       27320      10886567
EST204       27205      11856731
EST205       27286      11095046
EST206       27472      9819078
EST207       27625      9162981
EST208       27020      9846191
EST209       27937      11153690
EST21        73033      34027261
EST210       27678      11053684
EST211       26888      11354914
EST212       26798      12150685
EST213       27162      11036188
EST214       27088      10978565
EST215       27094      11942944
EST216       27252      11483193
EST217       27331      10809920
EST218       27318      10915020
EST219       27192      10389134
EST22        77166      30710392
EST220       26821      12751818
EST221       24533      17165143
EST222       26071      17523398
EST223       99722      38850619
EST224       78954      42465468
EST225       69504      45170171
EST226       70253      45181449
EST227       69983      45014794
EST228       69413      40760011
EST229       77072      44845222
EST23        77121      32028893
EST230       63742      42609840
EST231       62845      29468750
EST232       93813      46177397
EST233       95658      46901853
EST234       72030      40345801
EST235       62117      29490614
EST236       70575      41686447
EST237       72371      39456436
EST238       72375      33628666
EST239       70840      41211650
EST24        75848      34411368
EST240       72585      42059325
EST241       63199      37368810
EST242       72247      34836159
EST243       87925      48357109
EST244       77940      53093947
EST245       80452      55718058
EST246       108153     49972580
EST247       89186      44811836
EST248       74811      45058718
EST249       73797      41344990
EST25        72913      30998671
EST250       74975      39038638
EST251       72268      30402965
EST252       71474      39401353
EST253       65733      35774535
EST254       65163      42923295
EST255       73613      42356701
EST256       62336      44713602
EST257       62158      32092372
EST258       72402      39219256
EST259       79945      44062858
EST26        76389      31420360
EST260       99229      56544129
EST261       118790     49019885
EST262       90808      40604628
EST263       65180      35516244
EST264       71021      43469468
EST265       85454      44212526
EST266       70775      41399612
EST267       69420      43775984
EST268       61450      35285089
EST269       61309      38155573
EST27        79056      34943866
EST270       52817      30677336
EST271       91105      40369538
EST272       78452      26268578
EST273       72016      25885018
EST274       73963      27273067
EST275       73404      26563712
EST276       79376      26696027
EST277       73300      28494976
EST278       69546      28465557
EST279       18243      5432479
EST28        105245     50047261
EST29        66191      50965085
EST3         74216      30129457
EST30        74496      61790162
EST31        91433      51655420
EST32        95666      49319300
EST33        99331      47377892
EST34        97150      49379541
EST35        105947     47938727
EST36        75848      25707357
EST37        69422      18504255
EST38        79486      22937112
EST39        43825      12290507
EST4         74634      28188929
EST40        43503      11811811
EST41        43154      12076035
EST42        43184      11282205
EST43        94920      41756226
EST44        94245      43606041
EST45        92147      48072597
EST46        89067      42436535
EST47        107085     56430312
EST48        85121      40323190
EST49        72859      30595072
EST5         48531      15367417
EST50        72551      32280962
EST51        73051      31598928
EST52        73340      30950059
EST53        82984      32257102
EST54        69191      27344359
EST55        65429      29709966
EST56        72993      31432843
EST57        80176      36043939
EST58        74099      31856563
EST59        74334      26564480
EST6         56373      18277335
EST60        85515      37416887
EST61        56726      21292250
EST62        40219      11101182
EST63        40211      12009322
EST64        40501      12619138
EST65        40687      12093638
EST66        40557      12937485
EST67        40629      12703997
EST68        40526      12270777
EST69        40223      12244901
EST7         74713      29418829
EST70        40598      12575588
EST71        41559      12007330
EST72        41183      12889257
EST73        41155      12775842
EST74        41110      13405516
EST75        45223      11990780
EST76        41352      23870454
EST77        41864      22833516
EST78        45122      18566686
EST79        50167      22868262
EST8         76836      30881470
EST80        51582      21525745
EST81        56333      22824306
EST82        75220      31439857
EST83        74088      29225462
EST84        73228      32599503
EST85        78561      47382432
EST86        77081      41186426
EST87        77681      39332844
EST88        76432      40293920
EST89        72090      40042679
EST9         77956      30114966
EST90        73931      31977989
EST91        75542      43403932
EST92        70952      33281833
EST93        77777      49750953
EST94        64583      34637231
EST95        72154      37122921
EST96        74782      44700836
EST97        72646      43452887
EST98        71098      43567520
EST99        74613      38694542
GSS1         83028      35574490
GSS10        66512      34113837
GSS100       61841      58810865
GSS101       100065     57022153
GSS102       80920      37454559
GSS11        68803      40572229
GSS12        63838      32399919
GSS13        65715      34626602
GSS14        69128      36041025
GSS15        65610      29728609
GSS16        64381      29707473
GSS17        71588      41736486
GSS18        65473      33884926
GSS19        60217      27409460
GSS2         83357      35485809
GSS20        52071      27205036
GSS21        52494      26091928
GSS22        53636      23124055
GSS23        57756      33014250
GSS24        58746      30700422
GSS25        52919      24951821
GSS26        60178      39440553
GSS27        64517      27492099
GSS28        54009      22077969
GSS29        55059      27417855
GSS3         81042      38189636
GSS30        66990      31525793
GSS31        55059      31150169
GSS32        84961      38631816
GSS33        69956      36831370
GSS34        68173      38436353
GSS35        64758      42071759
GSS36        72942      35824489
GSS37        69887      36963155
GSS38        67388      37000761
GSS39        84621      53438521
GSS4         74233      38025921
GSS40        85787      56979839
GSS41        80581      41952655
GSS42        85564      53319643
GSS43        76664      33212875
GSS44        77844      32328372
GSS45        74968      44033376
GSS46        73920      52030110
GSS47        69755      49230313
GSS48        66172      43723465
GSS49        66219      43632392
GSS5         71113      38010979
GSS50        71979      40613194
GSS51        71090      35767780
GSS52        79294      55233207
GSS53        82645      60824395
GSS54        72507      50428813
GSS55        86005      52711928
GSS56        80912      51704502
GSS57        74165      47364182
GSS58        66645      34653999
GSS59        78607      52745933
GSS6         70760      35519722
GSS60        77391      38435360
GSS61        77331      49682512
GSS62        68424      67484360
GSS63        65562      71979942
GSS64        80879      61878130
GSS65        82018      55250360
GSS66        58092      40306549
GSS67        58999      40642439
GSS68        77530      57423461
GSS69        81490      60354233
GSS7         70854      35527088
GSS70        74347      43714255
GSS71        80196      49559834
GSS72        80860      56718954
GSS73        90509      51227471
GSS74        91825      49623175
GSS75        91773      49689142
GSS76        92444      48842476
GSS77        93609      47371280
GSS78        93160      47937727
GSS79        93079      48041201
GSS8         71428      36503785
GSS80        93953      46935289
GSS81        92059      49327432
GSS82        85826      56740674
GSS83        81672      64337476
GSS84        81560      64135755
GSS85        80120      63492644
GSS86        80084      63538722
GSS87        80227      55733184
GSS88        78123      28803966
GSS89        74059      23141498
GSS9         68930      34313855
GSS90        77388      26922434
GSS91        23531      13148642
GSS92        87880      66457089
GSS93        84727      63659853
GSS94        95381      40023382
GSS95        102880     60441149
GSS96        89634      49401308
GSS97        82224      65139169
GSS98        69685      58516563
GSS99        68711      60641554
HTC1         31801      54897473
HTC2         30889      66883801
HTC3         85721      76847961
HTG1         1329       190660442
HTG10        1235       189466584
HTG11        1425       187363721
HTG12        968        192249954
HTG13        756        192612597
HTG14        738        192541180
HTG15        763        192401251
HTG16        809        192361843
HTG17        776        192452593
HTG18        1513       185204292
HTG19        1535       184669304
HTG2         2531       188221931
HTG20        901        191425370
HTG21        1240       188470925
HTG22        815        191910582
HTG23        834        192016285
HTG24        964        191093640
HTG25        910        191660498
HTG26        871        191713487
HTG27        773        192475999
HTG28        912        191794670
HTG29        838        192187003
HTG3         2509       188169504
HTG30        891        191627015
HTG31        1012       190868450
HTG32        956        191044610
HTG33        957        191280827
HTG34        996        190770856
HTG35        903        191560656
HTG36        897        192244692
HTG37        1020       190899430
HTG38        888        191941418
HTG39        890        191877603
HTG4         2539       189837718
HTG40        875        191776558
HTG41        830        192254947
HTG42        968        190842073
HTG43        954        191786236
HTG44        903        192475030
HTG45        991        191312431
HTG46        1020       191403827
HTG47        1180       189680349
HTG48        1090       190791193
HTG49        1318       190314649
HTG5         1290       188275977
HTG50        1105       191259180
HTG51        1147       190525226
HTG52        1107       190580247
HTG53        1145       191561966
HTG54        1317       191741654
HTG55        1221       191624847
HTG56        1155       192592589
HTG57        1117       190970364
HTG58        1285       194252194
HTG59        1036       194217554
HTG6         1290       187953177
HTG60        1004       194176917
HTG61        1140       193212872
HTG62        255        51561401
HTG7         1254       188198803
HTG8         1293       187650749
HTG9         1206       189533694
INV1         10889      172103506
INV2         1286       166677598
INV3         59208      91132314
INV4         71721      77420942
INV5         30655      114011262
INV6         13165      42319498
MAM          52858      69555197
PAT1         223033     70276651
PAT10        30068      7263856
PAT2         200727     87214777
PAT3         148827     84241055
PAT4         110694     116533566
PAT5         139036     96531037
PAT6         137472     94940329
PAT7         124566     50089950
PAT8         96377      62994577
PAT9         134594     54520117
PHG          2396       10574224
PLN1         23764      135362169
PLN2         32729      137505783
PLN3         78178      77101144
PLN4         36914      56079507
PLN5         8040       155230519
PLN6         39185      102685961
PLN7         64445      67281205
PLN8         48721      108917532
PLN9         36951      101909604
PRI1         15776      153433964
PRI10        1399       175632954
PRI11        1278       175510053
PRI12        1507       175071532
PRI13        1584       179057169
PRI14        10234      169667937
PRI15        43719      117726791
PRI16        23615      138027547
PRI17        1583       179572712
PRI18        1697       181338167
PRI19        2085       185026393
PRI2         1420       173198087
PRI20        1765       187070465
PRI21        23744      146531248
PRI22        25860      106528361
PRI23        13799      166993878
PRI24        44591      124483047
PRI25        28534      137059558
PRI26        50142      79529642
PRI3         1255       181788440
PRI4         1291       178124339
PRI5         1143       173840648
PRI6         1208       179109034
PRI7         1209       177089069
PRI8         1330       169136454
PRI9         1229       177840530
ROD1         7273       173276688
ROD10        14295      19271142
ROD2         949        182750560
ROD3         1066       194772477
ROD4         2154       191580132
ROD5         24143      153607807
ROD6         1204       193398194
ROD7         1226       193526699
ROD8         23511      133495237
ROD9         39779      110977704
STS1         88823      48189134
STS2         88958      36508545
STS3         79622      35639580
SYN          10988      18013443
UNA          1093       394596
VRL1         73548      64340236
VRL2         73850      65882463
VRL3         56340      51878617
VRT1         62440      90835179
VRT2         28376      146960174
VRT3         26125      143635173
VRT4         4403       6082201

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 138.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries       Bases   Species

7075054 10239192958   Homo sapiens
5344321  6189695407   Mus musculus
830778   5547230845   Rattus norvegicus
538419   1132230268   Danio rerio
1641207  1037066814   Zea mays
262961    706000609   Oryza sativa (japonica cultivar-group)
352065    691638232   Drosophila melanogaster
886487    506457520   Canis familiaris
596781    498676554   Gallus gallus
567663    418408434   Arabidopsis thaliana
595960    403828841   Brassica oleracea
631103    385515243   Bos taurus
167559    339928663   Pan troglodytes
22384     334036966   Macaca mulatta
499250    294214386   Ciona intestinalis
504869    257384462   Triticum aestivum
222572    232991007   Caenorhabditis elegans
350937    222083076   Xenopus laevis
192732    184554301   Medicago truncatula
189227    170881307   Tetraodon nigroviridis

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the 562 files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 April 2003

                NCBI-GenBank Flat File Release 138.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 138.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark, Irene Fang,
	Linda Frisse, Michael Fetchko, Anjanette Johnston, William Klimke,
	Pierre Ledoux, Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis,
	Chris O'Sullivan, Leigh Riley, Gert Roosen, MJ Rosovitz, Susan Schafer,
	Suh-suh Wang, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Anton Butanaev, Mark Cavanaugh,
	Hsiu-Chuan Chen, Olga Cherenkov, Jonathan Kans, Michael Kimelman,
	Jim Ostell, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Carolyn Tolstoshev, Jane Weisemann,
	Eugene Yaschenko

Database Administration
	Ron Chen, Slava Khotomliansky, Tony Stearman

User Support
	Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
	Renata Geer, Scott McGinnis, Donna Messersmith, Rana Morris, Vyvy Pham,
	Monica Romiti, Eric Sayers, Tao Tao, David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center