Release Notes For GenBank Release 140

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2004

               NCBI-GenBank Flat File Release 140.0

                    Distribution Release Notes

 32549400 loci, 37893844733 bases, from 32549400 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 140.0
1.2 Cutoff Date
1.3 Important Changes in Release 140.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 140.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 140.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server: ftp.ncbi.nih.gov .

1.2 Cutoff Date

  This full release, 140.0, incorporates data available to the collaborating
databases as of February 20, 2004 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

    Mirrors of the GenBank FTP site at the NCBI are available from the San Diego
    Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

    Some users who experience slow FTP transfers of large files might realize
    an improvement in transfer rates from these alternate sites when traffic at
    the NCBI is high.

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 140.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 20 with this release:

  - the EST division is now comprised of 296 files (+8)
  - the GSS division is now comprised of 102 files (+4)
  - the HTC division is now comprised of 4   files (+1)
  - the HTG division is now comprised of 62  files (+1)
  - the PAT division is now comprised of 15  files (+4)
  - the VRL division is now comprised of 4   files (+1)
  - the VRT division is now comprised of 5   files (+1)

1.3.2 Filename change : genpept.fsa

  A companion file is made available with every GenBank Release that contains
all of the protein sequences for the coding regions annotated on GenBank
records, in FASTA format. The name of this file has been changed from:

	ftp://ftp.ncbi.nih.gov/genbank/genpept.fsa.gz
to:
	ftp://ftp.ncbi.nih.gov/genbank/rel140.fsa_aa.gz

  The term 'GenPept' had been used for purely historical reasons. In fact, 
GenPept is the name of a (non-FASTA) flatfile format for protein sequences,
one that closely parallels the GenBank flatfile format for DNA sequences.

  With this rename, there will be less confusion about the contents of
the file.

1.3.3 WGS Statistics

  Although the Whole Genome Shotgun sequence data are not formally a part
of GenBank Release distributions :

        ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs (ASN.1 files)
        ftp://ftp.ncbi.nih.gov/genbank/wgs   (GenBank flatfiles)

WGS sequences are a fast-growing component of the GenBank database. So as of
this release, we are providing a table of WGS growth statistics in Section
2.2.8 of the release notes. The first WGS project was processed at GenBank
in April of 2002, so the table starts with Release 129.0 .

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in one of two different systems,
depending on their origin. One recent change to release processing involves
the parallelization of the dumps from those systems. Because the second dump
(for example) has no prior knowledge of exactly how many GSS files will be
dumped from the first, it doesn't know how to number it's own output files.

  There is thus a discrepancy between the filenames and file headers of twelve
GSS flatfiles in Release 140.0. Consider the gbgss91.seq file:

GBGSS1.SEQ           Genetic Sequence Data Bank
                          February 15 2004

                NCBI-GenBank Flat File Release 140.0

                           GSS Sequences (Part 1)

   88249 loci,    65634155 bases, from    88249 reported sequences


  Here, the filename and part number in the header is "1", though the file
has been renamed as "91" based on the files dumped from the other system.

  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 **Sequence Length Limitation To Be Removed In June 2004**

  At the May 2003 collaborative meeting among representatives of GenBank,
EMBL, and DDBJ, it was decided that the 350 kilobase limit on the sequence
length of database records will be removed as of June 2004.

  Individual, complete sequences are currently expected to be a maximum
of 350 kbp in length. One major reason for the existence of this limit is
as an aid to users of sequence analysis software, some of which might not
be capable of processing megabase-scale sequences.

  However, very significant exceptions to the 350 kbp limit have existed
for several years; Phase 1 (unordered, unoriented) and Phase 2 (ordered,
oriented) high-throughput genomic sequences (HTGS) generated by efforts
such as the Human Genome Project; large dispersed eukaryotic genes with
an intron/exon structure that spans more than 350 kbp; and sequences
which result from assemblies of Whole Genome Shotgun (WGS) project data.

  Given these exceptions, and the technological advances which have made
large-scale sequencing practical for an increasing number of researchers,
the collaboration has decided that the 350 kbp limit must be removed.

  As of June 2004, the length of database sequences will be limited only
by the natural structures of an organism's genome. For example, a single
record might be used to represent all of human chromosome 1, which is
approximately 245 Mbp in length.

  Software developers for some of the larger commercial sequence analysis
packages were recently asked what timeframe would be appropriate for this
change. Answers ranged from "immediately", to "several months", to "one year".
So the one-year timeframe was selected, to provide ample time to implement
changes which megabase-scale sequences may require.

  Some sample records with very large sequences have been made available
so that developers can begin to test their software modifications:

	ftp://ftp.ncbi.nih.gov/genbank/LargeSeqs

  Many changes are expected after the removal of the length limit. For 
example, complete bacterial genomes (typically on the order of several
megabases) will be re-assembled into single sequence records. The submission
process for such genomes will become much more streamlined, since database
staff will no longer have to split the genomes into pieces. BLAST services
will be enchanced, so that hits reported within very large sequences will
be presented in a meaningful context.

  All such changes will be discussed more fully in future release notes,
the NCBI newsletter, and the GenBank newsgroup.

1.4.2 Rename of File 'Last.Release' and Deletion of /daily Subdirectories

The files named Last.Release which are located at:

	ftp://ftp.ncbi.nih.gov/genbank/daily/Last.Release
	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily/Last.Release

contain the number of the GenBank release which is currently installed
on the NCBI FTP site. As of Release 142.0 in June 2004, these files will
be moved and renamed as:

	ftp://ftp.ncbi.nih.gov/genbank/GB_Release_Number
	ftp://ftp.ncbi.nih.gov/ncbi-asn1/GB_Release_Number

The /daily subdirectories, which had been used for cumulative update
products that are no longer supported, will be deleted at that time.


1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

  The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 591 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

1.  gbrel.txt	- Release notes (this document).
2.  gbsdr.txt 	- Short directory of the data bank.
3.  gbacc.idx 	- Index of the entries according to accession number.
4.  gbkey.idx 	- Index of the entries according to keyword phrase.
5.  gbaut1.idx 	- Index of the entries according to author, part 1.
6.  gbaut2.idx 	- Index of the entries according to author, part 2.
7.  gbaut3.idx 	- Index of the entries according to author, part 3.
8.  gbaut4.idx 	- Index of the entries according to author, part 4.
9.  gbaut5.idx 	- Index of the entries according to author, part 5.
10. gbaut6.idx 	- Index of the entries according to author, part 6.
11. gbaut7.idx 	- Index of the entries according to author, part 7.
12. gbaut8.idx 	- Index of the entries according to author, part 8.
13. gbaut9.idx 	- Index of the entries according to author, part 9.
14. gbaut10.idx - Index of the entries according to author, part 10.
15. gbaut11.idx - Index of the entries according to author, part 11.
16. gbaut12.idx - Index of the entries according to author, part 12.
17. gbaut13.idx - Index of the entries according to author, part 13.
18. gbaut14.idx - Index of the entries according to author, part 14.
19. gbaut15.idx - Index of the entries according to author, part 15.
20. gbaut16.idx - Index of the entries according to author, part 16.
21. gbaut17.idx - Index of the entries according to author, part 17.
22. gbaut18.idx - Index of the entries according to author, part 18.
23. gbaut19.idx - Index of the entries according to author, part 19.
24. gbaut20.idx - Index of the entries according to author, part 20.
25. gbaut21.idx - Index of the entries according to author, part 21.
26. gbaut22.idx - Index of the entries according to author, part 22.
27. gbaut23.idx - Index of the entries according to author, part 23.
28. gbjou.idx 	- Index of the entries according to journal citation.
29. gbgen.idx 	- Index of the entries according to gene names.
30. gbsec.idx	- Index of the entries according to secondary accession number.
31. gbpri1.seq 	- Primate sequence entries, part 1.
32. gbpri2.seq 	- Primate sequence entries, part 2.
33. gbpri3.seq 	- Primate sequence entries, part 3.
34. gbpri4.seq 	- Primate sequence entries, part 4.
35. gbpri5.seq 	- Primate sequence entries, part 5.
36. gbpri6.seq 	- Primate sequence entries, part 6.
37. gbpri7.seq 	- Primate sequence entries, part 7.
38. gbpri8.seq 	- Primate sequence entries, part 8.
39. gbpri9.seq 	- Primate sequence entries, part 9.
40. gbpri10.seq	- Primate sequence entries, part 10.
41. gbpri11.seq	- Primate sequence entries, part 11.
42. gbpri12.seq	- Primate sequence entries, part 12.
43. gbpri13.seq	- Primate sequence entries, part 13.
44. gbpri14.seq	- Primate sequence entries, part 14.
45. gbpri15.seq	- Primate sequence entries, part 15.
46. gbpri16.seq	- Primate sequence entries, part 16.
47. gbpri17.seq	- Primate sequence entries, part 17.
48. gbpri18.seq	- Primate sequence entries, part 18.
49. gbpri19.seq	- Primate sequence entries, part 19.
50. gbpri20.seq	- Primate sequence entries, part 20.
51. gbpri21.seq	- Primate sequence entries, part 21.
52. gbpri22.seq	- Primate sequence entries, part 22.
53. gbpri23.seq	- Primate sequence entries, part 23.
54. gbpri24.seq	- Primate sequence entries, part 24.
55. gbpri25.seq	- Primate sequence entries, part 25.
56. gbpri26.seq	- Primate sequence entries, part 26.
57. gbpri27.seq	- Primate sequence entries, part 27.
58. gbrod1.seq 	- Rodent sequence entries, part 1.
59. gbrod2.seq 	- Rodent sequence entries, part 2.
60. gbrod3.seq 	- Rodent sequence entries, part 3.
61. gbrod4.seq 	- Rodent sequence entries, part 4.
62. gbrod5.seq 	- Rodent sequence entries, part 5.
63. gbrod6.seq 	- Rodent sequence entries, part 6.
64. gbrod7.seq 	- Rodent sequence entries, part 7.
65. gbrod8.seq 	- Rodent sequence entries, part 8.
66. gbrod9.seq 	- Rodent sequence entries, part 9.
67. gbrod10.seq - Rodent sequence entries, part 10.
68. gbrod11.seq - Rodent sequence entries, part 11.
69. gbmam.seq 	- Other mammalian sequence entries.
70. gbvrt1.seq 	- Other vertebrate sequence entries, part 1.
71. gbvrt2.seq 	- Other vertebrate sequence entries, part 2.
72. gbvrt3.seq 	- Other vertebrate sequence entries, part 3.
73. gbvrt4.seq 	- Other vertebrate sequence entries, part 4.
74. gbvrt5.seq 	- Other vertebrate sequence entries, part 5.
75. gbinv1.seq 	- Invertebrate sequence entries, part 1.
76. gbinv2.seq 	- Invertebrate sequence entries, part 2.
77. gbinv3.seq 	- Invertebrate sequence entries, part 3.
78. gbinv4.seq 	- Invertebrate sequence entries, part 4.
79. gbinv5.seq 	- Invertebrate sequence entries, part 5.
80. gbinv6.seq 	- Invertebrate sequence entries, part 6.
81. gbpln1.seq 	- Plant sequence entries (including fungi and algae), part 1.
82. gbpln2.seq 	- Plant sequence entries (including fungi and algae), part 2.
83. gbpln3.seq 	- Plant sequence entries (including fungi and algae), part 3.
84. gbpln4.seq 	- Plant sequence entries (including fungi and algae), part 4.
85. gbpln5.seq 	- Plant sequence entries (including fungi and algae), part 5.
86. gbpln6.seq 	- Plant sequence entries (including fungi and algae), part 6.
87. gbpln7.seq 	- Plant sequence entries (including fungi and algae), part 7.
88. gbpln8.seq 	- Plant sequence entries (including fungi and algae), part 8.
89. gbpln9.seq 	- Plant sequence entries (including fungi and algae), part 9.
90. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
91. gbbct1.seq 	- Bacterial sequence entries, part 1.
92. gbbct2.seq 	- Bacterial sequence entries, part 2.
93. gbbct3.seq 	- Bacterial sequence entries, part 3.
94. gbbct4.seq 	- Bacterial sequence entries, part 4.
95. gbbct5.seq 	- Bacterial sequence entries, part 5.
96. gbbct6.seq 	- Bacterial sequence entries, part 6.
97. gbbct7.seq 	- Bacterial sequence entries, part 7.
98. gbbct8.seq 	- Bacterial sequence entries, part 8.
99. gbvrl1.seq 	- Viral sequence entries, part 1.
100. gbvrl2.seq 	- Viral sequence entries, part 2.
101. gbvrl3.seq 	- Viral sequence entries, part 3.
102. gbvrl4.seq 	- Viral sequence entries, part 4.
103. gbphg.seq 	- Phage sequence entries.
104. gbsyn.seq 	- Synthetic and chimeric sequence entries.
105. gbuna.seq 	- Unannotated sequence entries.
106. gbest1.seq  - EST (expressed sequence tag) sequence entries, part 1.
107. gbest2.seq  - EST (expressed sequence tag) sequence entries, part 2.
108. gbest3.seq  - EST (expressed sequence tag) sequence entries, part 3.
109. gbest4.seq  - EST (expressed sequence tag) sequence entries, part 4.
110. gbest5.seq  - EST (expressed sequence tag) sequence entries, part 5.
111. gbest6.seq  - EST (expressed sequence tag) sequence entries, part 6.
112. gbest7.seq  - EST (expressed sequence tag) sequence entries, part 7.
113. gbest8.seq  - EST (expressed sequence tag) sequence entries, part 8.
114. gbest9.seq  - EST (expressed sequence tag) sequence entries, part 9.
115. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
116. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
117. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
118. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
119. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
120. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
121. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
122. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
123. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
124. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
125. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
126. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
127. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
128. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
129. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
130. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
131. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
132. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
133. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
134. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
135. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
136. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
137. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
138. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
139. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
140. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
141. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
142. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
143. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
144. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
145. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
146. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
147. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
148. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
149. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
150. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
151. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
152. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
153. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
154. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
155. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
156. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
157. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
158. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
159. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
160. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
161. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
162. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
163. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
164. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
165. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
166. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
167. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
168. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
169. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
170. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
171. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
172. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
173. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
174. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
175. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
176. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
177. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
178. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
179. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
180. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
181. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
182. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
183. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
184. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
185. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
186. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
187. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
188. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
189. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
190. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
191. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
192. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
193. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
194. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89
195. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
196. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
197. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
198. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
199. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
200. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
201. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
202. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
203. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
204. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
205. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
206. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
207. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
208. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
209. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
210. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
211. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
212. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
213. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
214. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
215. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
216. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
217. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
218. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
219. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
220. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
221. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
222. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
223. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
224. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
225. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
226. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
227. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
228. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
229. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
230. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
231. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
232. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
233. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
234. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
235. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
236. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
237. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
238. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
239. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
240. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
241. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
242. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
243. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
244. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
245. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
246. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
247. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
248. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
249. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
250. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
251. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
252. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
253. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
254. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
255. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
256. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
257. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
258. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
259. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
260. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
261. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
262. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
263. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
264. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
265. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
266. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
267. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
268. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
269. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
270. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
271. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
272. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
273. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
274. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
275. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
276. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
277. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
278. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
279. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
280. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
281. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
282. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
283. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
284. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
285. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
286. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
287. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
288. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
289. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
290. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
291. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
292. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
293. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
294. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
295. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
296. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
297. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
298. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
299. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
300. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
301. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
302. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
303. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
304. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
305. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
306. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
307. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
308. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
309. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
310. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
311. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
312. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
313. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
314. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
315. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
316. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
317. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
318. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
319. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
320. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
321. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
322. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
323. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
324. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
325. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
326. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
327. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
328. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
329. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
330. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
331. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
332. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
333. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
334. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
335. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
336. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
337. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
338. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
339. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
340. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
341. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
342. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
343. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
344. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
345. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
346. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
347. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
348. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
349. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
350. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
351. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
352. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
353. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
354. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
355. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
356. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
357. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
358. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
359. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
360. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
361. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
362. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
363. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
364. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
365. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
366. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
367. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
368. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
369. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
370. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
371. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
372. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
373. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
374. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
375. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
376. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
377. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
378. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
379. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
380. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
381. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
382. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
383. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
384. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
385. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
386. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
387. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
388. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
389. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
390. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
391. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
392. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
393. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
394. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
395. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
396. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
397. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
398. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
399. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
400. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
401. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
402. gbpat1.seq  - Patent sequence entries, part 1.
403. gbpat2.seq  - Patent sequence entries, part 2.
404. gbpat3.seq  - Patent sequence entries, part 3.
405. gbpat4.seq  - Patent sequence entries, part 4.
406. gbpat5.seq  - Patent sequence entries, part 5.
407. gbpat6.seq  - Patent sequence entries, part 6.
408. gbpat7.seq  - Patent sequence entries, part 7.
409. gbpat8.seq  - Patent sequence entries, part 8.
410. gbpat9.seq  - Patent sequence entries, part 9.
411. gbpat10.seq - Patent sequence entries, part 10.
412. gbpat11.seq - Patent sequence entries, part 11.
413. gbpat12.seq - Patent sequence entries, part 12.
414. gbpat13.seq - Patent sequence entries, part 13.
415. gbpat14.seq - Patent sequence entries, part 14.
416. gbpat15.seq - Patent sequence entries, part 15.
417. gbsts1.seq  - STS (sequence tagged site) sequence entries, part 1.
418. gbsts2.seq  - STS (sequence tagged site) sequence entries, part 2.
419. gbsts3.seq  - STS (sequence tagged site) sequence entries, part 3.
420. gbgss1.seq  - GSS (genome survey sequence) sequence entries, part 1.
421. gbgss2.seq  - GSS (genome survey sequence) sequence entries, part 2.
422. gbgss3.seq  - GSS (genome survey sequence) sequence entries, part 3.
423. gbgss4.seq  - GSS (genome survey sequence) sequence entries, part 4.
424. gbgss5.seq  - GSS (genome survey sequence) sequence entries, part 5.
425. gbgss6.seq  - GSS (genome survey sequence) sequence entries, part 6.
426. gbgss7.seq  - GSS (genome survey sequence) sequence entries, part 7.
427. gbgss8.seq  - GSS (genome survey sequence) sequence entries, part 8.
428. gbgss9.seq  - GSS (genome survey sequence) sequence entries, part 9.
429. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
430. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
431. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
432. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
433. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
434. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
435. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
436. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
437. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
438. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
439. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
440. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
441. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
442. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
443. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
444. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
445. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
446. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
447. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
448. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
449. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
450. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
451. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
452. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
453. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
454. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
455. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
456. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
457. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
458. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
459. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
460. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
461. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
462. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
463. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
464. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
465. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
466. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
467. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
468. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
469. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
470. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
471. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
472. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
473. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
474. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
475. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
476. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
477. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
478. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
479. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
480. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
481. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
482. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
483. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
484. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
485. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
486. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
487. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
488. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
489. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
490. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
491. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
492. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
493. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
494. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
495. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
496. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
497. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
498. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
499. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
500. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
501. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
502. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
503. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
504. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
505. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
506. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
507. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
508. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
509. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
510. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
511. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
512. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
513. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
514. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
515. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
516. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
517. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
518. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
519. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
520. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
521. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
522. gbhtg1.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 1.
523. gbhtg2.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 2.
524. gbhtg3.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 3.
525. gbhtg4.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 4.
526. gbhtg5.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 5.
527. gbhtg6.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 6.
528. gbhtg7.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 7.
529. gbhtg8.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 8.
530. gbhtg9.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 9.
531. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
532. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
533. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
534. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
535. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
536. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
537. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
538. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
539. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
540. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
541. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
542. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
543. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
544. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
545. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
546. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
547. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
548. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
549. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
550. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
551. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
552. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
553. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
554. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
555. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
556. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
557. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
558. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
559. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
560. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
561. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
562. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
563. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
564. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
565. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
566. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
567. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
568. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
569. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
570. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
571. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
572. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
573. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
574. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
575. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
576. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
577. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
578. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
579. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
580. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
581. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
582. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
583. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
584. gbhtc1.seq	 - HTC (high throughput cDNA sequencing) entries, part 1.
585. gbhtc2.seq	 - HTC (high throughput cDNA sequencing) entries, part 2.
586. gbhtc3.seq	 - HTC (high throughput cDNA sequencing) entries, part 3.
587. gbhtc4.seq	 - HTC (high throughput cDNA sequencing) entries, part 4.
588. gbcon.seq	 - CON division entries (see description below for details)
589. gbchg.txt   - Accession numbers of entries updated since the previous release.
590. gbdel.txt   - Accession numbers of entries deleted since the previous release.
591. gbnew.txt   - Accession numbers of entries new since the previous release.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the 
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

	ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 140.0 flatfiles require roughly 127 GB (sequence
files only) or 143 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1066737780     gbacc.idx
 502021216     gbaut1.idx
 514389719     gbaut10.idx
 506730394     gbaut11.idx
 501096832     gbaut12.idx
 531429666     gbaut13.idx
 512686769     gbaut14.idx
 500232745     gbaut15.idx
 504801361     gbaut16.idx
 549212134     gbaut17.idx
 515388650     gbaut18.idx
 502673285     gbaut19.idx
 500310746     gbaut2.idx
 500470239     gbaut20.idx
 500061560     gbaut21.idx
 506704699     gbaut22.idx
 367371921     gbaut23.idx
 502097659     gbaut3.idx
 503383773     gbaut4.idx
 500000852     gbaut5.idx
 501113495     gbaut6.idx
 501872729     gbaut7.idx
 508707733     gbaut8.idx
 501010225     gbaut9.idx
 250012231     gbbct1.seq
 250176198     gbbct2.seq
 250002483     gbbct3.seq
 250619790     gbbct4.seq
 250014133     gbbct5.seq
 250236332     gbbct6.seq
 250686704     gbbct7.seq
 226344212     gbbct8.seq
   1256984     gbchg.txt
     26066     gbdel.txt
 230690300     gbest1.seq
 230689356     gbest10.seq
 230689198     gbest100.seq
 230690498     gbest101.seq
 230689712     gbest102.seq
 230689809     gbest103.seq
 230689189     gbest104.seq
 230689818     gbest105.seq
 230688530     gbest106.seq
 230473045     gbest107.seq
 230689116     gbest108.seq
 230689934     gbest109.seq
 230688611     gbest11.seq
 230687838     gbest110.seq
 230687706     gbest111.seq
 230687642     gbest112.seq
 230690131     gbest113.seq
 230689504     gbest114.seq
 230690622     gbest115.seq
 230690090     gbest116.seq
 230688227     gbest117.seq
 230689741     gbest118.seq
 230690276     gbest119.seq
 230688639     gbest12.seq
 230687971     gbest120.seq
 230689653     gbest121.seq
 228290125     gbest122.seq
 230687827     gbest123.seq
 230689088     gbest124.seq
 230689528     gbest125.seq
 230689913     gbest126.seq
 230687851     gbest127.seq
 230689725     gbest128.seq
 230689676     gbest129.seq
 230688451     gbest13.seq
 230687709     gbest130.seq
 230691195     gbest131.seq
 230687698     gbest132.seq
 230688171     gbest133.seq
 230688011     gbest134.seq
 230690692     gbest135.seq
 230687683     gbest136.seq
 230690395     gbest137.seq
 230689595     gbest138.seq
 230688977     gbest139.seq
 230689521     gbest14.seq
 230688485     gbest140.seq
 230688837     gbest141.seq
 230687516     gbest142.seq
 230690716     gbest143.seq
 230690655     gbest144.seq
 230691052     gbest145.seq
 230691023     gbest146.seq
 230688436     gbest147.seq
 230688551     gbest148.seq
 230688393     gbest149.seq
 230688335     gbest15.seq
 230687926     gbest150.seq
 230688369     gbest151.seq
 230688646     gbest152.seq
 230690926     gbest153.seq
 230689065     gbest154.seq
 230689214     gbest155.seq
 230688212     gbest156.seq
 230688483     gbest157.seq
 230690083     gbest158.seq
 230688045     gbest159.seq
 230687890     gbest16.seq
 230689336     gbest160.seq
 230689136     gbest161.seq
 230688966     gbest162.seq
 230688008     gbest163.seq
 230688915     gbest164.seq
 230689946     gbest165.seq
 230689048     gbest166.seq
 230690139     gbest167.seq
 230691225     gbest168.seq
 230689529     gbest169.seq
 230690085     gbest17.seq
 230687458     gbest170.seq
 230689332     gbest171.seq
 230689636     gbest172.seq
 230689576     gbest173.seq
 230688923     gbest174.seq
 230689326     gbest175.seq
 230689646     gbest176.seq
 230689760     gbest177.seq
 230690459     gbest178.seq
 230690476     gbest179.seq
 230688827     gbest18.seq
 230687952     gbest180.seq
 230689725     gbest181.seq
 230688333     gbest182.seq
 230688452     gbest183.seq
 230689904     gbest184.seq
 230690337     gbest185.seq
 230689945     gbest186.seq
 230688129     gbest187.seq
 230687861     gbest188.seq
 230687717     gbest189.seq
 230687736     gbest19.seq
 230687975     gbest190.seq
 230690039     gbest191.seq
 230687820     gbest192.seq
 230689405     gbest193.seq
 230690390     gbest194.seq
 230689343     gbest195.seq
 230687768     gbest196.seq
 230690260     gbest197.seq
 230689296     gbest198.seq
 230688948     gbest199.seq
 230690089     gbest2.seq
 230687653     gbest20.seq
 163204039     gbest200.seq
 162071079     gbest201.seq
 168700327     gbest202.seq
 168169001     gbest203.seq
 168591105     gbest204.seq
 165351964     gbest205.seq
 165031890     gbest206.seq
 164650207     gbest207.seq
 164506608     gbest208.seq
 164482720     gbest209.seq
 230690677     gbest21.seq
 164631856     gbest210.seq
 163570749     gbest211.seq
 167172787     gbest212.seq
 164267415     gbest213.seq
 162274903     gbest214.seq
 165013410     gbest215.seq
 168895955     gbest216.seq
 166909215     gbest217.seq
 165743314     gbest218.seq
 166019217     gbest219.seq
 230688435     gbest22.seq
 165345190     gbest220.seq
 164885254     gbest221.seq
 164393768     gbest222.seq
 164679972     gbest223.seq
 165344370     gbest224.seq
 173303206     gbest225.seq
 177349860     gbest226.seq
 173181527     gbest227.seq
 230689544     gbest228.seq
 230689924     gbest229.seq
 230690732     gbest23.seq
 230687829     gbest230.seq
 230689857     gbest231.seq
 230689958     gbest232.seq
 230689748     gbest233.seq
 230689020     gbest234.seq
 230688196     gbest235.seq
 230691316     gbest236.seq
 230689039     gbest237.seq
 230689304     gbest238.seq
 230688528     gbest239.seq
 230689914     gbest24.seq
 230687660     gbest240.seq
 230688653     gbest241.seq
 230689294     gbest242.seq
 230688312     gbest243.seq
 230689301     gbest244.seq
 230689166     gbest245.seq
 230687451     gbest246.seq
 230690099     gbest247.seq
 230690173     gbest248.seq
 230689426     gbest249.seq
 230688168     gbest25.seq
 230687768     gbest250.seq
 230688541     gbest251.seq
 230689271     gbest252.seq
 230688880     gbest253.seq
 230689472     gbest254.seq
 230688044     gbest255.seq
 215245604     gbest256.seq
 230688233     gbest257.seq
 230687478     gbest258.seq
 230688841     gbest259.seq
 230690705     gbest26.seq
 230688783     gbest260.seq
 230688638     gbest261.seq
 230689235     gbest262.seq
 230689460     gbest263.seq
 230687899     gbest264.seq
 230689217     gbest265.seq
 230687721     gbest266.seq
 230688818     gbest267.seq
 230689290     gbest268.seq
 230690547     gbest269.seq
 230688463     gbest27.seq
 230688282     gbest270.seq
 230690385     gbest271.seq
 230689215     gbest272.seq
 230690534     gbest273.seq
 230687857     gbest274.seq
 230689304     gbest275.seq
 230689995     gbest276.seq
 230689464     gbest277.seq
 230688045     gbest278.seq
 230689225     gbest279.seq
 230689490     gbest28.seq
 230687864     gbest280.seq
 230687665     gbest281.seq
 230687726     gbest282.seq
 230688741     gbest283.seq
 230689681     gbest284.seq
 155346320     gbest285.seq
 223288497     gbest286.seq
 230687563     gbest287.seq
 230688422     gbest288.seq
 230689114     gbest289.seq
 230689504     gbest29.seq
 230687678     gbest290.seq
 230688892     gbest291.seq
 230688760     gbest292.seq
 230687849     gbest293.seq
 216557745     gbest294.seq
 230689099     gbest295.seq
 142675556     gbest296.seq
 230689555     gbest3.seq
 230688214     gbest30.seq
 230688126     gbest31.seq
 230689510     gbest32.seq
 230688115     gbest33.seq
 230688388     gbest34.seq
 230688686     gbest35.seq
 225320844     gbest36.seq
 191124333     gbest37.seq
 190586545     gbest38.seq
 215040119     gbest39.seq
 230687893     gbest4.seq
 216118740     gbest40.seq
 215790818     gbest41.seq
 216889236     gbest42.seq
 230688037     gbest43.seq
 230688351     gbest44.seq
 224947196     gbest45.seq
 228318298     gbest46.seq
 230688207     gbest47.seq
 230689332     gbest48.seq
 230690684     gbest49.seq
 163953101     gbest5.seq
 230690926     gbest50.seq
 230687652     gbest51.seq
 230688604     gbest52.seq
 230688762     gbest53.seq
 230688826     gbest54.seq
 230688092     gbest55.seq
 230688279     gbest56.seq
 230689209     gbest57.seq
 230689885     gbest58.seq
 230690075     gbest59.seq
 180514745     gbest6.seq
 230688535     gbest60.seq
 230690207     gbest61.seq
 209559378     gbest62.seq
 209229624     gbest63.seq
 208757109     gbest64.seq
 208885732     gbest65.seq
 210279564     gbest66.seq
 209756122     gbest67.seq
 208614686     gbest68.seq
 209134014     gbest69.seq
 230687546     gbest7.seq
 210496706     gbest70.seq
 206521996     gbest71.seq
 206434319     gbest72.seq
 208064476     gbest73.seq
 208561505     gbest74.seq
 215011906     gbest75.seq
 230689412     gbest76.seq
 230687719     gbest77.seq
 230690763     gbest78.seq
 216754095     gbest79.seq
 230689300     gbest8.seq
 214671112     gbest80.seq
 216841494     gbest81.seq
 230687794     gbest82.seq
 230688465     gbest83.seq
 230687670     gbest84.seq
 230689726     gbest85.seq
 230688944     gbest86.seq
 230690185     gbest87.seq
 230690259     gbest88.seq
 230688439     gbest89.seq
 230689730     gbest9.seq
 230689498     gbest90.seq
 230688873     gbest91.seq
 230689373     gbest92.seq
 230689907     gbest93.seq
 230687773     gbest94.seq
 230687554     gbest95.seq
 230690452     gbest96.seq
 230689150     gbest97.seq
 230689911     gbest98.seq
 230689737     gbest99.seq
  35567536     gbgen.idx
 230688872     gbgss1.seq
 230688594     gbgss10.seq
 250000824     gbgss100.seq
 250001629     gbgss101.seq
 128494179     gbgss102.seq
 230687461     gbgss11.seq
 230690319     gbgss12.seq
 230690127     gbgss13.seq
 230690290     gbgss14.seq
 230689815     gbgss15.seq
 230688831     gbgss16.seq
 230688919     gbgss17.seq
 230689732     gbgss18.seq
 230687876     gbgss19.seq
 230687986     gbgss2.seq
 230688817     gbgss20.seq
 230690299     gbgss21.seq
 230687588     gbgss22.seq
 230687901     gbgss23.seq
 230690187     gbgss24.seq
 230688264     gbgss25.seq
 230687922     gbgss26.seq
 230689340     gbgss27.seq
 230688624     gbgss28.seq
 230689722     gbgss29.seq
 230687901     gbgss3.seq
 230689239     gbgss30.seq
 230687612     gbgss31.seq
 230690022     gbgss32.seq
 230689010     gbgss33.seq
 230689624     gbgss34.seq
 230688022     gbgss35.seq
 230688649     gbgss36.seq
 230688241     gbgss37.seq
 230689678     gbgss38.seq
 230688668     gbgss39.seq
 230687845     gbgss4.seq
 230689734     gbgss40.seq
 230688518     gbgss41.seq
 230689541     gbgss42.seq
 230687614     gbgss43.seq
 230689451     gbgss44.seq
 230687508     gbgss45.seq
 230688083     gbgss46.seq
 230690002     gbgss47.seq
 230688829     gbgss48.seq
 230690067     gbgss49.seq
 230687801     gbgss5.seq
 230689783     gbgss50.seq
 230689542     gbgss51.seq
 230690220     gbgss52.seq
 230687736     gbgss53.seq
 230689276     gbgss54.seq
 230688105     gbgss55.seq
 230690377     gbgss56.seq
 230688353     gbgss57.seq
 230690232     gbgss58.seq
 230689013     gbgss59.seq
 230690143     gbgss6.seq
 230690495     gbgss60.seq
 230196082     gbgss61.seq
 230688216     gbgss62.seq
 230687633     gbgss63.seq
 230689868     gbgss64.seq
 230688152     gbgss65.seq
 230688035     gbgss66.seq
 230688453     gbgss67.seq
 230689147     gbgss68.seq
 230689434     gbgss69.seq
 230687660     gbgss7.seq
 230688585     gbgss70.seq
 230688095     gbgss71.seq
 230689087     gbgss72.seq
 230688607     gbgss73.seq
 230689420     gbgss74.seq
 230688716     gbgss75.seq
 230687708     gbgss76.seq
 230689227     gbgss77.seq
 230689238     gbgss78.seq
 230688138     gbgss79.seq
 230690622     gbgss8.seq
 208205451     gbgss80.seq
 193674468     gbgss81.seq
 210617240     gbgss82.seq
 230688445     gbgss83.seq
 230688823     gbgss84.seq
 230687688     gbgss85.seq
 230688302     gbgss86.seq
 230688905     gbgss87.seq
 230690078     gbgss88.seq
 230688478     gbgss89.seq
 230689742     gbgss9.seq
    198185     gbgss90.seq
 250000951     gbgss91.seq
 250002536     gbgss92.seq
 250001647     gbgss93.seq
 250002123     gbgss94.seq
 250002086     gbgss95.seq
 250001040     gbgss96.seq
 250002229     gbgss97.seq
 250000323     gbgss98.seq
 250000004     gbgss99.seq
 250006442     gbhtc1.seq
 250001028     gbhtc2.seq
 250000660     gbhtc3.seq
  88282267     gbhtc4.seq
 250022892     gbhtg1.seq
 250204757     gbhtg10.seq
 250176400     gbhtg11.seq
 250059980     gbhtg12.seq
 250070829     gbhtg13.seq
 250292134     gbhtg14.seq
 250157331     gbhtg15.seq
 250207929     gbhtg16.seq
 250241302     gbhtg17.seq
 250124680     gbhtg18.seq
 250408176     gbhtg19.seq
 250002113     gbhtg2.seq
 250028458     gbhtg20.seq
 250195197     gbhtg21.seq
 250065928     gbhtg22.seq
 250014853     gbhtg23.seq
 250010832     gbhtg24.seq
 250175798     gbhtg25.seq
 250046535     gbhtg26.seq
 250092616     gbhtg27.seq
 250165659     gbhtg28.seq
 250013105     gbhtg29.seq
 250000155     gbhtg3.seq
 250331208     gbhtg30.seq
 250010588     gbhtg31.seq
 250558827     gbhtg32.seq
 250310071     gbhtg33.seq
 250253577     gbhtg34.seq
 250082541     gbhtg35.seq
 250122123     gbhtg36.seq
 250125256     gbhtg37.seq
 250008747     gbhtg38.seq
 250051892     gbhtg39.seq
 250091204     gbhtg4.seq
 250250923     gbhtg40.seq
 250239717     gbhtg41.seq
 250166385     gbhtg42.seq
 250009082     gbhtg43.seq
 250185155     gbhtg44.seq
 250185625     gbhtg45.seq
 250079582     gbhtg46.seq
 250031850     gbhtg47.seq
 250076720     gbhtg48.seq
 250257220     gbhtg49.seq
 250221451     gbhtg5.seq
 250066136     gbhtg50.seq
 250186860     gbhtg51.seq
 250114683     gbhtg52.seq
 250190464     gbhtg53.seq
 250188270     gbhtg54.seq
 250258971     gbhtg55.seq
 250073334     gbhtg56.seq
 250071627     gbhtg57.seq
 250208173     gbhtg58.seq
 250183370     gbhtg59.seq
 250091103     gbhtg6.seq
 250174063     gbhtg60.seq
 252164622     gbhtg61.seq
   9790485     gbhtg62.seq
 250064848     gbhtg7.seq
 250042483     gbhtg8.seq
 250213360     gbhtg9.seq
 250050052     gbinv1.seq
 250120846     gbinv2.seq
 250002627     gbinv3.seq
 250000007     gbinv4.seq
 250000379     gbinv5.seq
 143779420     gbinv6.seq
 858447652     gbjou.idx
 713910739     gbkey.idx
 210019673     gbmam.seq
  24139557     gbnew.txt
 250004023     gbpat1.seq
 250001348     gbpat10.seq
 250000664     gbpat11.seq
 250001276     gbpat12.seq
 250000461     gbpat13.seq
 250000439     gbpat14.seq
  56619966     gbpat15.seq
 250002093     gbpat2.seq
 250008483     gbpat3.seq
 250000433     gbpat4.seq
 250004524     gbpat5.seq
 250020490     gbpat6.seq
 250000381     gbpat7.seq
 250000263     gbpat8.seq
 250001744     gbpat9.seq
  29648628     gbphg.seq
 250060065     gbpln1.seq
 239024679     gbpln10.seq
 250001427     gbpln2.seq
 250003059     gbpln3.seq
 250004845     gbpln4.seq
 250099726     gbpln5.seq
 250022127     gbpln6.seq
 250003291     gbpln7.seq
 250001098     gbpln8.seq
 250157826     gbpln9.seq
 250283966     gbpri1.seq
 250108318     gbpri10.seq
 250119250     gbpri11.seq
 250040543     gbpri12.seq
 250113220     gbpri13.seq
 250130720     gbpri14.seq
 251074187     gbpri15.seq
 250220109     gbpri16.seq
 250155266     gbpri17.seq
 250021219     gbpri18.seq
 250023630     gbpri19.seq
 250105135     gbpri2.seq
 250296816     gbpri20.seq
 250010593     gbpri21.seq
 250003923     gbpri22.seq
 250067803     gbpri23.seq
 250001247     gbpri24.seq
 250082398     gbpri25.seq
 250000671     gbpri26.seq
 122538567     gbpri27.seq
 250198906     gbpri3.seq
 250069334     gbpri4.seq
 250127745     gbpri5.seq
 250138877     gbpri6.seq
 250168793     gbpri7.seq
 250073988     gbpri8.seq
 250144902     gbpri9.seq
    161120     gbrel.txt
 250032995     gbrod1.seq
 250011207     gbrod10.seq
 206251373     gbrod11.seq
 250143379     gbrod2.seq
 250049028     gbrod3.seq
 250116483     gbrod4.seq
 250193683     gbrod5.seq
 250158453     gbrod6.seq
 250152365     gbrod7.seq
 250247025     gbrod8.seq
 250027971     gbrod9.seq
2603988555     gbsdr.txt
   1511290     gbsec.idx
 250000103     gbsts1.seq
 250001173     gbsts2.seq
 229867334     gbsts3.seq
  49203298     gbsyn.seq
   3031818     gbuna.seq
 250002596     gbvrl1.seq
 250001784     gbvrl2.seq
 250001857     gbvrl3.seq
   1675943     gbvrl4.seq
 250033203     gbvrt1.seq
 250001376     gbvrt2.seq
 250080168     gbvrt3.seq
 250001868     gbvrt4.seq
   2173106     gbvrt5.seq

2.2.6 Per-Division Statistics 

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         27051      99030483
BCT2         8451       106716654
BCT3         13434      109172207
BCT4         59987      87959383
BCT5         5096       114168372
BCT6         59309      85429373
BCT7         21563      97258441
BCT8         38250      82080171
EST1         68591      26476165
EST10        76948      29968674
EST100       70603      28486591
EST101       70840      31653688
EST102       64597      35045071
EST103       66736      38784844
EST104       72383      48431266
EST105       76065      28241101
EST106       75258      34817339
EST107       75140      27076476
EST108       74261      35794036
EST109       68458      35342837
EST11        76417      28993204
EST110       75422      42018297
EST111       79896      44772648
EST112       74377      48232369
EST113       67996      41048239
EST114       71080      47619239
EST115       72471      45614266
EST116       71148      44920867
EST117       76126      42365849
EST118       75428      47974604
EST119       74858      49804295
EST12        77097      30819214
EST120       70986      48476824
EST121       80618      42961607
EST122       75308      24982648
EST123       82725      45334920
EST124       75705      43080674
EST125       73824      44263789
EST126       65055      31655759
EST127       69189      38994387
EST128       67725      36854872
EST129       68262      39621079
EST13        77755      29955042
EST130       71531      41889838
EST131       72666      47007746
EST132       68199      40472952
EST133       73430      40635362
EST134       69564      41614229
EST135       59496      36122103
EST136       90465      48628098
EST137       96789      55485992
EST138       69101      35515736
EST139       107380     56742365
EST14        79977      32076020
EST140       109907     60333225
EST141       98350      54089692
EST142       73979      44508348
EST143       77563      47407364
EST144       68503      33775009
EST145       64378      29402332
EST146       55275      25212013
EST147       64667      31382079
EST148       61599      31256695
EST149       66496      35724884
EST15        73038      30953867
EST150       72955      51777551
EST151       65698      44869059
EST152       82919      48796463
EST153       58408      29893274
EST154       62999      32124471
EST155       67646      40414978
EST156       65604      39371965
EST157       63086      41333581
EST158       88877      47753602
EST159       83007      51973279
EST16        75618      33237474
EST160       73851      39019184
EST161       68161      45710526
EST162       66516      38095734
EST163       63495      41981388
EST164       67767      31780198
EST165       75745      29754985
EST166       71735      45585831
EST167       82456      41243421
EST168       62613      32045430
EST169       68999      47543810
EST17        84030      34396164
EST170       70050      48237060
EST171       69170      37269335
EST172       67449      43585598
EST173       71349      56251191
EST174       68632      32689393
EST175       72934      40561878
EST176       69904      59439041
EST177       66920      50713133
EST178       64248      46749896
EST179       63789      47250119
EST18        80491      32535798
EST180       65641      46076072
EST181       65042      45888879
EST182       64168      48942335
EST183       63545      39059077
EST184       64744      33760224
EST185       62513      36518214
EST186       85777      48022314
EST187       83892      54759548
EST188       72803      43023908
EST189       106300     66598828
EST19        81070      33657531
EST190       108474     65430807
EST191       104098     62358849
EST192       69318      38038340
EST193       69125      59111315
EST194       67552      69108957
EST195       76371      56432348
EST196       79963      38997050
EST197       76143      50393859
EST198       71855      51454747
EST199       64341      39770921
EST2         75366      28937064
EST20        72996      29250579
EST200       27866      10457923
EST201       27959      10488181
EST202       26859      9846254
EST203       26969      9524772
EST204       26942      9216957
EST205       27320      10246093
EST206       27255      9631599
EST207       27288      10176223
EST208       27281      11514969
EST209       27248      11510828
EST21        73142      34111695
EST210       27289      10636338
EST211       27603      9558689
EST212       27061      8809430
EST213       27629      11261791
EST214       27933      10776600
EST215       27517      11083052
EST216       26685      11754743
EST217       26928      11814386
EST218       27181      10610645
EST219       27026      11496984
EST22        77019      30652131
EST220       27158      11793556
EST221       27303      11327784
EST222       27332      10804598
EST223       27297      10787487
EST224       27234      10573414
EST225       25799      15591934
EST226       25083      16623465
EST227       29133      18201792
EST228       101986     35088640
EST229       83583      43249217
EST23        77200      32096025
EST230       69554      44944689
EST231       70202      45269982
EST232       69902      45202376
EST233       67150      39994925
EST234       80901      46495392
EST235       63845      42525544
EST236       63712      31211073
EST237       86270      42506343
EST238       98958      46316653
EST239       72894      41157669
EST24        75832      34324749
EST240       64253      32252224
EST241       70308      35995544
EST242       70470      43422430
EST243       74448      34592748
EST244       71076      37844117
EST245       70654      44895247
EST246       64724      37334938
EST247       69932      34024083
EST248       88280      47113344
EST249       78896      51561264
EST25        72756      30950174
EST250       80968      55395576
EST251       98209      51400282
EST252       97469      46510210
EST253       77676      43399230
EST254       70344      47087659
EST255       76084      33929385
EST256       70021      31376402
EST257       72199      35755747
EST258       65705      39425378
EST259       61386      39076306
EST26        76531      31525592
EST260       75497      44496050
EST261       62975      43539277
EST262       61453      33848721
EST263       84455      44117364
EST264       84771      42677646
EST265       86343      51017047
EST266       113301     52070837
EST267       108974     48179778
EST268       72423      37537412
EST269       68018      37503158
EST27        78842      34772339
EST270       73539      46670265
EST271       81599      39611275
EST272       71608      44048207
EST273       66710      40573484
EST274       62037      37425250
EST275       48983      26460066
EST276       63805      39840199
EST277       72181      38717839
EST278       66670      39878693
EST279       69835      44250775
EST28        107608     51679943
EST280       71092      50011025
EST281       65663      50827780
EST282       58822      38780746
EST283       66512      42331596
EST284       72906      47734316
EST285       57469      28958196
EST286       67982      35631608
EST287       61905      34844783
EST288       66977      32012338
EST289       97733      31348514
EST29        69092      47067767
EST290       70229      25469410
EST291       73823      27676873
EST292       74472      26168761
EST293       79334      27639264
EST294       69796      24619921
EST295       71255      29857930
EST296       48633      17564947
EST3         74213      30128080
EST30        70055      63180122
EST31        85700      49004015
EST32        85070      43629423
EST33        94041      45998728
EST34        100080     48439306
EST35        99255      50379328
EST36        94008      36126954
EST37        69371      18393414
EST38        69284      18576420
EST39        63658      19465138
EST4         74631      28188475
EST40        43585      11882591
EST41        43271      11988571
EST42        43103      11405932
EST43        77072      31076416
EST44        95470      43602471
EST45        92354      46696043
EST46        85832      41099519
EST47        105570     55271606
EST48        95688      46938201
EST49        77418      33289326
EST5         48531      15367560
EST50        67792      30019065
EST51        73129      31783602
EST52        70960      29813923
EST53        83656      33906593
EST54        74437      29762666
EST55        67411      27852528
EST56        69620      30362532
EST57        77434      37170580
EST58        73559      31931013
EST59        75584      27637963
EST6         56332      18258994
EST60        79507      30219137
EST61        75628      33845675
EST62        40285      11403873
EST63        40235      11251599
EST64        40350      12718414
EST65        40674      12278077
EST66        40642      12509151
EST67        40549      12919629
EST68        40556      12605239
EST69        40427      12113513
EST7         74707      29422353
EST70        40363      12307193
EST71        41196      12404329
EST72        41377      12246007
EST73        41257      13138218
EST74        41063      13087400
EST75        43560      12513644
EST76        43834      19777984
EST77        40785      24922323
EST78        42837      18604540
EST79        49925      21217249
EST8         76830      30879168
EST80        51193      21538521
EST81        50119      21985179
EST82        73473      32122949
EST83        74144      28793850
EST84        73037      30088123
EST85        77310      43860704
EST86        78595      41289358
EST87        76070      41542749
EST88        78516      36060677
EST89        70671      40988213
EST9         77952      30110323
EST90        74162      37531040
EST91        75716      39277283
EST92        70849      36744674
EST93        77673      48177113
EST94        68728      37655634
EST95        70973      35755544
EST96        73952      37325212
EST97        73528      45536608
EST98        67248      44003338
EST99        76122      45643151
GSS1         91487      39178813
GSS10        75816      44130824
GSS100       61261      55471388
GSS101       114592     58553162
GSS102       49289      21907482
GSS11        69169      35577401
GSS12        74400      38992332
GSS13        74973      37670490
GSS14        72504      32438738
GSS15        73588      37366893
GSS16        75295      43831304
GSS17        70273      32347652
GSS18        57512      29349613
GSS19        57689      28842415
GSS2         89911      39770582
GSS20        58964      25524292
GSS21        63584      38704440
GSS22        63504      29994480
GSS23        58832      29909034
GSS24        72199      43165723
GSS25        63146      24484895
GSS26        58276      27278055
GSS27        74954      35053936
GSS28        56768      31099790
GSS29        91005      43129837
GSS3         88258      42112413
GSS30        78083      40679708
GSS31        74171      43639924
GSS32        71244      43898246
GSS33        81414      39825002
GSS34        76554      40896450
GSS35        81692      47335380
GSS36        94348      62695539
GSS37        90040      51019400
GSS38        94312      58013126
GSS39        83623      37316111
GSS4         79835      41569189
GSS40        86751      36443883
GSS41        82210      49870948
GSS42        81091      57568215
GSS43        74917      51468461
GSS44        72791      48090688
GSS45        72955      47838016
GSS46        80917      39397169
GSS47        83657      52698457
GSS48        91926      64508133
GSS49        80708      60490825
GSS5         79679      41076797
GSS50        93070      56583501
GSS51        88913      57996606
GSS52        79403      48284248
GSS53        72662      37580061
GSS54        88289      52529939
GSS55        88057      55007967
GSS56        80077      62370538
GSS57        72139      79118408
GSS58        83731      71007083
GSS59        91468      63769584
GSS6         78381      39036861
GSS60        65698      44357853
GSS61        64882      44882681
GSS62        88752      66050026
GSS63        87371      61690114
GSS64        86583      52573456
GSS65        88274      57540555
GSS66        96205      59696072
GSS67        101204     54337116
GSS68        100808     54837753
GSS69        101718     53690363
GSS7         77255      39700569
GSS70        102904     52190818
GSS71        102713     52431677
GSS72        102709     52437462
GSS73        102599     52575736
GSS74        100397     55331320
GSS75        90084      68895644
GSS76        89551      70562046
GSS77        88318      69739960
GSS78        87840      69658317
GSS79        89404      62899276
GSS8         77182      38154928
GSS80        84373      33164656
GSS81        79001      24709920
GSS82        85829      33591553
GSS83        82459      50037069
GSS84        81505      46275992
GSS85        89538      63756210
GSS86        80077      61350938
GSS87        77502      79429558
GSS88        78538      59694505
GSS89        91718      54623156
GSS9         72967      37474282
GSS90        117        31934
GSS91        88249      65634155
GSS92        84795      63615030
GSS93        97507      42574518
GSS94        84719      53858621
GSS95        108019     69142802
GSS96        76967      41702040
GSS97        80451      63549309
GSS98        69733      58419648
GSS99        67969      62329881
HTC1         31843      55023281
HTC2         30756      66875061
HTC3         87727      78644244
HTC4         20722      25326213
HTG1         1329       190533657
HTG10        1243       189327444
HTG11        1418       187419209
HTG12        953        192242921
HTG13        753        192441644
HTG14        739        192657048
HTG15        765        192474175
HTG16        810        192333864
HTG17        775        192599601
HTG18        1618       184260386
HTG19        1425       185886134
HTG2         2558       188209285
HTG20        905        191217485
HTG21        1202       188803386
HTG22        831        191835619
HTG23        896        191353153
HTG24        910        191387885
HTG25        904        191511712
HTG26        831        191769156
HTG27        775        192341626
HTG28        894        191661554
HTG29        891        191725550
HTG3         2484       187993873
HTG30        926        191365236
HTG31        995        190815448
HTG32        935        191579350
HTG33        952        191479718
HTG34        942        191283404
HTG35        924        191841066
HTG36        895        191641058
HTG37        1004       191178058
HTG38        891        191641571
HTG39        864        191936359
HTG4         2535       189851873
HTG40        834        192112441
HTG41        901        191700743
HTG42        964        191235690
HTG43        940        192123167
HTG44        958        191468440
HTG45        987        191494201
HTG46        1147       189980591
HTG47        1103       190205032
HTG48        1344       190092736
HTG49        1129       191163683
HTG5         1291       188447633
HTG50        1140       190108977
HTG51        1100       190953998
HTG52        1166       191486771
HTG53        1246       192065633
HTG54        1156       192435664
HTG55        1230       192022278
HTG56        1085       193013284
HTG57        1277       191154372
HTG58        1070       193957593
HTG59        1020       194455503
HTG6         1289       187912596
HTG60        988        193994407
HTG61        1104       190689345
HTG62        84         7172215
HTG7         1254       188148673
HTG8         1296       187647964
HTG9         1207       189530516
INV1         11743      170572387
INV2         1315       166864029
INV3         57963      92244610
INV4         71854      76658181
INV5         39888      114672640
INV6         23922      60143239
MAM          57748      78565176
PAT1         223018     70310731
PAT10        115208     49917201
PAT11        151058     55792688
PAT12        157455     78048421
PAT13        104591     120100305
PAT14        141039     81823591
PAT15        58545      14063412
PAT2         199882     89312251
PAT3         163279     93295005
PAT4         150830     85907513
PAT5         111915     116428070
PAT6         138917     95542763
PAT7         125547     99656689
PAT8         145694     56315689
PAT9         104094     62446349
PHG          2455       11586230
PLN1         25983      132550787
PLN10        37828      105765783
PLN2         19046      156086594
PLN3         77554      77135411
PLN4         47086      63428561
PLN5         17732      109187796
PLN6         3543       169567954
PLN7         54617      70811055
PLN8         68693      75679805
PLN9         47502      113613859
PRI1         16239      153262329
PRI10        1399       175765116
PRI11        1279       175628206
PRI12        1509       175180328
PRI13        1581       178969284
PRI14        1504       185079093
PRI15        41160      123895968
PRI16        34935      90835147
PRI17        1605       177229315
PRI18        1651       180871669
PRI19        1826       181977633
PRI2         1422       173461511
PRI20        2184       189845594
PRI21        2375       184185754
PRI22        43623      78206058
PRI23        13072      153721990
PRI24        18099      155498291
PRI25        49094      117525071
PRI26        38382      124482015
PRI27        31362      46281935
PRI3         1256       182072697
PRI4         1293       178237062
PRI5         1143       173732018
PRI6         1207       178992258
PRI7         1210       177269985
PRI8         1334       169526068
PRI9         1230       177934408
ROD1         7486       172160842
ROD10        27547      98607559
ROD11        45826      85370136
ROD2         877        175162537
ROD3         962        179100805
ROD4         977        180502002
ROD5         1002       181618780
ROD6         25801      147934435
ROD7         1182       194408105
ROD8         1209       193247666
ROD9         9644       180363497
STS1         88861      48169052
STS2         90923      36770447
STS3         83511      37635064
SYN          11219      18694655
UNA          1270       556739
VRL1         72875      65486237
VRL2         73674      65189774
VRL3         72949      68924012
VRL4         294        622393
VRT1         64071      91680086
VRT2         19568      158354079
VRT3         24986      137679602
VRT4         32714      144419678
VRT5         592        723239

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 140.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries       Bases   Species

7688194 10562788491   Homo sapiens
5522062  6359223085   Mus musculus
882826   5581794872   Rattus norvegicus
628873   1374016681   Danio rerio
2122118  1339093805   Zea mays
270212    720148218   Oryza sativa (japonica cultivar-group)
370165    705462293   Drosophila melanogaster
613711    518384949   Gallus gallus
887520    511702734   Canis familiaris
632992    460919521   Arabidopsis thaliana
595969    403840724   Brassica oleracea
661591    401807223   Bos taurus
175679    395673123   Pan troglodytes
432497    356298816   Xenopus tropicalis
25509     338085385   Macaca mulatta
553050    302908395   Triticum aestivum
499308    294277994   Ciona intestinalis
250196    243138896   Medicago truncatula
238551    240764320   Caenorhabditis elegans
366523    234093682   Xenopus laevis

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002.

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the 591 files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 April 2003

                NCBI-GenBank Flat File Release 140.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 140.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark, Irene Fang,
	Linda Frisse, Michael Fetchko, Anjanette Johnston, William Klimke,
	Pierre Ledoux, Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis,
	Chris O'Sullivan, Leigh Riley, Gert Roosen, MJ Rosovitz, Susan Schafer,
	Suh-suh Wang, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Anton Butanaev, Mark Cavanaugh,
	Hsiu-Chuan Chen, Olga Cherenkov, Jonathan Kans, Michael Kimelman,
	Jim Ostell, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Carolyn Tolstoshev, Jane Weisemann,
	Eugene Yaschenko

Database Administration
	Ron Chen, Slava Khotomliansky, Tony Stearman

User Support
	Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
	Renata Geer, Scott McGinnis, Donna Messersmith, Rana Morris, Vyvy Pham,
	Monica Romiti, Eric Sayers, Tao Tao, David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center