Release Notes For GenBank Release 145
GBREL.TXT Genetic Sequence Data Bank
December 15 2004
NCBI-GenBank Flat File Release 145.0
Distribution Release Notes
40604319 loci, 44575745176 bases, from 40604319 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 145.0
1.2 Cutoff Date
1.3 Important Changes in Release 145.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 145.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
E-MAIL: update@ncbi.nlm.nih.gov
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 145.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
Mirrors of the GenBank FTP site at the NCBI are available from the San Diego
Supercomputer Center and the University of Indiana:
ftp://genbank.sdsc.edu/pub
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from these alternate sites when traffic at
the NCBI is high.
*** NOTE *** The SDSC GenBank mirror site is experiencing problems
caused by disk space limitations. Users of this site should closely
check the file content (total number of files and their dates) at
the mirror before using it. We will provide further details about
the status of the SDSC mirror as they become available.
1.2 Cutoff Date
This full release, 145.0, incorporates data available to the collaborating
databases as of December 16, 2004 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 145.0
1.3.1 Organizational changes
The total number of sequence data files increased by 21 with this release:
- the BCT division is now comprised of 11 files (+1)
- the EST division is now comprised of 355 files (+6)
- the GSS division is now comprised of 132 files (+12)
- the PAT division is now comprised of 17 files (+1)
- the ROD division is now comprised of 15 files (+1)
1.3.2 New gap feature
A new feature key for sequence gaps becomes legal as of this December 2004
GenBank release:
Feature key gap
Definition gap in the sequence
Mandatory qualifiers /estimated_length=unknown or <integer>
Optional qualifiers /map="text"
/note="text"
Comment the location span of the gap feature for an unknown
gap is 100 bp, with the 100 bp indicated as 100 "n"s in
the sequence. Where estimated length is indicated by
an integer, this is indicated by the same number of
"n"s in the sequence.
No upper or lower limit is set on the size of the gap.
Gap features will begin to appear in post-Release 145.0 GenBank Update files
in early January of 2005. They will frequently be seen in Phase 0, 1, and 2 HTG
records : each gap feature will coincide with the runs of N's in the sequence
data that separate adjacent sequence contigs.
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
twenty-three GSS flatfiles in Release 145.0. Consider gbgss110.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
December 15 2004
NCBI-GenBank Flat File Release 145.0
GSS Sequences (Part 1)
88212 loci, 65541827 bases, from 88212 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "110" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New ENV Division in April 2005
A new division for sequences obtained via environmental sampling methods
will be introduced with GenBank Release 147.0 in April 2005 . Records in this
new division will have these characteristics:
1. ENV division code on the LOCUS line
2. ENV keyword
3. /environmental_sample qualifier in the source feature
This new division will segregate sequences for which the source organism is
unknown, or can only be inferred by sequence comparison.
Sequences from WGS projects that involve environmental sampling will *not*
be distributed via this new division. All WGS projects will continue to be
distributed using project-specific data files at the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Additional information about the new ENV division will be provided via
these release notes and the GenBank newsgroup.
1.4.2 Continuous ranges of secondary accessions
With the removal of sequence length limits, some genomes (typically
bacterial) that had been split into many pieces are gradually being
replaced by a single sequence record. U00096 is a good example.
When this happens, the accessions of the former small pieces become
secondary accessions for the single large sequence record. When each
secondary is separately listed, the ACCESSION line becomes excessively
lengthy.
As of GenBank Release 146.0 in February 2005, it will be legal to
represent continuous ranges of secondary accessions by a start accession,
a dash character, and an end accession. In the case of U00096, the
ACCESSION line would thus look like:
ACCESSION U00096 AE000111-AE000510
Further details about the conventions for secondary accession ranges
will be provided via these release notes and the GenBank newsgroup.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 705 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut3.idx - Index of the entries according to accession number, part 3.
23. gbaut4.idx - Index of the entries according to accession number, part 4.
24. gbaut5.idx - Index of the entries according to accession number, part 5.
25. gbaut6.idx - Index of the entries according to accession number, part 6.
26. gbaut7.idx - Index of the entries according to accession number, part 7.
27. gbaut8.idx - Index of the entries according to accession number, part 8.
28. gbaut9.idx - Index of the entries according to accession number, part 9.
29. gbbct1.seq - Bacterial sequence entries, part 1.
30. gbbct10.seq - Bacterial sequence entries, part 10.
31. gbbct11.seq - Bacterial sequence entries, part 11.
32. gbbct2.seq - Bacterial sequence entries, part 2.
33. gbbct3.seq - Bacterial sequence entries, part 3.
34. gbbct4.seq - Bacterial sequence entries, part 4.
35. gbbct5.seq - Bacterial sequence entries, part 5.
36. gbbct6.seq - Bacterial sequence entries, part 6.
37. gbbct7.seq - Bacterial sequence entries, part 7.
38. gbbct8.seq - Bacterial sequence entries, part 8.
39. gbbct9.seq - Bacterial sequence entries, part 9.
40. gbchg.txt - Accession numbers of entries updated since the previous release.
41. gbcon.seq - Constructed sequence entries.
42. gbdel.txt - Accession numbers of entries deleted since the previous release.
43. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
44. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
45. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
46. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
47. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
48. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
49. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
50. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
51. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
52. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
53. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
54. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
55. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
56. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
57. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
58. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
59. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
60. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
61. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
62. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
63. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
64. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
65. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
66. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
67. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
68. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
69. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
70. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
71. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
72. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
73. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
74. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
75. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
76. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
77. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
78. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
79. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
80. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
81. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
82. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
83. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
84. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
85. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
86. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
87. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
88. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
89. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
90. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
91. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
92. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
93. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
94. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
95. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
96. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
97. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
98. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
99. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
100. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
101. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
102. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
103. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
104. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
105. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
106. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
107. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
108. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
109. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
110. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
111. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
112. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
113. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
114. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
115. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
116. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
117. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
118. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
119. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
120. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
121. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
122. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
123. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
124. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
125. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
126. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
127. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
128. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
129. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
130. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
131. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
132. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
133. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
134. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
135. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
136. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
137. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
138. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
139. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
140. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
141. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
142. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
143. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
144. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
145. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
146. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
147. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
148. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
149. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
150. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
151. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
152. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
153. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
154. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
155. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
156. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
157. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
158. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
159. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
160. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
161. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
162. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
163. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
164. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
165. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
166. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
167. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
168. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
169. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
170. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
171. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
172. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
173. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
174. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
175. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
176. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
177. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
178. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
179. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
180. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
181. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
182. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
183. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
184. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
185. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
186. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
187. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
188. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
189. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
190. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
191. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
192. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
193. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
194. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
195. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
196. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
197. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
198. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
199. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
200. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
201. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
202. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
203. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
204. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
205. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
206. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
207. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
208. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
209. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
210. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
211. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
212. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
213. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
214. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
215. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
216. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
217. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
218. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
219. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
220. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
221. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
222. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
223. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
224. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
225. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
226. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
227. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
228. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
229. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
230. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
231. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
232. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
233. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
234. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
235. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
236. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
237. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
238. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
239. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
240. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
241. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
242. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
243. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
244. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
245. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
246. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
247. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
248. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
249. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
250. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
251. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
252. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
253. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
254. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
255. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
256. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
257. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
258. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
259. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
260. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
261. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
262. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
263. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
264. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
265. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
266. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
267. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
268. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
269. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
270. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
271. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
272. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
273. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
274. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
275. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
276. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
277. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
278. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
279. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
280. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
281. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
282. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
283. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
284. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
285. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
286. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
287. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
288. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
289. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
290. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
291. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
292. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
293. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
294. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
295. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
296. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
297. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
298. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
299. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
300. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
301. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
302. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
303. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
304. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
305. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
306. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
307. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
308. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
309. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
310. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
311. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
312. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
313. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
314. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
315. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
316. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
317. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
318. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
319. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
320. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
321. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
322. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
323. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
324. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
325. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
326. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
327. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
328. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
329. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
330. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
331. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
332. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
333. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
334. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
335. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
336. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
337. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
338. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
339. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
340. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
341. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
342. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
343. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
344. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
345. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
346. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
347. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
348. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
349. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
350. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
351. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
352. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
353. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
354. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
355. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
356. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
357. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
358. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
359. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
360. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
361. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
362. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
363. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
364. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
365. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
366. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
367. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
368. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
369. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
370. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
371. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
372. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
373. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
374. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
375. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
376. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
377. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
378. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
379. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
380. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
381. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
382. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
383. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
384. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
385. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
386. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
387. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
388. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
389. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
390. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
391. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
392. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
393. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
394. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
395. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
396. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
397. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
398. gbgen.idx - Index of the entries according to gene symbols.
399. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
400. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
401. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
402. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
403. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
404. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
405. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
406. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
407. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
408. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
409. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
410. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
411. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
412. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
413. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
414. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
415. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
416. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
417. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
418. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
419. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
420. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
421. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
422. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
423. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
424. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
425. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
426. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
427. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
428. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
429. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
430. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
431. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
432. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
433. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
434. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
435. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
436. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
437. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
438. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
439. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
440. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
441. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
442. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
443. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
444. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
445. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
446. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
447. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
448. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
449. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
450. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
451. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
452. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
453. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
454. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
455. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
456. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
457. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
458. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
459. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
460. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
461. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
462. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
463. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
464. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
465. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
466. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
467. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
468. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
469. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
470. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
471. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
472. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
473. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
474. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
475. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
476. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
477. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
478. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
479. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
480. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
481. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
482. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
483. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
484. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
485. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
486. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
487. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
488. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
489. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
490. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
491. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
492. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
493. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
494. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
495. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
496. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
497. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
498. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
499. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
500. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
501. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
502. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
503. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
504. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
505. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
506. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
507. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
508. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
509. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
510. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
511. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
512. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
513. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
514. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
515. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
516. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
517. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
518. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
519. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
520. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
521. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
522. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
523. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
524. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
525. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
526. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
527. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
528. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
529. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
530. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
531. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
532. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
533. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
534. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
535. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
536. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
537. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
538. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
539. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
540. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
541. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
542. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
543. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
544. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
545. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
546. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
547. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
548. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
549. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
550. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
551. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
552. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
553. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
554. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
555. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
556. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
557. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
558. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
559. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
560. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
561. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
562. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
563. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
564. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
565. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
566. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
567. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
568. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
569. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
570. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
571. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
572. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
573. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
574. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
575. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
576. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
577. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
578. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
579. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
580. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
581. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
582. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
583. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
584. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
585. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
586. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
587. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
588. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
589. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
590. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
591. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
592. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
593. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
594. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
595. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
596. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
597. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
598. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
599. gbinv1.seq - Invertebrate sequence entries, part 1.
600. gbinv2.seq - Invertebrate sequence entries, part 2.
601. gbinv3.seq - Invertebrate sequence entries, part 3.
602. gbinv4.seq - Invertebrate sequence entries, part 4.
603. gbinv5.seq - Invertebrate sequence entries, part 5.
604. gbinv6.seq - Invertebrate sequence entries, part 6.
605. gbinv7.seq - Invertebrate sequence entries, part 7.
606. gbjou.idx - Index of the entries according to journal citation.
607. gbkey.idx - Index of the entries according to keyword phrase.
608. gbmam1.seq - Other mammalian sequence entries, part 1.
609. gbmam2.seq - Other mammalian sequence entries, part 2.
610. gbnew.txt - Accession numbers of entries new since the previous release.
611. gbpat1.seq - Patent sequence entries, part 1.
612. gbpat10.seq - Patent sequence entries, part 10.
613. gbpat11.seq - Patent sequence entries, part 11.
614. gbpat12.seq - Patent sequence entries, part 12.
615. gbpat13.seq - Patent sequence entries, part 13.
616. gbpat14.seq - Patent sequence entries, part 14.
617. gbpat15.seq - Patent sequence entries, part 15.
618. gbpat16.seq - Patent sequence entries, part 16.
619. gbpat17.seq - Patent sequence entries, part 17.
620. gbpat2.seq - Patent sequence entries, part 2.
621. gbpat3.seq - Patent sequence entries, part 3.
622. gbpat4.seq - Patent sequence entries, part 4.
623. gbpat5.seq - Patent sequence entries, part 5.
624. gbpat6.seq - Patent sequence entries, part 6.
625. gbpat7.seq - Patent sequence entries, part 7.
626. gbpat8.seq - Patent sequence entries, part 8.
627. gbpat9.seq - Patent sequence entries, part 9.
628. gbphg.seq - Phage sequence entries.
629. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
630. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
631. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
632. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
633. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
634. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
635. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
636. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
637. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
638. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
639. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
640. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
641. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
642. gbpri1.seq - Primate sequence entries, part 1.
643. gbpri10.seq - Primate sequence entries, part 10.
644. gbpri11.seq - Primate sequence entries, part 11.
645. gbpri12.seq - Primate sequence entries, part 12.
646. gbpri13.seq - Primate sequence entries, part 13.
647. gbpri14.seq - Primate sequence entries, part 14.
648. gbpri15.seq - Primate sequence entries, part 15.
649. gbpri16.seq - Primate sequence entries, part 16.
650. gbpri17.seq - Primate sequence entries, part 17.
651. gbpri18.seq - Primate sequence entries, part 18.
652. gbpri19.seq - Primate sequence entries, part 19.
653. gbpri2.seq - Primate sequence entries, part 2.
654. gbpri20.seq - Primate sequence entries, part 20.
655. gbpri21.seq - Primate sequence entries, part 21.
656. gbpri22.seq - Primate sequence entries, part 22.
657. gbpri23.seq - Primate sequence entries, part 23.
658. gbpri24.seq - Primate sequence entries, part 24.
659. gbpri25.seq - Primate sequence entries, part 25.
660. gbpri26.seq - Primate sequence entries, part 26.
661. gbpri27.seq - Primate sequence entries, part 27.
662. gbpri28.seq - Primate sequence entries, part 28.
663. gbpri3.seq - Primate sequence entries, part 3.
664. gbpri4.seq - Primate sequence entries, part 4.
665. gbpri5.seq - Primate sequence entries, part 5.
666. gbpri6.seq - Primate sequence entries, part 6.
667. gbpri7.seq - Primate sequence entries, part 7.
668. gbpri8.seq - Primate sequence entries, part 8.
669. gbpri9.seq - Primate sequence entries, part 9.
670. gbrel.txt - Release notes (this document).
671. gbrod1.seq - Rodent sequence entries, part 1.
672. gbrod10.seq - Rodent sequence entries, part 10.
673. gbrod11.seq - Rodent sequence entries, part 11.
674. gbrod12.seq - Rodent sequence entries, part 12.
675. gbrod13.seq - Rodent sequence entries, part 13.
676. gbrod14.seq - Rodent sequence entries, part 14.
677. gbrod15.seq - Rodent sequence entries, part 15.
678. gbrod2.seq - Rodent sequence entries, part 2.
679. gbrod3.seq - Rodent sequence entries, part 3.
680. gbrod4.seq - Rodent sequence entries, part 4.
681. gbrod5.seq - Rodent sequence entries, part 5.
682. gbrod6.seq - Rodent sequence entries, part 6.
683. gbrod7.seq - Rodent sequence entries, part 7.
684. gbrod8.seq - Rodent sequence entries, part 8.
685. gbrod9.seq - Rodent sequence entries, part 9.
686. gbsdr.txt - Short directory of the data bank.
687. gbsec.idx - Index of the entries according to secondary accession number.
688. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
689. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
690. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
691. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
692. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
693. gbsyn.seq - Synthetic and chimeric sequence entries.
694. gbuna.seq - Unannotated sequence entries.
695. gbvrl1.seq - Viral sequence entries, part 1.
696. gbvrl2.seq - Viral sequence entries, part 2.
697. gbvrl3.seq - Viral sequence entries, part 3.
698. gbvrl4.seq - Viral sequence entries, part 4.
699. gbvrt1.seq - Other vertebrate sequence entries, part 1.
700. gbvrt2.seq - Other vertebrate sequence entries, part 2.
701. gbvrt3.seq - Other vertebrate sequence entries, part 3.
702. gbvrt4.seq - Other vertebrate sequence entries, part 4.
703. gbvrt5.seq - Other vertebrate sequence entries, part 5.
704. gbvrt6.seq - Other vertebrate sequence entries, part 6.
705. gbvrt7.seq - Other vertebrate sequence entries, part 7.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 145.0 flatfiles require roughly 153 GB (sequence
files only) or 170 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1332565477 gbacc.idx
500002331 gbaut1.idx
512504033 gbaut10.idx
517607059 gbaut11.idx
517853498 gbaut12.idx
501604122 gbaut13.idx
503326173 gbaut14.idx
502554177 gbaut15.idx
506747495 gbaut16.idx
500090057 gbaut17.idx
522627766 gbaut18.idx
506714116 gbaut19.idx
504097029 gbaut2.idx
519724644 gbaut20.idx
524697557 gbaut21.idx
500055105 gbaut22.idx
519424006 gbaut23.idx
511893957 gbaut24.idx
543869351 gbaut25.idx
518662237 gbaut26.idx
237635654 gbaut27.idx
500153564 gbaut3.idx
524756262 gbaut4.idx
500469364 gbaut5.idx
500118494 gbaut6.idx
500631383 gbaut7.idx
503910882 gbaut8.idx
517627545 gbaut9.idx
250012199 gbbct1.seq
250024196 gbbct10.seq
64789970 gbbct11.seq
250002811 gbbct2.seq
250354301 gbbct3.seq
250001898 gbbct4.seq
254186382 gbbct5.seq
250000019 gbbct6.seq
253224683 gbbct7.seq
250326956 gbbct8.seq
250012494 gbbct9.seq
6289176 gbchg.txt
1048001689 gbcon.seq
195594 gbdel.txt
230688653 gbest1.seq
230689574 gbest10.seq
230688356 gbest100.seq
230689961 gbest101.seq
230689005 gbest102.seq
230687482 gbest103.seq
230690001 gbest104.seq
230688055 gbest105.seq
230689314 gbest106.seq
230689474 gbest107.seq
230688187 gbest108.seq
229161031 gbest109.seq
230689356 gbest11.seq
230690084 gbest110.seq
230691469 gbest111.seq
230688900 gbest112.seq
230688007 gbest113.seq
230687559 gbest114.seq
230688033 gbest115.seq
230689639 gbest116.seq
230687547 gbest117.seq
230690208 gbest118.seq
230688481 gbest119.seq
230687819 gbest12.seq
230688319 gbest120.seq
230689638 gbest121.seq
230688216 gbest122.seq
230688394 gbest123.seq
227991590 gbest124.seq
230689171 gbest125.seq
230689071 gbest126.seq
230688007 gbest127.seq
230690874 gbest128.seq
230689964 gbest129.seq
230688366 gbest13.seq
230688771 gbest130.seq
230688471 gbest131.seq
230687998 gbest132.seq
230690541 gbest133.seq
230690583 gbest134.seq
230689011 gbest135.seq
230688811 gbest136.seq
230687948 gbest137.seq
230687569 gbest138.seq
230690875 gbest139.seq
230687613 gbest14.seq
230689607 gbest140.seq
230687817 gbest141.seq
230688004 gbest142.seq
230689012 gbest143.seq
230688494 gbest144.seq
230690020 gbest145.seq
230689246 gbest146.seq
230688550 gbest147.seq
230690587 gbest148.seq
230689750 gbest149.seq
230688077 gbest15.seq
230690482 gbest150.seq
230692344 gbest151.seq
230688627 gbest152.seq
230687869 gbest153.seq
230688676 gbest154.seq
230689545 gbest155.seq
230689636 gbest156.seq
230690824 gbest157.seq
230688066 gbest158.seq
230690124 gbest159.seq
230688325 gbest16.seq
230689376 gbest160.seq
230689295 gbest161.seq
230688063 gbest162.seq
230688752 gbest163.seq
230688780 gbest164.seq
230688011 gbest165.seq
230687836 gbest166.seq
230689995 gbest167.seq
230690595 gbest168.seq
230689929 gbest169.seq
230689216 gbest17.seq
230689442 gbest170.seq
230691249 gbest171.seq
230688639 gbest172.seq
230688956 gbest173.seq
230690199 gbest174.seq
230689044 gbest175.seq
230689517 gbest176.seq
230687700 gbest177.seq
230688117 gbest178.seq
230689832 gbest179.seq
230690038 gbest18.seq
230689671 gbest180.seq
230690001 gbest181.seq
230690113 gbest182.seq
230690249 gbest183.seq
230690457 gbest184.seq
230690097 gbest185.seq
230690620 gbest186.seq
230690578 gbest187.seq
230689539 gbest188.seq
230689281 gbest189.seq
230687875 gbest19.seq
230688901 gbest190.seq
230690905 gbest191.seq
230689749 gbest192.seq
230687517 gbest193.seq
230687497 gbest194.seq
230687636 gbest195.seq
230687496 gbest196.seq
230689297 gbest197.seq
230688817 gbest198.seq
230688500 gbest199.seq
230407561 gbest2.seq
230689309 gbest20.seq
230689315 gbest200.seq
230688612 gbest201.seq
230689676 gbest202.seq
230690554 gbest203.seq
230688590 gbest204.seq
230689839 gbest205.seq
230689578 gbest206.seq
230689638 gbest207.seq
230689013 gbest208.seq
230689473 gbest209.seq
230688974 gbest21.seq
229441448 gbest210.seq
162425647 gbest211.seq
161389367 gbest212.seq
168147489 gbest213.seq
167514334 gbest214.seq
167485919 gbest215.seq
164693138 gbest216.seq
164299359 gbest217.seq
163901082 gbest218.seq
163741045 gbest219.seq
230689675 gbest22.seq
163699170 gbest220.seq
163810211 gbest221.seq
162814297 gbest222.seq
166412078 gbest223.seq
163696844 gbest224.seq
161372973 gbest225.seq
164511588 gbest226.seq
167994496 gbest227.seq
166109086 gbest228.seq
165039870 gbest229.seq
230689648 gbest23.seq
165260200 gbest230.seq
164510889 gbest231.seq
164100773 gbest232.seq
163628852 gbest233.seq
164017740 gbest234.seq
164489888 gbest235.seq
173895341 gbest236.seq
175809054 gbest237.seq
174065055 gbest238.seq
230689068 gbest239.seq
230687463 gbest24.seq
230689149 gbest240.seq
230690110 gbest241.seq
230688085 gbest242.seq
230689804 gbest243.seq
230689456 gbest244.seq
230690299 gbest245.seq
230689954 gbest246.seq
230690063 gbest247.seq
230688706 gbest248.seq
230687464 gbest249.seq
230690247 gbest25.seq
230689024 gbest250.seq
230691669 gbest251.seq
230687794 gbest252.seq
230689331 gbest253.seq
230689279 gbest254.seq
230689438 gbest255.seq
230688808 gbest256.seq
230687687 gbest257.seq
230688423 gbest258.seq
230689752 gbest259.seq
230690490 gbest26.seq
230687812 gbest260.seq
230687618 gbest261.seq
230690592 gbest262.seq
230690323 gbest263.seq
230688433 gbest264.seq
230690472 gbest265.seq
230689511 gbest266.seq
215695488 gbest267.seq
212956306 gbest268.seq
230689035 gbest269.seq
230688142 gbest27.seq
230687682 gbest270.seq
230688384 gbest271.seq
230688777 gbest272.seq
230691184 gbest273.seq
230689379 gbest274.seq
230688132 gbest275.seq
230689590 gbest276.seq
230689046 gbest277.seq
230687911 gbest278.seq
230688066 gbest279.seq
230688280 gbest28.seq
230689122 gbest280.seq
230688786 gbest281.seq
230688976 gbest282.seq
230690195 gbest283.seq
230689754 gbest284.seq
230690198 gbest285.seq
230688282 gbest286.seq
230687977 gbest287.seq
230689032 gbest288.seq
230689091 gbest289.seq
230688740 gbest29.seq
230689507 gbest290.seq
230690563 gbest291.seq
230687769 gbest292.seq
230688851 gbest293.seq
230687622 gbest294.seq
230687498 gbest295.seq
230690865 gbest296.seq
230688859 gbest297.seq
230688096 gbest298.seq
166912445 gbest299.seq
230687602 gbest3.seq
230687964 gbest30.seq
178017135 gbest300.seq
230690649 gbest301.seq
230688927 gbest302.seq
230689577 gbest303.seq
230688309 gbest304.seq
230690154 gbest305.seq
230690668 gbest306.seq
230689657 gbest307.seq
230689160 gbest308.seq
230689173 gbest309.seq
230689155 gbest31.seq
230687945 gbest310.seq
230689059 gbest311.seq
230687611 gbest312.seq
230687693 gbest313.seq
230689960 gbest314.seq
230687625 gbest315.seq
230688985 gbest316.seq
230690034 gbest317.seq
230687903 gbest318.seq
230688956 gbest319.seq
230689814 gbest32.seq
230689592 gbest320.seq
230688125 gbest321.seq
230688860 gbest322.seq
230687850 gbest323.seq
230690170 gbest324.seq
230689935 gbest325.seq
230687558 gbest326.seq
230689136 gbest327.seq
230687666 gbest328.seq
230688007 gbest329.seq
230689672 gbest33.seq
230690767 gbest330.seq
230693030 gbest331.seq
230689643 gbest332.seq
230688245 gbest333.seq
230689898 gbest334.seq
230689300 gbest335.seq
230687683 gbest336.seq
230691762 gbest337.seq
230689888 gbest338.seq
230687684 gbest339.seq
230690295 gbest34.seq
227234185 gbest340.seq
230687520 gbest341.seq
230690298 gbest342.seq
230688354 gbest343.seq
230688025 gbest344.seq
230688469 gbest345.seq
230688658 gbest346.seq
230687569 gbest347.seq
230688584 gbest348.seq
230690126 gbest349.seq
230687709 gbest35.seq
230690035 gbest350.seq
230688933 gbest351.seq
230687481 gbest352.seq
219695231 gbest353.seq
230687645 gbest354.seq
212423292 gbest355.seq
230688876 gbest36.seq
230687780 gbest37.seq
202858400 gbest38.seq
190727563 gbest39.seq
230688424 gbest4.seq
200127378 gbest40.seq
214024052 gbest41.seq
215625750 gbest42.seq
215616453 gbest43.seq
216061058 gbest44.seq
230689069 gbest45.seq
230689193 gbest46.seq
222301537 gbest47.seq
230688236 gbest48.seq
230689133 gbest49.seq
163266048 gbest5.seq
230689144 gbest50.seq
230688604 gbest51.seq
230689298 gbest52.seq
230688068 gbest53.seq
230687994 gbest54.seq
230688744 gbest55.seq
230691451 gbest56.seq
230687601 gbest57.seq
230687761 gbest58.seq
230691936 gbest59.seq
181003512 gbest6.seq
230688715 gbest60.seq
230687799 gbest61.seq
230690461 gbest62.seq
226878867 gbest63.seq
209376345 gbest64.seq
208408037 gbest65.seq
208235261 gbest66.seq
208651587 gbest67.seq
209904982 gbest68.seq
209031201 gbest69.seq
230689588 gbest7.seq
207749786 gbest70.seq
209244232 gbest71.seq
209795531 gbest72.seq
205189924 gbest73.seq
206588415 gbest74.seq
207322573 gbest75.seq
208017923 gbest76.seq
216819298 gbest77.seq
230691526 gbest78.seq
230687530 gbest79.seq
230689218 gbest8.seq
229826867 gbest80.seq
214689360 gbest81.seq
213928286 gbest82.seq
217591313 gbest83.seq
230689408 gbest84.seq
230687786 gbest85.seq
230690003 gbest86.seq
230687672 gbest87.seq
230689218 gbest88.seq
230689673 gbest89.seq
230688426 gbest9.seq
230689823 gbest90.seq
230688302 gbest91.seq
230687936 gbest92.seq
230689821 gbest93.seq
230688843 gbest94.seq
230687716 gbest95.seq
230690187 gbest96.seq
230688976 gbest97.seq
230689388 gbest98.seq
230690860 gbest99.seq
43108977 gbgen.idx
230687681 gbgss1.seq
230689928 gbgss10.seq
228422503 gbgss100.seq
228277659 gbgss101.seq
228211949 gbgss102.seq
227320823 gbgss103.seq
227124944 gbgss104.seq
230689860 gbgss105.seq
230689449 gbgss106.seq
230687634 gbgss107.seq
230688670 gbgss108.seq
72287222 gbgss109.seq
230689158 gbgss11.seq
250002400 gbgss110.seq
250002092 gbgss111.seq
250001256 gbgss112.seq
250000701 gbgss113.seq
250002010 gbgss114.seq
250002587 gbgss115.seq
250002151 gbgss116.seq
250002405 gbgss117.seq
250003543 gbgss118.seq
250001828 gbgss119.seq
230687842 gbgss12.seq
250001628 gbgss120.seq
250003405 gbgss121.seq
250002061 gbgss122.seq
250000027 gbgss123.seq
250001922 gbgss124.seq
250000883 gbgss125.seq
250000187 gbgss126.seq
250000266 gbgss127.seq
250000319 gbgss128.seq
250001563 gbgss129.seq
230687740 gbgss13.seq
250002489 gbgss130.seq
250000671 gbgss131.seq
150221875 gbgss132.seq
230688201 gbgss14.seq
230688928 gbgss15.seq
230688353 gbgss16.seq
230689930 gbgss17.seq
230689083 gbgss18.seq
230689898 gbgss19.seq
230688205 gbgss2.seq
230688923 gbgss20.seq
230689098 gbgss21.seq
230690842 gbgss22.seq
230690473 gbgss23.seq
230687493 gbgss24.seq
230690959 gbgss25.seq
230690407 gbgss26.seq
230688959 gbgss27.seq
230688096 gbgss28.seq
230688596 gbgss29.seq
230688259 gbgss3.seq
230689062 gbgss30.seq
230690057 gbgss31.seq
230687590 gbgss32.seq
230689426 gbgss33.seq
230688209 gbgss34.seq
230689463 gbgss35.seq
230688110 gbgss36.seq
230687897 gbgss37.seq
230689824 gbgss38.seq
230689139 gbgss39.seq
230689474 gbgss4.seq
230689243 gbgss40.seq
230688468 gbgss41.seq
230688724 gbgss42.seq
230688389 gbgss43.seq
230687633 gbgss44.seq
230688443 gbgss45.seq
230690276 gbgss46.seq
230688985 gbgss47.seq
230687871 gbgss48.seq
230689060 gbgss49.seq
230689316 gbgss5.seq
230689820 gbgss50.seq
230687892 gbgss51.seq
230689879 gbgss52.seq
230689893 gbgss53.seq
230690239 gbgss54.seq
230687600 gbgss55.seq
230690323 gbgss56.seq
230688699 gbgss57.seq
230689526 gbgss58.seq
230689364 gbgss59.seq
230688914 gbgss6.seq
230357487 gbgss60.seq
230218510 gbgss61.seq
230688745 gbgss62.seq
230690117 gbgss63.seq
230688185 gbgss64.seq
230687443 gbgss65.seq
230688337 gbgss66.seq
230689470 gbgss67.seq
230688539 gbgss68.seq
230689024 gbgss69.seq
230689588 gbgss7.seq
230688725 gbgss70.seq
230689028 gbgss71.seq
230687758 gbgss72.seq
230688441 gbgss73.seq
230688584 gbgss74.seq
230689328 gbgss75.seq
230689111 gbgss76.seq
230689205 gbgss77.seq
230688795 gbgss78.seq
230689794 gbgss79.seq
230688181 gbgss8.seq
198731879 gbgss80.seq
192345158 gbgss81.seq
219992710 gbgss82.seq
230688840 gbgss83.seq
230687513 gbgss84.seq
230688950 gbgss85.seq
230689246 gbgss86.seq
230689300 gbgss87.seq
230688861 gbgss88.seq
230690085 gbgss89.seq
230687460 gbgss9.seq
230689991 gbgss90.seq
230687462 gbgss91.seq
230687770 gbgss92.seq
230688552 gbgss93.seq
230689687 gbgss94.seq
230689693 gbgss95.seq
230687984 gbgss96.seq
230689734 gbgss97.seq
230687836 gbgss98.seq
227018426 gbgss99.seq
250003342 gbhtc1.seq
250000518 gbhtc2.seq
250000473 gbhtc3.seq
250002541 gbhtc4.seq
250002780 gbhtc5.seq
198523885 gbhtc6.seq
250080261 gbhtg1.seq
250004677 gbhtg10.seq
250218274 gbhtg11.seq
250034046 gbhtg12.seq
250308418 gbhtg13.seq
250297377 gbhtg14.seq
250059415 gbhtg15.seq
250043040 gbhtg16.seq
250004091 gbhtg17.seq
250078471 gbhtg18.seq
250258920 gbhtg19.seq
250006081 gbhtg2.seq
250188664 gbhtg20.seq
250220723 gbhtg21.seq
250041786 gbhtg22.seq
250249357 gbhtg23.seq
250118499 gbhtg24.seq
250245537 gbhtg25.seq
250046600 gbhtg26.seq
250255144 gbhtg27.seq
250132728 gbhtg28.seq
250026340 gbhtg29.seq
250050636 gbhtg3.seq
250176494 gbhtg30.seq
250098750 gbhtg31.seq
250091490 gbhtg32.seq
250207224 gbhtg33.seq
250033341 gbhtg34.seq
250114581 gbhtg35.seq
250327354 gbhtg36.seq
250017268 gbhtg37.seq
250101542 gbhtg38.seq
250063461 gbhtg39.seq
250028264 gbhtg4.seq
250174484 gbhtg40.seq
250207846 gbhtg41.seq
250250451 gbhtg42.seq
250111750 gbhtg43.seq
250007846 gbhtg44.seq
250030274 gbhtg45.seq
250089148 gbhtg46.seq
250104278 gbhtg47.seq
250079514 gbhtg48.seq
250070672 gbhtg49.seq
250186647 gbhtg5.seq
250033433 gbhtg50.seq
250049877 gbhtg51.seq
250204530 gbhtg52.seq
250061455 gbhtg53.seq
250229501 gbhtg54.seq
250098795 gbhtg55.seq
250011590 gbhtg56.seq
250102837 gbhtg57.seq
250049866 gbhtg58.seq
250148811 gbhtg59.seq
250009016 gbhtg6.seq
250097473 gbhtg60.seq
250194819 gbhtg61.seq
101708697 gbhtg62.seq
250171308 gbhtg7.seq
250040403 gbhtg8.seq
250047162 gbhtg9.seq
250016207 gbinv1.seq
250334065 gbinv2.seq
250000495 gbinv3.seq
250000515 gbinv4.seq
250001149 gbinv5.seq
250002267 gbinv6.seq
75006982 gbinv7.seq
1039078863 gbjou.idx
917766492 gbkey.idx
250000571 gbmam1.seq
21345856 gbmam2.seq
26312352 gbnew.txt
250000065 gbpat1.seq
250000465 gbpat10.seq
250001501 gbpat11.seq
250000765 gbpat12.seq
250000766 gbpat13.seq
250000936 gbpat14.seq
250009170 gbpat15.seq
250000708 gbpat16.seq
8452946 gbpat17.seq
250001484 gbpat2.seq
250000779 gbpat3.seq
250000190 gbpat4.seq
250004337 gbpat5.seq
250002026 gbpat6.seq
250000304 gbpat7.seq
250031395 gbpat8.seq
250001330 gbpat9.seq
34866214 gbphg.seq
250049209 gbpln1.seq
250000869 gbpln10.seq
256056099 gbpln11.seq
250001575 gbpln12.seq
196488361 gbpln13.seq
250070289 gbpln2.seq
250001872 gbpln3.seq
250002425 gbpln4.seq
250005538 gbpln5.seq
250037203 gbpln6.seq
250144824 gbpln7.seq
250001803 gbpln8.seq
250000768 gbpln9.seq
250068609 gbpri1.seq
250108826 gbpri10.seq
250148890 gbpri11.seq
250073074 gbpri12.seq
250043461 gbpri13.seq
250142492 gbpri14.seq
250167386 gbpri15.seq
250002223 gbpri16.seq
250016348 gbpri17.seq
250050065 gbpri18.seq
250152594 gbpri19.seq
250051031 gbpri2.seq
250018885 gbpri20.seq
250168051 gbpri21.seq
250071387 gbpri22.seq
250009280 gbpri23.seq
250023605 gbpri24.seq
250144542 gbpri25.seq
250027393 gbpri26.seq
250002000 gbpri27.seq
123556159 gbpri28.seq
250012284 gbpri3.seq
250314918 gbpri4.seq
250021967 gbpri5.seq
250224532 gbpri6.seq
250051766 gbpri7.seq
250263266 gbpri8.seq
250009666 gbpri9.seq
176490 gbrel.txt
250279828 gbrod1.seq
250048500 gbrod10.seq
250048322 gbrod11.seq
250163097 gbrod12.seq
250005250 gbrod13.seq
250072701 gbrod14.seq
231251707 gbrod15.seq
250097898 gbrod2.seq
250293671 gbrod3.seq
250178528 gbrod4.seq
250028191 gbrod5.seq
250120591 gbrod6.seq
250245442 gbrod7.seq
250255275 gbrod8.seq
250011359 gbrod9.seq
3248389208 gbsdr.txt
1557172 gbsec.idx
250002423 gbsts1.seq
250001186 gbsts2.seq
250000126 gbsts3.seq
250002535 gbsts4.seq
83929158 gbsts5.seq
70046617 gbsyn.seq
4048111 gbuna.seq
250003765 gbvrl1.seq
250002236 gbvrl2.seq
250004630 gbvrl3.seq
160732094 gbvrl4.seq
250000480 gbvrt1.seq
250013088 gbvrt2.seq
250006010 gbvrt3.seq
250181366 gbvrt4.seq
250077080 gbvrt5.seq
250268082 gbvrt6.seq
212091473 gbvrt7.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 31328 98806837
BCT10 38856 91449800
BCT11 14614 22264685
BCT2 8378 106564949
BCT3 356 114762906
BCT4 37143 99053071
BCT5 42835 95171032
BCT6 68439 84211678
BCT7 31891 104135290
BCT8 7442 99641037
BCT9 7256 106112136
EST1 68765 26543006
EST10 76840 29909680
EST100 70757 43656793
EST101 73876 42269501
EST102 69617 29630808
EST103 70448 33085081
EST104 64837 34118339
EST105 68963 40225463
EST106 71614 46759387
EST107 76382 33605428
EST108 74974 30618463
EST109 76208 25961443
EST11 76524 29054298
EST110 74201 35672204
EST111 64446 35063711
EST112 79276 43954586
EST113 80011 45433047
EST114 73186 46499446
EST115 68856 43396595
EST116 73228 48274827
EST117 68567 44946923
EST118 73731 44530628
EST119 75632 45068494
EST12 77128 30810517
EST120 74024 47878656
EST121 75505 49401511
EST122 73423 46462077
EST123 78962 39829326
EST124 76941 25814467
EST125 82160 48299055
EST126 75402 44432268
EST127 68052 38329837
EST128 70366 34844690
EST129 67479 38074924
EST13 78350 30262367
EST130 67039 36454675
EST131 69784 42668617
EST132 73080 41713118
EST133 69234 43512775
EST134 69458 41760027
EST135 74541 43030701
EST136 68911 41736922
EST137 59140 33773184
EST138 96391 52179874
EST139 88112 50775263
EST14 79617 31911883
EST140 79940 41149688
EST141 107571 57937351
EST142 107903 57981180
EST143 98579 54449034
EST144 73486 45079092
EST145 99688 58847619
EST146 93781 57492517
EST147 69407 38876394
EST148 66520 30462769
EST149 61062 27934885
EST15 73161 31045605
EST150 56691 27697694
EST151 62920 31173236
EST152 56702 29025380
EST153 79913 55867925
EST154 68819 37153991
EST155 73805 51204800
EST156 70455 39484338
EST157 62029 30991070
EST158 65477 40862067
EST159 66452 30792121
EST16 75631 33145795
EST160 63411 46972276
EST161 71945 40409939
EST162 100001 44110292
EST163 90803 54373707
EST164 103732 60141738
EST165 96456 57231529
EST166 95480 43667542
EST167 92237 43417970
EST168 98248 47898803
EST169 64782 44219583
EST17 84561 34469342
EST170 69274 36867868
EST171 59709 34757937
EST172 70242 44611668
EST173 72371 29530365
EST174 77027 39121982
EST175 73890 41066690
EST176 70614 36218273
EST177 68502 36191589
EST178 70630 52776481
EST179 67282 42237514
EST18 79960 32460279
EST180 69982 35394104
EST181 69723 50194768
EST182 69227 49436414
EST183 73195 38016784
EST184 68376 44491813
EST185 71227 59770716
EST186 64641 47994296
EST187 64400 47143971
EST188 64634 46755745
EST189 65714 46442381
EST19 81624 34024756
EST190 67867 51105930
EST191 62102 40576790
EST192 62310 35791239
EST193 66524 37687633
EST194 69185 39092742
EST195 90999 51227855
EST196 71396 50728078
EST197 89813 52833941
EST198 106813 66068559
EST199 108932 64666615
EST2 75519 28989930
EST20 72327 29020938
EST200 108093 64705869
EST201 103040 67078104
EST202 117882 56446095
EST203 69009 38660972
EST204 70404 50970503
EST205 69201 59309090
EST206 76883 50312802
EST207 80871 39851725
EST208 76691 51645021
EST209 71553 51034896
EST21 72704 33856461
EST210 64690 38532612
EST211 27918 10495935
EST212 28000 10503714
EST213 26877 9860223
EST214 27008 9513414
EST215 27058 9248574
EST216 27350 10237464
EST217 27297 9729402
EST218 27343 10201338
EST219 27329 11599510
EST22 77440 30808545
EST220 27306 11481744
EST221 27358 10576409
EST222 27658 9578729
EST223 27119 8965621
EST224 27650 11208035
EST225 28011 10817238
EST226 27524 11135079
EST227 26746 11804392
EST228 27003 11743793
EST229 27218 10712924
EST23 76976 31908504
EST230 27076 11531117
EST231 27232 11755846
EST232 27357 11329635
EST233 27387 10828206
EST234 27340 10788118
EST235 27301 10649641
EST236 25620 15999883
EST237 25264 16677159
EST238 31639 18550087
EST239 104527 36822002
EST24 75792 34515035
EST240 81263 42916803
EST241 68626 44401227
EST242 69307 44661601
EST243 69011 44583714
EST244 65218 38749368
EST245 78951 45204484
EST246 64186 46469935
EST247 66796 37712905
EST248 70084 35260809
EST249 102722 47352988
EST25 73135 30996916
EST250 79597 44123057
EST251 69612 35840651
EST252 66855 32305195
EST253 70577 42182789
EST254 72976 34751997
EST255 69565 33731166
EST256 75818 48277254
EST257 62577 33469627
EST258 68119 38066300
EST259 82788 44330821
EST26 76141 31298113
EST260 83119 46091945
EST261 80285 56590435
EST262 88317 52955395
EST263 106687 48137955
EST264 79801 46413216
EST265 71930 42112523
EST266 74881 39463992
EST267 69423 33643489
EST268 70395 28914934
EST269 68613 40687185
EST27 79222 35098837
EST270 60706 35565911
EST271 67340 42533185
EST272 69152 40134204
EST273 62789 43313674
EST274 77207 38962612
EST275 82254 43758584
EST276 74112 42627095
EST277 92147 54154408
EST278 116156 49915976
EST279 102612 45889556
EST28 107630 51376969
EST280 68331 36558330
EST281 69786 40755909
EST282 76840 45221807
EST283 76912 38625957
EST284 71358 45535265
EST285 69521 37679061
EST286 60612 37298722
EST287 51258 26375380
EST288 72474 51771640
EST289 69113 40739738
EST29 102512 49779451
EST290 75871 46082242
EST291 65669 37369068
EST292 73237 46630089
EST293 75276 46045945
EST294 67660 55271527
EST295 64288 48927107
EST296 62160 42795157
EST297 60349 32507768
EST298 75055 52449463
EST299 55443 30758353
EST3 74312 30191538
EST30 82311 40797362
EST300 55759 27717044
EST301 70525 40463005
EST302 57472 29083124
EST303 64048 35886271
EST304 67898 43210013
EST305 84309 42086674
EST306 69651 43021892
EST307 70920 42375978
EST308 64805 38531477
EST309 73632 46841451
EST31 67958 60161609
EST310 89352 51038250
EST311 88244 50787520
EST312 68452 36889166
EST313 58484 37277497
EST314 76920 37958607
EST315 52356 28946606
EST316 55036 29613055
EST317 71059 42447105
EST318 97007 45485655
EST319 75974 44653976
EST32 78681 50393761
EST320 74855 50544178
EST321 75339 49010270
EST322 63258 35030806
EST323 77423 36989177
EST324 78527 38646462
EST325 60412 40887661
EST326 65516 36549658
EST327 87010 53053339
EST328 90002 50008263
EST329 69945 39900634
EST33 92367 45585634
EST330 75945 38899123
EST331 47738 29545007
EST332 44476 24392751
EST333 83632 50824209
EST334 82275 45297810
EST335 77353 41474995
EST336 66343 38524545
EST337 59905 40848137
EST338 69880 37697523
EST339 56078 35407638
EST34 85168 46030538
EST340 82832 27007907
EST341 77311 31813955
EST342 69688 41730132
EST343 66600 35490736
EST344 65326 36379929
EST345 67104 47030756
EST346 53945 29464283
EST347 56824 35107246
EST348 103402 41002850
EST349 73146 25949370
EST35 97694 45288595
EST350 73072 27250232
EST351 74230 26424942
EST352 72990 26459582
EST353 77967 26195652
EST354 72336 29307605
EST355 69654 26211042
EST36 96940 50359354
EST37 106301 47740062
EST38 75064 25514370
EST39 69424 18489631
EST4 74672 28141114
EST40 79282 22781034
EST41 44616 12616183
EST42 43559 11829926
EST43 43201 12106591
EST44 43230 11285039
EST45 94299 41411072
EST46 95113 43915111
EST47 92163 47977789
EST48 85965 39617895
EST49 106771 56731414
EST5 48631 15383892
EST50 93323 44858737
EST51 75326 31889114
EST52 68847 30583236
EST53 71546 30989804
EST54 73593 30876564
EST55 83280 33048411
EST56 72318 28235828
EST57 64590 28368452
EST58 73635 31878676
EST59 74467 35258578
EST6 56826 18517789
EST60 75172 32894631
EST61 76012 26977839
EST62 79988 31187261
EST63 70581 30597884
EST64 40137 11467730
EST65 40340 11576230
EST66 40473 12660444
EST67 40701 12284431
EST68 40663 12628412
EST69 40629 12856370
EST7 74724 29429258
EST70 40618 12319420
EST71 40346 12346865
EST72 40530 12428768
EST73 41364 12092832
EST74 41342 12749065
EST75 41291 13053787
EST76 41152 13088476
EST77 44340 12293064
EST78 42831 21876190
EST79 41528 23898341
EST8 76952 30923987
EST80 43715 17958362
EST81 50526 23102733
EST82 51400 21316521
EST83 51817 21524364
EST84 75495 32600733
EST85 74346 29248703
EST86 73665 31750661
EST87 77298 45633767
EST88 78015 41279037
EST89 76597 40099658
EST9 77950 30114437
EST90 78659 38741555
EST91 69824 41137448
EST92 74820 33507544
EST93 75514 38215186
EST94 70637 37078212
EST95 78392 51637117
EST96 66389 34214427
EST97 73291 37072034
EST98 72277 40992891
EST99 73841 44139776
GSS1 91713 39273189
GSS10 76749 44468976
GSS100 73993 46044070
GSS101 74160 45628044
GSS102 74113 45642599
GSS103 73891 45156136
GSS104 74111 44602662
GSS105 82796 55334196
GSS106 85451 57698405
GSS107 80656 53651277
GSS108 84654 49479670
GSS109 24192 14210173
GSS11 69047 35944053
GSS110 88212 65541827
GSS111 84800 63608966
GSS112 102041 47406325
GSS113 75787 65175726
GSS114 76351 64152259
GSS115 77013 63018976
GSS116 77391 62368231
GSS117 81881 68210936
GSS118 80255 50861574
GSS119 85528 60418201
GSS12 74305 38756859
GSS120 102035 61700393
GSS121 88898 46604976
GSS122 82173 65175659
GSS123 69686 58512200
GSS124 68857 60321741
GSS125 62175 59505850
GSS126 99572 64293870
GSS127 123348 75076944
GSS128 118451 77103529
GSS129 98003 52745637
GSS13 75133 37545662
GSS130 86494 55506869
GSS131 105414 55218912
GSS132 59913 27124756
GSS14 72597 32295765
GSS15 74366 38124310
GSS16 74946 43454251
GSS17 69511 32039038
GSS18 57471 29414490
GSS19 57743 28700238
GSS2 90518 40076850
GSS20 59046 25307625
GSS21 64147 39596129
GSS22 62864 29326486
GSS23 59124 31614717
GSS24 73027 41988246
GSS25 62112 23796354
GSS26 58152 27609180
GSS27 74987 35096928
GSS28 57759 31290327
GSS29 92022 43680950
GSS3 88818 42310786
GSS30 77056 40418125
GSS31 74291 43536646
GSS32 71588 43359671
GSS33 81165 40684384
GSS34 76275 40923850
GSS35 83040 48560967
GSS36 94357 62683498
GSS37 89240 48946038
GSS38 95186 60017142
GSS39 83529 36503880
GSS4 79866 41698333
GSS40 86444 34519619
GSS41 81718 52236870
GSS42 80958 57768323
GSS43 74513 50824466
GSS44 72818 48041482
GSS45 73827 46245734
GSS46 80426 40847200
GSS47 84698 54165865
GSS48 92020 64495793
GSS49 79895 59113993
GSS5 80013 41184511
GSS50 94527 58047151
GSS51 88659 58452049
GSS52 78436 46304274
GSS53 71743 37377493
GSS54 88080 51428973
GSS55 87344 55590321
GSS56 79393 63061842
GSS57 72068 79209536
GSS58 84623 70564481
GSS59 91447 62952983
GSS6 78468 39193980
GSS60 64627 44332068
GSS61 65040 44951528
GSS62 89750 66895920
GSS63 86612 60272300
GSS64 87354 53492113
GSS65 88485 57593021
GSS66 97211 59531330
GSS67 101987 55040526
GSS68 101856 55202730
GSS69 102665 54195880
GSS7 77055 39730209
GSS70 103702 52902813
GSS71 103682 52927590
GSS72 103971 52566729
GSS73 103352 53338545
GSS74 99787 57488287
GSS75 90217 69602482
GSS76 89828 70788225
GSS77 88129 69630287
GSS78 87822 69679637
GSS79 89372 63452603
GSS8 77547 38217094
GSS80 82333 25662883
GSS81 79039 24846711
GSS82 89076 36645578
GSS83 84319 50933314
GSS84 80937 49027746
GSS85 89649 64758910
GSS86 78622 62222373
GSS87 78203 79471505
GSS88 78566 57555455
GSS89 91523 53360884
GSS9 73643 37744628
GSS90 74613 39526672
GSS91 85899 54560682
GSS92 73925 58735139
GSS93 86174 52512849
GSS94 82937 61436062
GSS95 86333 57581400
GSS96 85419 54443471
GSS97 86620 61800475
GSS98 81227 60023468
GSS99 75628 41971008
HTC1 32058 55427426
HTC2 31311 66327861
HTC3 70557 42235313
HTC4 86481 76794312
HTC5 97776 86114623
HTC6 47613 81482910
HTG1 1318 188927273
HTG10 1229 186801132
HTG11 1426 184119848
HTG12 918 191864170
HTG13 752 192483005
HTG14 745 192408774
HTG15 773 192206767
HTG16 799 192047376
HTG17 772 192169615
HTG18 1862 174771786
HTG19 1143 187386205
HTG2 2384 186082526
HTG20 1198 186525265
HTG21 823 191670191
HTG22 787 191846965
HTG23 945 190514840
HTG24 903 190904504
HTG25 845 191320201
HTG26 769 192107085
HTG27 864 191544020
HTG28 873 191592472
HTG29 902 190695520
HTG3 2531 185223113
HTG30 978 190421825
HTG31 932 190877495
HTG32 970 190448077
HTG33 873 191422665
HTG34 861 191673640
HTG35 997 189825936
HTG36 884 191439053
HTG37 858 191502734
HTG38 826 191895591
HTG39 886 191067732
HTG4 2617 188653188
HTG40 986 190288335
HTG41 935 190955666
HTG42 959 190747406
HTG43 1119 188421538
HTG44 1118 188295776
HTG45 1343 187150797
HTG46 1152 189314320
HTG47 1142 187873316
HTG48 1117 191532335
HTG49 1277 190916529
HTG5 1287 185730220
HTG50 1169 191198223
HTG51 1222 191346070
HTG52 1170 191115994
HTG53 1260 190124233
HTG54 1351 188416250
HTG55 1182 192301467
HTG56 1173 190820969
HTG57 1048 192222939
HTG58 1057 193655357
HTG59 1050 193504253
HTG6 1276 185167485
HTG60 1046 193741535
HTG61 1068 193407079
HTG62 421 74937291
HTG7 1242 185807065
HTG8 1289 184885664
HTG9 1194 186962522
INV1 14264 166449989
INV2 1459 167583581
INV3 49940 99458288
INV4 72220 75999408
INV5 73182 81215693
INV6 35342 112198204
INV7 9581 34203856
MAM1 60992 103717040
MAM2 6057 7063075
PAT1 223047 70322804
PAT10 100441 62699761
PAT11 122941 53181620
PAT12 152417 55279964
PAT13 165583 75472474
PAT14 103395 123012723
PAT15 128457 101180971
PAT16 138521 89180249
PAT17 8523 2210074
PAT2 199655 89404948
PAT3 180653 98968702
PAT4 150820 93961248
PAT5 131163 99600311
PAT6 133483 100542768
PAT7 128491 101791718
PAT8 138235 92191960
PAT9 134595 51546541
PHG 2777 13638774
PLN1 30441 127326216
PLN10 78143 78168555
PLN11 36039 120026342
PLN12 37228 117893459
PLN13 36715 77325665
PLN2 1366 180177631
PLN3 39868 123304417
PLN4 78050 76851206
PLN5 44504 54845220
PLN6 17334 111711310
PLN7 1258 167035748
PLN8 29715 117320441
PLN9 66755 66936872
PRI1 18096 151258319
PRI10 1410 176400336
PRI11 1266 175642772
PRI12 1501 175189575
PRI13 1594 178598209
PRI14 1520 184342150
PRI15 23398 152998041
PRI16 42481 95874912
PRI17 13962 148668542
PRI18 1605 184089329
PRI19 1756 183184645
PRI2 1424 172705716
PRI20 2118 182267584
PRI21 1574 186857943
PRI22 36863 127371616
PRI23 40263 75520766
PRI24 9233 165790189
PRI25 19189 156583955
PRI26 51091 118318493
PRI27 35422 131694343
PRI28 31917 46417991
PRI3 1255 182696059
PRI4 1296 178201137
PRI5 1145 173858820
PRI6 1194 178827445
PRI7 1216 177228602
PRI8 1329 169656515
PRI9 1224 177338444
ROD1 8819 170961496
ROD10 26730 146521250
ROD11 1186 192099742
ROD12 1253 193815435
ROD13 22799 155429183
ROD14 24822 97463413
ROD15 46063 103816602
ROD2 909 174162462
ROD3 899 174790078
ROD4 916 174710686
ROD5 983 181088703
ROD6 981 180915250
ROD7 1011 182847716
ROD8 997 183828023
ROD9 1035 187646528
STS1 89188 48035330
STS2 75357 31334117
STS3 94358 38095577
STS4 85932 35103565
STS5 35761 16128425
SYN 16094 24038436
UNA 1727 784447
VRL1 72774 65398621
VRL2 73304 65439138
VRL3 72891 69062202
VRL4 46912 43822176
VRT1 62890 98015624
VRT2 8582 176824107
VRT3 68651 67534005
VRT4 11383 152295139
VRT5 1280 192906701
VRT6 8241 182263356
VRT7 43684 97910708
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 145.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
8376552 10989131784 Homo sapiens
6132699 6848679400 Mus musculus
993256 5649466676 Rattus norvegicus
778558 2056804290 Danio rerio
2296840 1461369501 Zea mays
350371 789588901 Oryza sativa (japonica cultivar-group)
964476 763841230 Bos taurus
483627 757813573 Drosophila melanogaster
700739 608211036 Gallus gallus
873234 600848477 Arabidopsis thaliana
1033368 593604465 Canis familiaris
563430 469515364 Xenopus tropicalis
767142 451237134 Sorghum bicolor
193693 445348260 Pan troglodytes
693134 418143999 Ciona intestinalis
595918 403981007 Brassica oleracea
56041 376601146 Macaca mulatta
561768 353804633 Sus scrofa
351861 341281507 Medicago truncatula
595592 333427484 Triticum aestivum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 October 2004
NCBI-GenBank Flat File Release 145.0
Bacterial Sequences (Part 1)
37811 loci, 97585608 bases, from 37811 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
bits-request@ncbi.nlm.nih.gov
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A.,
Wheeler D.L. GenBank. Nucl. Acids Res. 28(1):15-18 (2000)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:
ftp://genbank.sdsc.edu/pub
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to
indicate the GenBank release number (e.g., Release 145.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
Renata Geer, Scott McGinnis, Donna Messersmith, Rana Morris, Vyvy Pham,
Monica Romiti, Eric Sayers, Tao Tao, David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241