U.S. flag

An official website of the United States government

Release Notes For GenBank Release 145

GBREL.TXT          Genetic Sequence Data Bank
                         December 15 2004

               NCBI-GenBank Flat File Release 145.0

                    Distribution Release Notes

 40604319 loci, 44575745176 bases, from 40604319 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 145.0
1.2 Cutoff Date
1.3 Important Changes in Release 145.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 145.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 145.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

Mirrors of the GenBank FTP site at the NCBI are available from the San Diego
Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from these alternate sites when traffic at
the NCBI is high.

        *** NOTE *** The SDSC GenBank mirror site is experiencing problems
	caused by disk space limitations. Users of this site should closely
	check the file content (total number of files and their dates) at
	the mirror before using it. We will provide further details about
	the status of the SDSC mirror as they become available.

1.2 Cutoff Date

  This full release, 145.0, incorporates data available to the collaborating
databases as of December 16, 2004 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 145.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 21 with this release:

  - the BCT division is now comprised of  11 files (+1)
  - the EST division is now comprised of 355 files (+6)
  - the GSS division is now comprised of 132 files (+12)
  - the PAT division is now comprised of  17 files (+1)
  - the ROD division is now comprised of  15 files (+1)

1.3.2 New gap feature

  A new feature key for sequence gaps becomes legal as of this December 2004
GenBank release:

Feature key           gap

Definition            gap in the sequence
Mandatory qualifiers  /estimated_length=unknown or <integer>
Optional qualifiers   /map="text"
                      /note="text"
Comment               the location span of the gap feature for an unknown 
                      gap is 100 bp, with the 100 bp indicated as 100 "n"s in 
                      the sequence.  Where estimated length is indicated by 
                      an integer, this is indicated by the same number of 
                      "n"s in the sequence. 
                      No upper or lower limit is set on the size of the gap.


  Gap features will begin to appear in post-Release 145.0 GenBank Update files
in early January of 2005. They will frequently be seen in Phase 0, 1, and 2 HTG
records : each gap feature will coincide with the runs of N's in the sequence
data that separate adjacent sequence contigs.

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
twenty-three GSS flatfiles in Release 145.0. Consider gbgss110.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                          December 15 2004

                NCBI-GenBank Flat File Release 145.0

                           GSS Sequences (Part 1)

   88212 loci,    65541827 bases, from    88212 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "110" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New ENV Division in April 2005

  A new division for sequences obtained via environmental sampling methods
will be introduced with GenBank Release 147.0 in April 2005 . Records in this
new division will have these characteristics:

  1. ENV division code on the LOCUS line
  2. ENV keyword
  3. /environmental_sample qualifier in the source feature

This new division will segregate sequences for which the source organism is
unknown, or can only be inferred by sequence comparison.

  Sequences from WGS projects that involve environmental sampling will *not*
be distributed via this new division. All WGS projects will continue to be
distributed using project-specific data files at the NCBI FTP site:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	ftp://ftp.ncbi.nih.gov/genbank/wgs

  Additional information about the new ENV division will be provided via
these release notes and the GenBank newsgroup.  

1.4.2 Continuous ranges of secondary accessions

  With the removal of sequence length limits, some genomes (typically
bacterial) that had been split into many pieces are gradually being
replaced by a single sequence record. U00096 is a good example.

  When this happens, the accessions of the former small pieces become
secondary accessions for the single large sequence record. When each
secondary is separately listed, the ACCESSION line becomes excessively
lengthy.

  As of GenBank Release 146.0 in February 2005, it will be legal to
represent continuous ranges of secondary accessions by a start accession,
a dash character, and an end accession. In the case of U00096, the
ACCESSION line would thus look like:

	ACCESSION   U00096 AE000111-AE000510

  Further details about the conventions for secondary accession ranges
will be provided via these release notes and the GenBank newsgroup.  

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

  The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 705 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut3.idx - Index of the entries according to accession number, part 3.
23. gbaut4.idx - Index of the entries according to accession number, part 4.
24. gbaut5.idx - Index of the entries according to accession number, part 5.
25. gbaut6.idx - Index of the entries according to accession number, part 6.
26. gbaut7.idx - Index of the entries according to accession number, part 7.
27. gbaut8.idx - Index of the entries according to accession number, part 8.
28. gbaut9.idx - Index of the entries according to accession number, part 9.
29. gbbct1.seq - Bacterial sequence entries, part 1.
30. gbbct10.seq - Bacterial sequence entries, part 10.
31. gbbct11.seq - Bacterial sequence entries, part 11.
32. gbbct2.seq - Bacterial sequence entries, part 2.
33. gbbct3.seq - Bacterial sequence entries, part 3.
34. gbbct4.seq - Bacterial sequence entries, part 4.
35. gbbct5.seq - Bacterial sequence entries, part 5.
36. gbbct6.seq - Bacterial sequence entries, part 6.
37. gbbct7.seq - Bacterial sequence entries, part 7.
38. gbbct8.seq - Bacterial sequence entries, part 8.
39. gbbct9.seq - Bacterial sequence entries, part 9.
40. gbchg.txt - Accession numbers of entries updated since the previous release.
41. gbcon.seq - Constructed sequence entries.
42. gbdel.txt - Accession numbers of entries deleted since the previous release.
43. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
44. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
45. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
46. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
47. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
48. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
49. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
50. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
51. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
52. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
53. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
54. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
55. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
56. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
57. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
58. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
59. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
60. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
61. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
62. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
63. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
64. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
65. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
66. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
67. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
68. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
69. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
70. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
71. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
72. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
73. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
74. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
75. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
76. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
77. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
78. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
79. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
80. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
81. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
82. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
83. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
84. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
85. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
86. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
87. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
88. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
89. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
90. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
91. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
92. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
93. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
94. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
95. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
96. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
97. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
98. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
99. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
100. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
101. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
102. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
103. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
104. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
105. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
106. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
107. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
108. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
109. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
110. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
111. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
112. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
113. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
114. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
115. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
116. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
117. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
118. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
119. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
120. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
121. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
122. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
123. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
124. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
125. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
126. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
127. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
128. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
129. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
130. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
131. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
132. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
133. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
134. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
135. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
136. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
137. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
138. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
139. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
140. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
141. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
142. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
143. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
144. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
145. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
146. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
147. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
148. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
149. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
150. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
151. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
152. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
153. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
154. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
155. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
156. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
157. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
158. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
159. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
160. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
161. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
162. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
163. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
164. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
165. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
166. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
167. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
168. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
169. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
170. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
171. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
172. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
173. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
174. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
175. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
176. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
177. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
178. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
179. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
180. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
181. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
182. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
183. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
184. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
185. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
186. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
187. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
188. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
189. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
190. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
191. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
192. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
193. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
194. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
195. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
196. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
197. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
198. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
199. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
200. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
201. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
202. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
203. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
204. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
205. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
206. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
207. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
208. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
209. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
210. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
211. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
212. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
213. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
214. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
215. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
216. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
217. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
218. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
219. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
220. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
221. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
222. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
223. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
224. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
225. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
226. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
227. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
228. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
229. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
230. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
231. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
232. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
233. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
234. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
235. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
236. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
237. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
238. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
239. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
240. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
241. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
242. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
243. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
244. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
245. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
246. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
247. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
248. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
249. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
250. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
251. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
252. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
253. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
254. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
255. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
256. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
257. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
258. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
259. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
260. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
261. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
262. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
263. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
264. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
265. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
266. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
267. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
268. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
269. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
270. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
271. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
272. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
273. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
274. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
275. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
276. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
277. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
278. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
279. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
280. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
281. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
282. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
283. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
284. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
285. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
286. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
287. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
288. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
289. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
290. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
291. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
292. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
293. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
294. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
295. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
296. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
297. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
298. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
299. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
300. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
301. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
302. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
303. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
304. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
305. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
306. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
307. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
308. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
309. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
310. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
311. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
312. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
313. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
314. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
315. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
316. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
317. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
318. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
319. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
320. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
321. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
322. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
323. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
324. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
325. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
326. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
327. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
328. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
329. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
330. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
331. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
332. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
333. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
334. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
335. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
336. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
337. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
338. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
339. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
340. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
341. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
342. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
343. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
344. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
345. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
346. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
347. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
348. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
349. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
350. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
351. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
352. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
353. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
354. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
355. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
356. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
357. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
358. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
359. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
360. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
361. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
362. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
363. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
364. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
365. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
366. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
367. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
368. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
369. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
370. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
371. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
372. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
373. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
374. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
375. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
376. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
377. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
378. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
379. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
380. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
381. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
382. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
383. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
384. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
385. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
386. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
387. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
388. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
389. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
390. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
391. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
392. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
393. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
394. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
395. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
396. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
397. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
398. gbgen.idx - Index of the entries according to gene symbols.
399. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
400. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
401. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
402. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
403. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
404. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
405. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
406. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
407. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
408. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
409. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
410. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
411. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
412. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
413. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
414. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
415. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
416. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
417. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
418. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
419. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
420. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
421. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
422. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
423. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
424. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
425. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
426. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
427. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
428. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
429. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
430. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
431. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
432. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
433. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
434. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
435. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
436. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
437. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
438. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
439. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
440. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
441. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
442. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
443. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
444. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
445. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
446. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
447. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
448. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
449. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
450. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
451. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
452. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
453. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
454. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
455. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
456. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
457. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
458. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
459. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
460. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
461. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
462. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
463. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
464. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
465. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
466. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
467. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
468. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
469. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
470. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
471. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
472. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
473. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
474. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
475. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
476. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
477. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
478. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
479. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
480. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
481. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
482. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
483. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
484. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
485. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
486. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
487. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
488. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
489. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
490. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
491. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
492. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
493. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
494. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
495. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
496. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
497. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
498. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
499. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
500. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
501. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
502. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
503. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
504. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
505. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
506. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
507. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
508. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
509. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
510. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
511. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
512. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
513. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
514. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
515. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
516. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
517. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
518. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
519. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
520. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
521. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
522. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
523. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
524. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
525. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
526. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
527. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
528. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
529. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
530. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
531. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
532. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
533. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
534. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
535. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
536. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
537. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
538. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
539. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
540. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
541. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
542. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
543. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
544. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
545. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
546. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
547. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
548. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
549. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
550. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
551. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
552. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
553. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
554. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
555. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
556. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
557. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
558. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
559. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
560. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
561. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
562. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
563. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
564. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
565. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
566. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
567. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
568. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
569. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
570. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
571. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
572. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
573. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
574. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
575. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
576. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
577. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
578. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
579. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
580. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
581. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
582. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
583. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
584. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
585. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
586. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
587. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
588. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
589. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
590. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
591. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
592. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
593. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
594. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
595. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
596. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
597. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
598. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
599. gbinv1.seq - Invertebrate sequence entries, part 1.
600. gbinv2.seq - Invertebrate sequence entries, part 2.
601. gbinv3.seq - Invertebrate sequence entries, part 3.
602. gbinv4.seq - Invertebrate sequence entries, part 4.
603. gbinv5.seq - Invertebrate sequence entries, part 5.
604. gbinv6.seq - Invertebrate sequence entries, part 6.
605. gbinv7.seq - Invertebrate sequence entries, part 7.
606. gbjou.idx - Index of the entries according to journal citation.
607. gbkey.idx - Index of the entries according to keyword phrase.
608. gbmam1.seq - Other mammalian sequence entries, part 1.
609. gbmam2.seq - Other mammalian sequence entries, part 2.
610. gbnew.txt - Accession numbers of entries new since the previous release.
611. gbpat1.seq - Patent sequence entries, part 1.
612. gbpat10.seq - Patent sequence entries, part 10.
613. gbpat11.seq - Patent sequence entries, part 11.
614. gbpat12.seq - Patent sequence entries, part 12.
615. gbpat13.seq - Patent sequence entries, part 13.
616. gbpat14.seq - Patent sequence entries, part 14.
617. gbpat15.seq - Patent sequence entries, part 15.
618. gbpat16.seq - Patent sequence entries, part 16.
619. gbpat17.seq - Patent sequence entries, part 17.
620. gbpat2.seq - Patent sequence entries, part 2.
621. gbpat3.seq - Patent sequence entries, part 3.
622. gbpat4.seq - Patent sequence entries, part 4.
623. gbpat5.seq - Patent sequence entries, part 5.
624. gbpat6.seq - Patent sequence entries, part 6.
625. gbpat7.seq - Patent sequence entries, part 7.
626. gbpat8.seq - Patent sequence entries, part 8.
627. gbpat9.seq - Patent sequence entries, part 9.
628. gbphg.seq - Phage sequence entries.
629. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
630. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
631. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
632. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
633. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
634. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
635. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
636. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
637. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
638. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
639. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
640. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
641. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
642. gbpri1.seq - Primate sequence entries, part 1.
643. gbpri10.seq - Primate sequence entries, part 10.
644. gbpri11.seq - Primate sequence entries, part 11.
645. gbpri12.seq - Primate sequence entries, part 12.
646. gbpri13.seq - Primate sequence entries, part 13.
647. gbpri14.seq - Primate sequence entries, part 14.
648. gbpri15.seq - Primate sequence entries, part 15.
649. gbpri16.seq - Primate sequence entries, part 16.
650. gbpri17.seq - Primate sequence entries, part 17.
651. gbpri18.seq - Primate sequence entries, part 18.
652. gbpri19.seq - Primate sequence entries, part 19.
653. gbpri2.seq - Primate sequence entries, part 2.
654. gbpri20.seq - Primate sequence entries, part 20.
655. gbpri21.seq - Primate sequence entries, part 21.
656. gbpri22.seq - Primate sequence entries, part 22.
657. gbpri23.seq - Primate sequence entries, part 23.
658. gbpri24.seq - Primate sequence entries, part 24.
659. gbpri25.seq - Primate sequence entries, part 25.
660. gbpri26.seq - Primate sequence entries, part 26.
661. gbpri27.seq - Primate sequence entries, part 27.
662. gbpri28.seq - Primate sequence entries, part 28.
663. gbpri3.seq - Primate sequence entries, part 3.
664. gbpri4.seq - Primate sequence entries, part 4.
665. gbpri5.seq - Primate sequence entries, part 5.
666. gbpri6.seq - Primate sequence entries, part 6.
667. gbpri7.seq - Primate sequence entries, part 7.
668. gbpri8.seq - Primate sequence entries, part 8.
669. gbpri9.seq - Primate sequence entries, part 9.
670. gbrel.txt - Release notes (this document).
671. gbrod1.seq - Rodent sequence entries, part 1.
672. gbrod10.seq - Rodent sequence entries, part 10.
673. gbrod11.seq - Rodent sequence entries, part 11.
674. gbrod12.seq - Rodent sequence entries, part 12.
675. gbrod13.seq - Rodent sequence entries, part 13.
676. gbrod14.seq - Rodent sequence entries, part 14.
677. gbrod15.seq - Rodent sequence entries, part 15.
678. gbrod2.seq - Rodent sequence entries, part 2.
679. gbrod3.seq - Rodent sequence entries, part 3.
680. gbrod4.seq - Rodent sequence entries, part 4.
681. gbrod5.seq - Rodent sequence entries, part 5.
682. gbrod6.seq - Rodent sequence entries, part 6.
683. gbrod7.seq - Rodent sequence entries, part 7.
684. gbrod8.seq - Rodent sequence entries, part 8.
685. gbrod9.seq - Rodent sequence entries, part 9.
686. gbsdr.txt - Short directory of the data bank.
687. gbsec.idx - Index of the entries according to secondary accession number.
688. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
689. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
690. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
691. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
692. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
693. gbsyn.seq - Synthetic and chimeric sequence entries.
694. gbuna.seq - Unannotated sequence entries.
695. gbvrl1.seq - Viral sequence entries, part 1.
696. gbvrl2.seq - Viral sequence entries, part 2.
697. gbvrl3.seq - Viral sequence entries, part 3.
698. gbvrl4.seq - Viral sequence entries, part 4.
699. gbvrt1.seq - Other vertebrate sequence entries, part 1.
700. gbvrt2.seq - Other vertebrate sequence entries, part 2.
701. gbvrt3.seq - Other vertebrate sequence entries, part 3.
702. gbvrt4.seq - Other vertebrate sequence entries, part 4.
703. gbvrt5.seq - Other vertebrate sequence entries, part 5.
704. gbvrt6.seq - Other vertebrate sequence entries, part 6.
705. gbvrt7.seq - Other vertebrate sequence entries, part 7.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 145.0 flatfiles require roughly 153 GB (sequence
files only) or 170 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1332565477     gbacc.idx
 500002331     gbaut1.idx
 512504033     gbaut10.idx
 517607059     gbaut11.idx
 517853498     gbaut12.idx
 501604122     gbaut13.idx
 503326173     gbaut14.idx
 502554177     gbaut15.idx
 506747495     gbaut16.idx
 500090057     gbaut17.idx
 522627766     gbaut18.idx
 506714116     gbaut19.idx
 504097029     gbaut2.idx
 519724644     gbaut20.idx
 524697557     gbaut21.idx
 500055105     gbaut22.idx
 519424006     gbaut23.idx
 511893957     gbaut24.idx
 543869351     gbaut25.idx
 518662237     gbaut26.idx
 237635654     gbaut27.idx
 500153564     gbaut3.idx
 524756262     gbaut4.idx
 500469364     gbaut5.idx
 500118494     gbaut6.idx
 500631383     gbaut7.idx
 503910882     gbaut8.idx
 517627545     gbaut9.idx
 250012199     gbbct1.seq
 250024196     gbbct10.seq
  64789970     gbbct11.seq
 250002811     gbbct2.seq
 250354301     gbbct3.seq
 250001898     gbbct4.seq
 254186382     gbbct5.seq
 250000019     gbbct6.seq
 253224683     gbbct7.seq
 250326956     gbbct8.seq
 250012494     gbbct9.seq
   6289176     gbchg.txt
1048001689     gbcon.seq
    195594     gbdel.txt
 230688653     gbest1.seq
 230689574     gbest10.seq
 230688356     gbest100.seq
 230689961     gbest101.seq
 230689005     gbest102.seq
 230687482     gbest103.seq
 230690001     gbest104.seq
 230688055     gbest105.seq
 230689314     gbest106.seq
 230689474     gbest107.seq
 230688187     gbest108.seq
 229161031     gbest109.seq
 230689356     gbest11.seq
 230690084     gbest110.seq
 230691469     gbest111.seq
 230688900     gbest112.seq
 230688007     gbest113.seq
 230687559     gbest114.seq
 230688033     gbest115.seq
 230689639     gbest116.seq
 230687547     gbest117.seq
 230690208     gbest118.seq
 230688481     gbest119.seq
 230687819     gbest12.seq
 230688319     gbest120.seq
 230689638     gbest121.seq
 230688216     gbest122.seq
 230688394     gbest123.seq
 227991590     gbest124.seq
 230689171     gbest125.seq
 230689071     gbest126.seq
 230688007     gbest127.seq
 230690874     gbest128.seq
 230689964     gbest129.seq
 230688366     gbest13.seq
 230688771     gbest130.seq
 230688471     gbest131.seq
 230687998     gbest132.seq
 230690541     gbest133.seq
 230690583     gbest134.seq
 230689011     gbest135.seq
 230688811     gbest136.seq
 230687948     gbest137.seq
 230687569     gbest138.seq
 230690875     gbest139.seq
 230687613     gbest14.seq
 230689607     gbest140.seq
 230687817     gbest141.seq
 230688004     gbest142.seq
 230689012     gbest143.seq
 230688494     gbest144.seq
 230690020     gbest145.seq
 230689246     gbest146.seq
 230688550     gbest147.seq
 230690587     gbest148.seq
 230689750     gbest149.seq
 230688077     gbest15.seq
 230690482     gbest150.seq
 230692344     gbest151.seq
 230688627     gbest152.seq
 230687869     gbest153.seq
 230688676     gbest154.seq
 230689545     gbest155.seq
 230689636     gbest156.seq
 230690824     gbest157.seq
 230688066     gbest158.seq
 230690124     gbest159.seq
 230688325     gbest16.seq
 230689376     gbest160.seq
 230689295     gbest161.seq
 230688063     gbest162.seq
 230688752     gbest163.seq
 230688780     gbest164.seq
 230688011     gbest165.seq
 230687836     gbest166.seq
 230689995     gbest167.seq
 230690595     gbest168.seq
 230689929     gbest169.seq
 230689216     gbest17.seq
 230689442     gbest170.seq
 230691249     gbest171.seq
 230688639     gbest172.seq
 230688956     gbest173.seq
 230690199     gbest174.seq
 230689044     gbest175.seq
 230689517     gbest176.seq
 230687700     gbest177.seq
 230688117     gbest178.seq
 230689832     gbest179.seq
 230690038     gbest18.seq
 230689671     gbest180.seq
 230690001     gbest181.seq
 230690113     gbest182.seq
 230690249     gbest183.seq
 230690457     gbest184.seq
 230690097     gbest185.seq
 230690620     gbest186.seq
 230690578     gbest187.seq
 230689539     gbest188.seq
 230689281     gbest189.seq
 230687875     gbest19.seq
 230688901     gbest190.seq
 230690905     gbest191.seq
 230689749     gbest192.seq
 230687517     gbest193.seq
 230687497     gbest194.seq
 230687636     gbest195.seq
 230687496     gbest196.seq
 230689297     gbest197.seq
 230688817     gbest198.seq
 230688500     gbest199.seq
 230407561     gbest2.seq
 230689309     gbest20.seq
 230689315     gbest200.seq
 230688612     gbest201.seq
 230689676     gbest202.seq
 230690554     gbest203.seq
 230688590     gbest204.seq
 230689839     gbest205.seq
 230689578     gbest206.seq
 230689638     gbest207.seq
 230689013     gbest208.seq
 230689473     gbest209.seq
 230688974     gbest21.seq
 229441448     gbest210.seq
 162425647     gbest211.seq
 161389367     gbest212.seq
 168147489     gbest213.seq
 167514334     gbest214.seq
 167485919     gbest215.seq
 164693138     gbest216.seq
 164299359     gbest217.seq
 163901082     gbest218.seq
 163741045     gbest219.seq
 230689675     gbest22.seq
 163699170     gbest220.seq
 163810211     gbest221.seq
 162814297     gbest222.seq
 166412078     gbest223.seq
 163696844     gbest224.seq
 161372973     gbest225.seq
 164511588     gbest226.seq
 167994496     gbest227.seq
 166109086     gbest228.seq
 165039870     gbest229.seq
 230689648     gbest23.seq
 165260200     gbest230.seq
 164510889     gbest231.seq
 164100773     gbest232.seq
 163628852     gbest233.seq
 164017740     gbest234.seq
 164489888     gbest235.seq
 173895341     gbest236.seq
 175809054     gbest237.seq
 174065055     gbest238.seq
 230689068     gbest239.seq
 230687463     gbest24.seq
 230689149     gbest240.seq
 230690110     gbest241.seq
 230688085     gbest242.seq
 230689804     gbest243.seq
 230689456     gbest244.seq
 230690299     gbest245.seq
 230689954     gbest246.seq
 230690063     gbest247.seq
 230688706     gbest248.seq
 230687464     gbest249.seq
 230690247     gbest25.seq
 230689024     gbest250.seq
 230691669     gbest251.seq
 230687794     gbest252.seq
 230689331     gbest253.seq
 230689279     gbest254.seq
 230689438     gbest255.seq
 230688808     gbest256.seq
 230687687     gbest257.seq
 230688423     gbest258.seq
 230689752     gbest259.seq
 230690490     gbest26.seq
 230687812     gbest260.seq
 230687618     gbest261.seq
 230690592     gbest262.seq
 230690323     gbest263.seq
 230688433     gbest264.seq
 230690472     gbest265.seq
 230689511     gbest266.seq
 215695488     gbest267.seq
 212956306     gbest268.seq
 230689035     gbest269.seq
 230688142     gbest27.seq
 230687682     gbest270.seq
 230688384     gbest271.seq
 230688777     gbest272.seq
 230691184     gbest273.seq
 230689379     gbest274.seq
 230688132     gbest275.seq
 230689590     gbest276.seq
 230689046     gbest277.seq
 230687911     gbest278.seq
 230688066     gbest279.seq
 230688280     gbest28.seq
 230689122     gbest280.seq
 230688786     gbest281.seq
 230688976     gbest282.seq
 230690195     gbest283.seq
 230689754     gbest284.seq
 230690198     gbest285.seq
 230688282     gbest286.seq
 230687977     gbest287.seq
 230689032     gbest288.seq
 230689091     gbest289.seq
 230688740     gbest29.seq
 230689507     gbest290.seq
 230690563     gbest291.seq
 230687769     gbest292.seq
 230688851     gbest293.seq
 230687622     gbest294.seq
 230687498     gbest295.seq
 230690865     gbest296.seq
 230688859     gbest297.seq
 230688096     gbest298.seq
 166912445     gbest299.seq
 230687602     gbest3.seq
 230687964     gbest30.seq
 178017135     gbest300.seq
 230690649     gbest301.seq
 230688927     gbest302.seq
 230689577     gbest303.seq
 230688309     gbest304.seq
 230690154     gbest305.seq
 230690668     gbest306.seq
 230689657     gbest307.seq
 230689160     gbest308.seq
 230689173     gbest309.seq
 230689155     gbest31.seq
 230687945     gbest310.seq
 230689059     gbest311.seq
 230687611     gbest312.seq
 230687693     gbest313.seq
 230689960     gbest314.seq
 230687625     gbest315.seq
 230688985     gbest316.seq
 230690034     gbest317.seq
 230687903     gbest318.seq
 230688956     gbest319.seq
 230689814     gbest32.seq
 230689592     gbest320.seq
 230688125     gbest321.seq
 230688860     gbest322.seq
 230687850     gbest323.seq
 230690170     gbest324.seq
 230689935     gbest325.seq
 230687558     gbest326.seq
 230689136     gbest327.seq
 230687666     gbest328.seq
 230688007     gbest329.seq
 230689672     gbest33.seq
 230690767     gbest330.seq
 230693030     gbest331.seq
 230689643     gbest332.seq
 230688245     gbest333.seq
 230689898     gbest334.seq
 230689300     gbest335.seq
 230687683     gbest336.seq
 230691762     gbest337.seq
 230689888     gbest338.seq
 230687684     gbest339.seq
 230690295     gbest34.seq
 227234185     gbest340.seq
 230687520     gbest341.seq
 230690298     gbest342.seq
 230688354     gbest343.seq
 230688025     gbest344.seq
 230688469     gbest345.seq
 230688658     gbest346.seq
 230687569     gbest347.seq
 230688584     gbest348.seq
 230690126     gbest349.seq
 230687709     gbest35.seq
 230690035     gbest350.seq
 230688933     gbest351.seq
 230687481     gbest352.seq
 219695231     gbest353.seq
 230687645     gbest354.seq
 212423292     gbest355.seq
 230688876     gbest36.seq
 230687780     gbest37.seq
 202858400     gbest38.seq
 190727563     gbest39.seq
 230688424     gbest4.seq
 200127378     gbest40.seq
 214024052     gbest41.seq
 215625750     gbest42.seq
 215616453     gbest43.seq
 216061058     gbest44.seq
 230689069     gbest45.seq
 230689193     gbest46.seq
 222301537     gbest47.seq
 230688236     gbest48.seq
 230689133     gbest49.seq
 163266048     gbest5.seq
 230689144     gbest50.seq
 230688604     gbest51.seq
 230689298     gbest52.seq
 230688068     gbest53.seq
 230687994     gbest54.seq
 230688744     gbest55.seq
 230691451     gbest56.seq
 230687601     gbest57.seq
 230687761     gbest58.seq
 230691936     gbest59.seq
 181003512     gbest6.seq
 230688715     gbest60.seq
 230687799     gbest61.seq
 230690461     gbest62.seq
 226878867     gbest63.seq
 209376345     gbest64.seq
 208408037     gbest65.seq
 208235261     gbest66.seq
 208651587     gbest67.seq
 209904982     gbest68.seq
 209031201     gbest69.seq
 230689588     gbest7.seq
 207749786     gbest70.seq
 209244232     gbest71.seq
 209795531     gbest72.seq
 205189924     gbest73.seq
 206588415     gbest74.seq
 207322573     gbest75.seq
 208017923     gbest76.seq
 216819298     gbest77.seq
 230691526     gbest78.seq
 230687530     gbest79.seq
 230689218     gbest8.seq
 229826867     gbest80.seq
 214689360     gbest81.seq
 213928286     gbest82.seq
 217591313     gbest83.seq
 230689408     gbest84.seq
 230687786     gbest85.seq
 230690003     gbest86.seq
 230687672     gbest87.seq
 230689218     gbest88.seq
 230689673     gbest89.seq
 230688426     gbest9.seq
 230689823     gbest90.seq
 230688302     gbest91.seq
 230687936     gbest92.seq
 230689821     gbest93.seq
 230688843     gbest94.seq
 230687716     gbest95.seq
 230690187     gbest96.seq
 230688976     gbest97.seq
 230689388     gbest98.seq
 230690860     gbest99.seq
  43108977     gbgen.idx
 230687681     gbgss1.seq
 230689928     gbgss10.seq
 228422503     gbgss100.seq
 228277659     gbgss101.seq
 228211949     gbgss102.seq
 227320823     gbgss103.seq
 227124944     gbgss104.seq
 230689860     gbgss105.seq
 230689449     gbgss106.seq
 230687634     gbgss107.seq
 230688670     gbgss108.seq
  72287222     gbgss109.seq
 230689158     gbgss11.seq
 250002400     gbgss110.seq
 250002092     gbgss111.seq
 250001256     gbgss112.seq
 250000701     gbgss113.seq
 250002010     gbgss114.seq
 250002587     gbgss115.seq
 250002151     gbgss116.seq
 250002405     gbgss117.seq
 250003543     gbgss118.seq
 250001828     gbgss119.seq
 230687842     gbgss12.seq
 250001628     gbgss120.seq
 250003405     gbgss121.seq
 250002061     gbgss122.seq
 250000027     gbgss123.seq
 250001922     gbgss124.seq
 250000883     gbgss125.seq
 250000187     gbgss126.seq
 250000266     gbgss127.seq
 250000319     gbgss128.seq
 250001563     gbgss129.seq
 230687740     gbgss13.seq
 250002489     gbgss130.seq
 250000671     gbgss131.seq
 150221875     gbgss132.seq
 230688201     gbgss14.seq
 230688928     gbgss15.seq
 230688353     gbgss16.seq
 230689930     gbgss17.seq
 230689083     gbgss18.seq
 230689898     gbgss19.seq
 230688205     gbgss2.seq
 230688923     gbgss20.seq
 230689098     gbgss21.seq
 230690842     gbgss22.seq
 230690473     gbgss23.seq
 230687493     gbgss24.seq
 230690959     gbgss25.seq
 230690407     gbgss26.seq
 230688959     gbgss27.seq
 230688096     gbgss28.seq
 230688596     gbgss29.seq
 230688259     gbgss3.seq
 230689062     gbgss30.seq
 230690057     gbgss31.seq
 230687590     gbgss32.seq
 230689426     gbgss33.seq
 230688209     gbgss34.seq
 230689463     gbgss35.seq
 230688110     gbgss36.seq
 230687897     gbgss37.seq
 230689824     gbgss38.seq
 230689139     gbgss39.seq
 230689474     gbgss4.seq
 230689243     gbgss40.seq
 230688468     gbgss41.seq
 230688724     gbgss42.seq
 230688389     gbgss43.seq
 230687633     gbgss44.seq
 230688443     gbgss45.seq
 230690276     gbgss46.seq
 230688985     gbgss47.seq
 230687871     gbgss48.seq
 230689060     gbgss49.seq
 230689316     gbgss5.seq
 230689820     gbgss50.seq
 230687892     gbgss51.seq
 230689879     gbgss52.seq
 230689893     gbgss53.seq
 230690239     gbgss54.seq
 230687600     gbgss55.seq
 230690323     gbgss56.seq
 230688699     gbgss57.seq
 230689526     gbgss58.seq
 230689364     gbgss59.seq
 230688914     gbgss6.seq
 230357487     gbgss60.seq
 230218510     gbgss61.seq
 230688745     gbgss62.seq
 230690117     gbgss63.seq
 230688185     gbgss64.seq
 230687443     gbgss65.seq
 230688337     gbgss66.seq
 230689470     gbgss67.seq
 230688539     gbgss68.seq
 230689024     gbgss69.seq
 230689588     gbgss7.seq
 230688725     gbgss70.seq
 230689028     gbgss71.seq
 230687758     gbgss72.seq
 230688441     gbgss73.seq
 230688584     gbgss74.seq
 230689328     gbgss75.seq
 230689111     gbgss76.seq
 230689205     gbgss77.seq
 230688795     gbgss78.seq
 230689794     gbgss79.seq
 230688181     gbgss8.seq
 198731879     gbgss80.seq
 192345158     gbgss81.seq
 219992710     gbgss82.seq
 230688840     gbgss83.seq
 230687513     gbgss84.seq
 230688950     gbgss85.seq
 230689246     gbgss86.seq
 230689300     gbgss87.seq
 230688861     gbgss88.seq
 230690085     gbgss89.seq
 230687460     gbgss9.seq
 230689991     gbgss90.seq
 230687462     gbgss91.seq
 230687770     gbgss92.seq
 230688552     gbgss93.seq
 230689687     gbgss94.seq
 230689693     gbgss95.seq
 230687984     gbgss96.seq
 230689734     gbgss97.seq
 230687836     gbgss98.seq
 227018426     gbgss99.seq
 250003342     gbhtc1.seq
 250000518     gbhtc2.seq
 250000473     gbhtc3.seq
 250002541     gbhtc4.seq
 250002780     gbhtc5.seq
 198523885     gbhtc6.seq
 250080261     gbhtg1.seq
 250004677     gbhtg10.seq
 250218274     gbhtg11.seq
 250034046     gbhtg12.seq
 250308418     gbhtg13.seq
 250297377     gbhtg14.seq
 250059415     gbhtg15.seq
 250043040     gbhtg16.seq
 250004091     gbhtg17.seq
 250078471     gbhtg18.seq
 250258920     gbhtg19.seq
 250006081     gbhtg2.seq
 250188664     gbhtg20.seq
 250220723     gbhtg21.seq
 250041786     gbhtg22.seq
 250249357     gbhtg23.seq
 250118499     gbhtg24.seq
 250245537     gbhtg25.seq
 250046600     gbhtg26.seq
 250255144     gbhtg27.seq
 250132728     gbhtg28.seq
 250026340     gbhtg29.seq
 250050636     gbhtg3.seq
 250176494     gbhtg30.seq
 250098750     gbhtg31.seq
 250091490     gbhtg32.seq
 250207224     gbhtg33.seq
 250033341     gbhtg34.seq
 250114581     gbhtg35.seq
 250327354     gbhtg36.seq
 250017268     gbhtg37.seq
 250101542     gbhtg38.seq
 250063461     gbhtg39.seq
 250028264     gbhtg4.seq
 250174484     gbhtg40.seq
 250207846     gbhtg41.seq
 250250451     gbhtg42.seq
 250111750     gbhtg43.seq
 250007846     gbhtg44.seq
 250030274     gbhtg45.seq
 250089148     gbhtg46.seq
 250104278     gbhtg47.seq
 250079514     gbhtg48.seq
 250070672     gbhtg49.seq
 250186647     gbhtg5.seq
 250033433     gbhtg50.seq
 250049877     gbhtg51.seq
 250204530     gbhtg52.seq
 250061455     gbhtg53.seq
 250229501     gbhtg54.seq
 250098795     gbhtg55.seq
 250011590     gbhtg56.seq
 250102837     gbhtg57.seq
 250049866     gbhtg58.seq
 250148811     gbhtg59.seq
 250009016     gbhtg6.seq
 250097473     gbhtg60.seq
 250194819     gbhtg61.seq
 101708697     gbhtg62.seq
 250171308     gbhtg7.seq
 250040403     gbhtg8.seq
 250047162     gbhtg9.seq
 250016207     gbinv1.seq
 250334065     gbinv2.seq
 250000495     gbinv3.seq
 250000515     gbinv4.seq
 250001149     gbinv5.seq
 250002267     gbinv6.seq
  75006982     gbinv7.seq
1039078863     gbjou.idx
 917766492     gbkey.idx
 250000571     gbmam1.seq
  21345856     gbmam2.seq
  26312352     gbnew.txt
 250000065     gbpat1.seq
 250000465     gbpat10.seq
 250001501     gbpat11.seq
 250000765     gbpat12.seq
 250000766     gbpat13.seq
 250000936     gbpat14.seq
 250009170     gbpat15.seq
 250000708     gbpat16.seq
   8452946     gbpat17.seq
 250001484     gbpat2.seq
 250000779     gbpat3.seq
 250000190     gbpat4.seq
 250004337     gbpat5.seq
 250002026     gbpat6.seq
 250000304     gbpat7.seq
 250031395     gbpat8.seq
 250001330     gbpat9.seq
  34866214     gbphg.seq
 250049209     gbpln1.seq
 250000869     gbpln10.seq
 256056099     gbpln11.seq
 250001575     gbpln12.seq
 196488361     gbpln13.seq
 250070289     gbpln2.seq
 250001872     gbpln3.seq
 250002425     gbpln4.seq
 250005538     gbpln5.seq
 250037203     gbpln6.seq
 250144824     gbpln7.seq
 250001803     gbpln8.seq
 250000768     gbpln9.seq
 250068609     gbpri1.seq
 250108826     gbpri10.seq
 250148890     gbpri11.seq
 250073074     gbpri12.seq
 250043461     gbpri13.seq
 250142492     gbpri14.seq
 250167386     gbpri15.seq
 250002223     gbpri16.seq
 250016348     gbpri17.seq
 250050065     gbpri18.seq
 250152594     gbpri19.seq
 250051031     gbpri2.seq
 250018885     gbpri20.seq
 250168051     gbpri21.seq
 250071387     gbpri22.seq
 250009280     gbpri23.seq
 250023605     gbpri24.seq
 250144542     gbpri25.seq
 250027393     gbpri26.seq
 250002000     gbpri27.seq
 123556159     gbpri28.seq
 250012284     gbpri3.seq
 250314918     gbpri4.seq
 250021967     gbpri5.seq
 250224532     gbpri6.seq
 250051766     gbpri7.seq
 250263266     gbpri8.seq
 250009666     gbpri9.seq
    176490     gbrel.txt
 250279828     gbrod1.seq
 250048500     gbrod10.seq
 250048322     gbrod11.seq
 250163097     gbrod12.seq
 250005250     gbrod13.seq
 250072701     gbrod14.seq
 231251707     gbrod15.seq
 250097898     gbrod2.seq
 250293671     gbrod3.seq
 250178528     gbrod4.seq
 250028191     gbrod5.seq
 250120591     gbrod6.seq
 250245442     gbrod7.seq
 250255275     gbrod8.seq
 250011359     gbrod9.seq
3248389208     gbsdr.txt
   1557172     gbsec.idx
 250002423     gbsts1.seq
 250001186     gbsts2.seq
 250000126     gbsts3.seq
 250002535     gbsts4.seq
  83929158     gbsts5.seq
  70046617     gbsyn.seq
   4048111     gbuna.seq
 250003765     gbvrl1.seq
 250002236     gbvrl2.seq
 250004630     gbvrl3.seq
 160732094     gbvrl4.seq
 250000480     gbvrt1.seq
 250013088     gbvrt2.seq
 250006010     gbvrt3.seq
 250181366     gbvrt4.seq
 250077080     gbvrt5.seq
 250268082     gbvrt6.seq
 212091473     gbvrt7.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         31328      98806837
BCT10        38856      91449800
BCT11        14614      22264685
BCT2         8378       106564949
BCT3         356        114762906
BCT4         37143      99053071
BCT5         42835      95171032
BCT6         68439      84211678
BCT7         31891      104135290
BCT8         7442       99641037
BCT9         7256       106112136
EST1         68765      26543006
EST10        76840      29909680
EST100       70757      43656793
EST101       73876      42269501
EST102       69617      29630808
EST103       70448      33085081
EST104       64837      34118339
EST105       68963      40225463
EST106       71614      46759387
EST107       76382      33605428
EST108       74974      30618463
EST109       76208      25961443
EST11        76524      29054298
EST110       74201      35672204
EST111       64446      35063711
EST112       79276      43954586
EST113       80011      45433047
EST114       73186      46499446
EST115       68856      43396595
EST116       73228      48274827
EST117       68567      44946923
EST118       73731      44530628
EST119       75632      45068494
EST12        77128      30810517
EST120       74024      47878656
EST121       75505      49401511
EST122       73423      46462077
EST123       78962      39829326
EST124       76941      25814467
EST125       82160      48299055
EST126       75402      44432268
EST127       68052      38329837
EST128       70366      34844690
EST129       67479      38074924
EST13        78350      30262367
EST130       67039      36454675
EST131       69784      42668617
EST132       73080      41713118
EST133       69234      43512775
EST134       69458      41760027
EST135       74541      43030701
EST136       68911      41736922
EST137       59140      33773184
EST138       96391      52179874
EST139       88112      50775263
EST14        79617      31911883
EST140       79940      41149688
EST141       107571     57937351
EST142       107903     57981180
EST143       98579      54449034
EST144       73486      45079092
EST145       99688      58847619
EST146       93781      57492517
EST147       69407      38876394
EST148       66520      30462769
EST149       61062      27934885
EST15        73161      31045605
EST150       56691      27697694
EST151       62920      31173236
EST152       56702      29025380
EST153       79913      55867925
EST154       68819      37153991
EST155       73805      51204800
EST156       70455      39484338
EST157       62029      30991070
EST158       65477      40862067
EST159       66452      30792121
EST16        75631      33145795
EST160       63411      46972276
EST161       71945      40409939
EST162       100001     44110292
EST163       90803      54373707
EST164       103732     60141738
EST165       96456      57231529
EST166       95480      43667542
EST167       92237      43417970
EST168       98248      47898803
EST169       64782      44219583
EST17        84561      34469342
EST170       69274      36867868
EST171       59709      34757937
EST172       70242      44611668
EST173       72371      29530365
EST174       77027      39121982
EST175       73890      41066690
EST176       70614      36218273
EST177       68502      36191589
EST178       70630      52776481
EST179       67282      42237514
EST18        79960      32460279
EST180       69982      35394104
EST181       69723      50194768
EST182       69227      49436414
EST183       73195      38016784
EST184       68376      44491813
EST185       71227      59770716
EST186       64641      47994296
EST187       64400      47143971
EST188       64634      46755745
EST189       65714      46442381
EST19        81624      34024756
EST190       67867      51105930
EST191       62102      40576790
EST192       62310      35791239
EST193       66524      37687633
EST194       69185      39092742
EST195       90999      51227855
EST196       71396      50728078
EST197       89813      52833941
EST198       106813     66068559
EST199       108932     64666615
EST2         75519      28989930
EST20        72327      29020938
EST200       108093     64705869
EST201       103040     67078104
EST202       117882     56446095
EST203       69009      38660972
EST204       70404      50970503
EST205       69201      59309090
EST206       76883      50312802
EST207       80871      39851725
EST208       76691      51645021
EST209       71553      51034896
EST21        72704      33856461
EST210       64690      38532612
EST211       27918      10495935
EST212       28000      10503714
EST213       26877      9860223
EST214       27008      9513414
EST215       27058      9248574
EST216       27350      10237464
EST217       27297      9729402
EST218       27343      10201338
EST219       27329      11599510
EST22        77440      30808545
EST220       27306      11481744
EST221       27358      10576409
EST222       27658      9578729
EST223       27119      8965621
EST224       27650      11208035
EST225       28011      10817238
EST226       27524      11135079
EST227       26746      11804392
EST228       27003      11743793
EST229       27218      10712924
EST23        76976      31908504
EST230       27076      11531117
EST231       27232      11755846
EST232       27357      11329635
EST233       27387      10828206
EST234       27340      10788118
EST235       27301      10649641
EST236       25620      15999883
EST237       25264      16677159
EST238       31639      18550087
EST239       104527     36822002
EST24        75792      34515035
EST240       81263      42916803
EST241       68626      44401227
EST242       69307      44661601
EST243       69011      44583714
EST244       65218      38749368
EST245       78951      45204484
EST246       64186      46469935
EST247       66796      37712905
EST248       70084      35260809
EST249       102722     47352988
EST25        73135      30996916
EST250       79597      44123057
EST251       69612      35840651
EST252       66855      32305195
EST253       70577      42182789
EST254       72976      34751997
EST255       69565      33731166
EST256       75818      48277254
EST257       62577      33469627
EST258       68119      38066300
EST259       82788      44330821
EST26        76141      31298113
EST260       83119      46091945
EST261       80285      56590435
EST262       88317      52955395
EST263       106687     48137955
EST264       79801      46413216
EST265       71930      42112523
EST266       74881      39463992
EST267       69423      33643489
EST268       70395      28914934
EST269       68613      40687185
EST27        79222      35098837
EST270       60706      35565911
EST271       67340      42533185
EST272       69152      40134204
EST273       62789      43313674
EST274       77207      38962612
EST275       82254      43758584
EST276       74112      42627095
EST277       92147      54154408
EST278       116156     49915976
EST279       102612     45889556
EST28        107630     51376969
EST280       68331      36558330
EST281       69786      40755909
EST282       76840      45221807
EST283       76912      38625957
EST284       71358      45535265
EST285       69521      37679061
EST286       60612      37298722
EST287       51258      26375380
EST288       72474      51771640
EST289       69113      40739738
EST29        102512     49779451
EST290       75871      46082242
EST291       65669      37369068
EST292       73237      46630089
EST293       75276      46045945
EST294       67660      55271527
EST295       64288      48927107
EST296       62160      42795157
EST297       60349      32507768
EST298       75055      52449463
EST299       55443      30758353
EST3         74312      30191538
EST30        82311      40797362
EST300       55759      27717044
EST301       70525      40463005
EST302       57472      29083124
EST303       64048      35886271
EST304       67898      43210013
EST305       84309      42086674
EST306       69651      43021892
EST307       70920      42375978
EST308       64805      38531477
EST309       73632      46841451
EST31        67958      60161609
EST310       89352      51038250
EST311       88244      50787520
EST312       68452      36889166
EST313       58484      37277497
EST314       76920      37958607
EST315       52356      28946606
EST316       55036      29613055
EST317       71059      42447105
EST318       97007      45485655
EST319       75974      44653976
EST32        78681      50393761
EST320       74855      50544178
EST321       75339      49010270
EST322       63258      35030806
EST323       77423      36989177
EST324       78527      38646462
EST325       60412      40887661
EST326       65516      36549658
EST327       87010      53053339
EST328       90002      50008263
EST329       69945      39900634
EST33        92367      45585634
EST330       75945      38899123
EST331       47738      29545007
EST332       44476      24392751
EST333       83632      50824209
EST334       82275      45297810
EST335       77353      41474995
EST336       66343      38524545
EST337       59905      40848137
EST338       69880      37697523
EST339       56078      35407638
EST34        85168      46030538
EST340       82832      27007907
EST341       77311      31813955
EST342       69688      41730132
EST343       66600      35490736
EST344       65326      36379929
EST345       67104      47030756
EST346       53945      29464283
EST347       56824      35107246
EST348       103402     41002850
EST349       73146      25949370
EST35        97694      45288595
EST350       73072      27250232
EST351       74230      26424942
EST352       72990      26459582
EST353       77967      26195652
EST354       72336      29307605
EST355       69654      26211042
EST36        96940      50359354
EST37        106301     47740062
EST38        75064      25514370
EST39        69424      18489631
EST4         74672      28141114
EST40        79282      22781034
EST41        44616      12616183
EST42        43559      11829926
EST43        43201      12106591
EST44        43230      11285039
EST45        94299      41411072
EST46        95113      43915111
EST47        92163      47977789
EST48        85965      39617895
EST49        106771     56731414
EST5         48631      15383892
EST50        93323      44858737
EST51        75326      31889114
EST52        68847      30583236
EST53        71546      30989804
EST54        73593      30876564
EST55        83280      33048411
EST56        72318      28235828
EST57        64590      28368452
EST58        73635      31878676
EST59        74467      35258578
EST6         56826      18517789
EST60        75172      32894631
EST61        76012      26977839
EST62        79988      31187261
EST63        70581      30597884
EST64        40137      11467730
EST65        40340      11576230
EST66        40473      12660444
EST67        40701      12284431
EST68        40663      12628412
EST69        40629      12856370
EST7         74724      29429258
EST70        40618      12319420
EST71        40346      12346865
EST72        40530      12428768
EST73        41364      12092832
EST74        41342      12749065
EST75        41291      13053787
EST76        41152      13088476
EST77        44340      12293064
EST78        42831      21876190
EST79        41528      23898341
EST8         76952      30923987
EST80        43715      17958362
EST81        50526      23102733
EST82        51400      21316521
EST83        51817      21524364
EST84        75495      32600733
EST85        74346      29248703
EST86        73665      31750661
EST87        77298      45633767
EST88        78015      41279037
EST89        76597      40099658
EST9         77950      30114437
EST90        78659      38741555
EST91        69824      41137448
EST92        74820      33507544
EST93        75514      38215186
EST94        70637      37078212
EST95        78392      51637117
EST96        66389      34214427
EST97        73291      37072034
EST98        72277      40992891
EST99        73841      44139776
GSS1         91713      39273189
GSS10        76749      44468976
GSS100       73993      46044070
GSS101       74160      45628044
GSS102       74113      45642599
GSS103       73891      45156136
GSS104       74111      44602662
GSS105       82796      55334196
GSS106       85451      57698405
GSS107       80656      53651277
GSS108       84654      49479670
GSS109       24192      14210173
GSS11        69047      35944053
GSS110       88212      65541827
GSS111       84800      63608966
GSS112       102041     47406325
GSS113       75787      65175726
GSS114       76351      64152259
GSS115       77013      63018976
GSS116       77391      62368231
GSS117       81881      68210936
GSS118       80255      50861574
GSS119       85528      60418201
GSS12        74305      38756859
GSS120       102035     61700393
GSS121       88898      46604976
GSS122       82173      65175659
GSS123       69686      58512200
GSS124       68857      60321741
GSS125       62175      59505850
GSS126       99572      64293870
GSS127       123348     75076944
GSS128       118451     77103529
GSS129       98003      52745637
GSS13        75133      37545662
GSS130       86494      55506869
GSS131       105414     55218912
GSS132       59913      27124756
GSS14        72597      32295765
GSS15        74366      38124310
GSS16        74946      43454251
GSS17        69511      32039038
GSS18        57471      29414490
GSS19        57743      28700238
GSS2         90518      40076850
GSS20        59046      25307625
GSS21        64147      39596129
GSS22        62864      29326486
GSS23        59124      31614717
GSS24        73027      41988246
GSS25        62112      23796354
GSS26        58152      27609180
GSS27        74987      35096928
GSS28        57759      31290327
GSS29        92022      43680950
GSS3         88818      42310786
GSS30        77056      40418125
GSS31        74291      43536646
GSS32        71588      43359671
GSS33        81165      40684384
GSS34        76275      40923850
GSS35        83040      48560967
GSS36        94357      62683498
GSS37        89240      48946038
GSS38        95186      60017142
GSS39        83529      36503880
GSS4         79866      41698333
GSS40        86444      34519619
GSS41        81718      52236870
GSS42        80958      57768323
GSS43        74513      50824466
GSS44        72818      48041482
GSS45        73827      46245734
GSS46        80426      40847200
GSS47        84698      54165865
GSS48        92020      64495793
GSS49        79895      59113993
GSS5         80013      41184511
GSS50        94527      58047151
GSS51        88659      58452049
GSS52        78436      46304274
GSS53        71743      37377493
GSS54        88080      51428973
GSS55        87344      55590321
GSS56        79393      63061842
GSS57        72068      79209536
GSS58        84623      70564481
GSS59        91447      62952983
GSS6         78468      39193980
GSS60        64627      44332068
GSS61        65040      44951528
GSS62        89750      66895920
GSS63        86612      60272300
GSS64        87354      53492113
GSS65        88485      57593021
GSS66        97211      59531330
GSS67        101987     55040526
GSS68        101856     55202730
GSS69        102665     54195880
GSS7         77055      39730209
GSS70        103702     52902813
GSS71        103682     52927590
GSS72        103971     52566729
GSS73        103352     53338545
GSS74        99787      57488287
GSS75        90217      69602482
GSS76        89828      70788225
GSS77        88129      69630287
GSS78        87822      69679637
GSS79        89372      63452603
GSS8         77547      38217094
GSS80        82333      25662883
GSS81        79039      24846711
GSS82        89076      36645578
GSS83        84319      50933314
GSS84        80937      49027746
GSS85        89649      64758910
GSS86        78622      62222373
GSS87        78203      79471505
GSS88        78566      57555455
GSS89        91523      53360884
GSS9         73643      37744628
GSS90        74613      39526672
GSS91        85899      54560682
GSS92        73925      58735139
GSS93        86174      52512849
GSS94        82937      61436062
GSS95        86333      57581400
GSS96        85419      54443471
GSS97        86620      61800475
GSS98        81227      60023468
GSS99        75628      41971008
HTC1         32058      55427426
HTC2         31311      66327861
HTC3         70557      42235313
HTC4         86481      76794312
HTC5         97776      86114623
HTC6         47613      81482910
HTG1         1318       188927273
HTG10        1229       186801132
HTG11        1426       184119848
HTG12        918        191864170
HTG13        752        192483005
HTG14        745        192408774
HTG15        773        192206767
HTG16        799        192047376
HTG17        772        192169615
HTG18        1862       174771786
HTG19        1143       187386205
HTG2         2384       186082526
HTG20        1198       186525265
HTG21        823        191670191
HTG22        787        191846965
HTG23        945        190514840
HTG24        903        190904504
HTG25        845        191320201
HTG26        769        192107085
HTG27        864        191544020
HTG28        873        191592472
HTG29        902        190695520
HTG3         2531       185223113
HTG30        978        190421825
HTG31        932        190877495
HTG32        970        190448077
HTG33        873        191422665
HTG34        861        191673640
HTG35        997        189825936
HTG36        884        191439053
HTG37        858        191502734
HTG38        826        191895591
HTG39        886        191067732
HTG4         2617       188653188
HTG40        986        190288335
HTG41        935        190955666
HTG42        959        190747406
HTG43        1119       188421538
HTG44        1118       188295776
HTG45        1343       187150797
HTG46        1152       189314320
HTG47        1142       187873316
HTG48        1117       191532335
HTG49        1277       190916529
HTG5         1287       185730220
HTG50        1169       191198223
HTG51        1222       191346070
HTG52        1170       191115994
HTG53        1260       190124233
HTG54        1351       188416250
HTG55        1182       192301467
HTG56        1173       190820969
HTG57        1048       192222939
HTG58        1057       193655357
HTG59        1050       193504253
HTG6         1276       185167485
HTG60        1046       193741535
HTG61        1068       193407079
HTG62        421        74937291
HTG7         1242       185807065
HTG8         1289       184885664
HTG9         1194       186962522
INV1         14264      166449989
INV2         1459       167583581
INV3         49940      99458288
INV4         72220      75999408
INV5         73182      81215693
INV6         35342      112198204
INV7         9581       34203856
MAM1         60992      103717040
MAM2         6057       7063075
PAT1         223047     70322804
PAT10        100441     62699761
PAT11        122941     53181620
PAT12        152417     55279964
PAT13        165583     75472474
PAT14        103395     123012723
PAT15        128457     101180971
PAT16        138521     89180249
PAT17        8523       2210074
PAT2         199655     89404948
PAT3         180653     98968702
PAT4         150820     93961248
PAT5         131163     99600311
PAT6         133483     100542768
PAT7         128491     101791718
PAT8         138235     92191960
PAT9         134595     51546541
PHG          2777       13638774
PLN1         30441      127326216
PLN10        78143      78168555
PLN11        36039      120026342
PLN12        37228      117893459
PLN13        36715      77325665
PLN2         1366       180177631
PLN3         39868      123304417
PLN4         78050      76851206
PLN5         44504      54845220
PLN6         17334      111711310
PLN7         1258       167035748
PLN8         29715      117320441
PLN9         66755      66936872
PRI1         18096      151258319
PRI10        1410       176400336
PRI11        1266       175642772
PRI12        1501       175189575
PRI13        1594       178598209
PRI14        1520       184342150
PRI15        23398      152998041
PRI16        42481      95874912
PRI17        13962      148668542
PRI18        1605       184089329
PRI19        1756       183184645
PRI2         1424       172705716
PRI20        2118       182267584
PRI21        1574       186857943
PRI22        36863      127371616
PRI23        40263      75520766
PRI24        9233       165790189
PRI25        19189      156583955
PRI26        51091      118318493
PRI27        35422      131694343
PRI28        31917      46417991
PRI3         1255       182696059
PRI4         1296       178201137
PRI5         1145       173858820
PRI6         1194       178827445
PRI7         1216       177228602
PRI8         1329       169656515
PRI9         1224       177338444
ROD1         8819       170961496
ROD10        26730      146521250
ROD11        1186       192099742
ROD12        1253       193815435
ROD13        22799      155429183
ROD14        24822      97463413
ROD15        46063      103816602
ROD2         909        174162462
ROD3         899        174790078
ROD4         916        174710686
ROD5         983        181088703
ROD6         981        180915250
ROD7         1011       182847716
ROD8         997        183828023
ROD9         1035       187646528
STS1         89188      48035330
STS2         75357      31334117
STS3         94358      38095577
STS4         85932      35103565
STS5         35761      16128425
SYN          16094      24038436
UNA          1727       784447
VRL1         72774      65398621
VRL2         73304      65439138
VRL3         72891      69062202
VRL4         46912      43822176
VRT1         62890      98015624
VRT2         8582       176824107
VRT3         68651      67534005
VRT4         11383      152295139
VRT5         1280       192906701
VRT6         8241       182263356
VRT7         43684      97910708

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 145.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries       Bases   Species

8376552  10989131784  Homo sapiens
6132699   6848679400  Mus musculus
993256    5649466676  Rattus norvegicus
778558    2056804290  Danio rerio
2296840   1461369501  Zea mays
350371     789588901  Oryza sativa (japonica cultivar-group)
964476     763841230  Bos taurus
483627     757813573  Drosophila melanogaster
700739     608211036  Gallus gallus
873234     600848477  Arabidopsis thaliana
1033368    593604465  Canis familiaris
563430     469515364  Xenopus tropicalis
767142     451237134  Sorghum bicolor
193693     445348260  Pan troglodytes
693134     418143999  Ciona intestinalis
595918     403981007  Brassica oleracea
56041      376601146  Macaca mulatta
561768     353804633  Sus scrofa
351861     341281507  Medicago truncatula
595592     333427484  Triticum aestivum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 October 2004

                NCBI-GenBank Flat File Release 145.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 145.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
	Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
	Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
	Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
	Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Tony Stearman

User Support
	Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
	Renata Geer, Scott McGinnis, Donna Messersmith, Rana Morris, Vyvy Pham,
	Monica Romiti, Eric Sayers, Tao Tao, David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center