Release Notes For GenBank Release 146
GBREL.TXT Genetic Sequence Data Bank
February 15 2005
NCBI-GenBank Flat File Release 146.0
Distribution Release Notes
42734478 loci, 46849831226 bases, from 42734478 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 146.0
1.2 Cutoff Date
1.3 Important Changes in Release 146.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 146.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
E-MAIL: update@ncbi.nlm.nih.gov
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 146.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
Mirrors of the GenBank FTP site at the NCBI are available from the San Diego
Supercomputer Center and the University of Indiana:
ftp://genbank.sdsc.edu/pub
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from these alternate sites when traffic at
the NCBI is high.
*** NOTE *** The SDSC GenBank mirror site is experiencing problems
caused by disk space limitations. Users of this site should closely
check the file content (total number of files and their dates) at
the mirror before using it. We will provide further details about
the status of the SDSC mirror as they become available.
1.2 Cutoff Date
This full release, 146.0, incorporates data available to the collaborating
databases as of February 16, 2005 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 146.0
1.3.1 Organizational changes
The total number of sequence data files increased by 37 with this release:
- the EST division is now comprised of 377 files (+22)
- the GSS division is now comprised of 138 files (+6)
- the HTG division is now comprised of 63 files (+1)
- the PLN division is now comprised of 15 files (+2)
- the ROD division is now comprised of 16 files (+1)
- the STS division is now comprised of 9 files (+4)
- the VRT division is now comprised of 8 files (+1)
1.3.2 Continuous ranges of secondary accessions
With the removal of sequence length limits, some genomes (typically
bacterial) that had been split into many pieces are gradually being
replaced by a single sequence record. U00096 is a good example.
When this happens, the accessions of the former small pieces become
secondary accessions for the single large sequence record. When each
secondary is separately listed, the ACCESSION line becomes excessively
lengthy.
As of this February 2005 GenBank Release, continuous ranges of secondary
accessions (represented by a start accession, a dash character, and an end
accession) will begin to appear, initially within the GenBank Updates. In
the case of U00096, the ACCESSION line would look like:
ACCESSION U00096 AE000111-AE000510
1.3.3 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
twenty-four GSS flatfiles in Release 146.0. Consider gbgss115.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
February 15 2005
NCBI-GenBank Flat File Release 146.0
GSS Sequences (Part 1)
87937 loci, 65332512 bases, from 87937 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "115" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New ENV Division in April 2005
A new division for sequences obtained via environmental sampling methods
will be introduced with GenBank Release 147.0 in April 2005 . Records in this
new division will have these characteristics:
1. ENV division code on the LOCUS line
2. ENV keyword
3. /environmental_sample qualifier in the source feature
This new division will segregate sequences for which the source organism is
unknown, or can only be inferred by sequence comparison.
Sequences from WGS projects that involve environmental sampling will *not*
be distributed via this new division. All WGS projects will continue to be
distributed using project-specific data files at the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Additional information about the new ENV division will be provided via
these release notes and the GenBank newsgroup.
1.4.2 Removal of MEDLINE linetype in April 2005
The PUBMED linetype was introduced in December of 1997, as a means of
linking references in sequence records to the PubMed biomedical literature
database, based on a PubMed ID (PMID) .
Since then, we have been displaying both the PMID and its predecessor
(Medline Unique ID / MUID) for all references. For example :
LOCUS ECOGUABA 3531 bp DNA linear BCT
09-FEB-2005
DEFINITION Escherichia coli guaBA operon operon, complete sequence.
ACCESSION M10101 M10102
VERSION M10101.1 GI:146274
....
REFERENCE 1 (bases 1768 to 3531)
AUTHORS Tiedeman,A.A., Smith,J.M. and Zalkin,H.
TITLE Nucleotide sequence of the guaA gene encoding GMP synthetase of
Escherichia coli K12
JOURNAL J. Biol. Chem. 260 (15), 8676-8679 (1985)
MEDLINE 85261223
PUBMED 3894345
Subsequent to 1997, PMID article identifiers subsumed MUIDs. Some background
information about that evolution can be found at:
http://www.nlm.nih.gov/pubs/techbull/mj01/mj01_medline_ui.html
Starting with GenBank Release 147.0 in April of 2005, the older MEDLINE
linetype will be displayed in GenBank sequence records only for (very rare)
articles that lack a PMID identifier.
For the vast majority of cases, this means that the MEDLINE linetype will
no longer be displayed; only the PUBMED identifier will be presented.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 743 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut28.idx - Index of the entries according to accession number, part 28.
23. gbaut3.idx - Index of the entries according to accession number, part 3.
24. gbaut4.idx - Index of the entries according to accession number, part 4.
25. gbaut5.idx - Index of the entries according to accession number, part 5.
26. gbaut6.idx - Index of the entries according to accession number, part 6.
27. gbaut7.idx - Index of the entries according to accession number, part 7.
28. gbaut8.idx - Index of the entries according to accession number, part 8.
29. gbaut9.idx - Index of the entries according to accession number, part 9.
30. gbbct1.seq - Bacterial sequence entries, part 1.
31. gbbct10.seq - Bacterial sequence entries, part 10.
32. gbbct11.seq - Bacterial sequence entries, part 11.
33. gbbct2.seq - Bacterial sequence entries, part 2.
34. gbbct3.seq - Bacterial sequence entries, part 3.
35. gbbct4.seq - Bacterial sequence entries, part 4.
36. gbbct5.seq - Bacterial sequence entries, part 5.
37. gbbct6.seq - Bacterial sequence entries, part 6.
38. gbbct7.seq - Bacterial sequence entries, part 7.
39. gbbct8.seq - Bacterial sequence entries, part 8.
40. gbbct9.seq - Bacterial sequence entries, part 9.
41. gbchg.txt - Accession numbers of entries updated since the previous release.
42. gbcon.seq - Constructed sequence entries.
43. gbdel.txt - Accession numbers of entries deleted since the previous release.
44. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
45. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
46. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
47. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
48. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
49. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
50. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
51. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
52. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
53. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
54. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
55. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
56. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
57. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
58. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
59. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
60. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
61. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
62. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
63. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
64. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
65. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
66. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
67. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
68. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
69. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
70. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
71. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
72. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
73. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
74. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
75. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
76. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
77. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
78. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
79. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
80. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
81. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
82. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
83. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
84. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
85. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
86. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
87. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
88. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
89. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
90. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
91. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
92. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
93. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
94. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
95. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
96. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
97. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
98. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
99. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
100. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
101. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
102. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
103. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
104. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
105. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
106. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
107. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
108. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
109. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
110. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
111. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
112. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
113. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
114. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
115. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
116. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
117. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
118. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
119. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
120. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
121. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
122. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
123. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
124. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
125. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
126. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
127. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
128. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
129. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
130. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
131. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
132. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
133. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
134. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
135. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
136. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
137. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
138. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
139. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
140. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
141. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
142. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
143. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
144. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
145. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
146. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
147. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
148. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
149. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
150. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
151. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
152. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
153. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
154. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
155. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
156. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
157. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
158. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
159. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
160. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
161. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
162. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
163. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
164. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
165. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
166. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
167. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
168. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
169. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
170. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
171. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
172. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
173. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
174. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
175. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
176. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
177. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
178. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
179. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
180. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
181. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
182. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
183. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
184. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
185. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
186. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
187. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
188. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
189. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
190. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
191. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
192. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
193. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
194. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
195. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
196. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
197. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
198. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
199. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
200. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
201. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
202. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
203. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
204. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
205. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
206. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
207. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
208. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
209. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
210. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
211. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
212. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
213. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
214. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
215. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
216. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
217. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
218. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
219. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
220. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
221. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
222. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
223. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
224. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
225. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
226. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
227. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
228. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
229. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
230. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
231. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
232. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
233. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
234. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
235. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
236. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
237. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
238. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
239. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
240. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
241. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
242. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
243. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
244. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
245. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
246. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
247. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
248. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
249. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
250. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
251. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
252. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
253. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
254. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
255. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
256. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
257. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
258. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
259. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
260. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
261. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
262. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
263. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
264. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
265. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
266. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
267. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
268. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
269. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
270. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
271. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
272. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
273. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
274. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
275. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
276. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
277. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
278. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
279. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
280. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
281. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
282. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
283. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
284. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
285. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
286. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
287. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
288. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
289. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
290. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
291. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
292. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
293. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
294. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
295. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
296. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
297. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
298. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
299. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
300. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
301. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
302. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
303. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
304. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
305. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
306. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
307. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
308. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
309. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
310. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
311. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
312. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
313. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
314. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
315. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
316. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
317. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
318. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
319. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
320. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
321. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
322. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
323. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
324. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
325. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
326. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
327. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
328. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
329. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
330. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
331. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
332. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
333. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
334. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
335. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
336. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
337. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
338. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
339. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
340. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
341. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
342. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
343. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
344. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
345. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
346. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
347. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
348. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
349. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
350. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
351. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
352. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
353. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
354. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
355. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
356. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
357. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
358. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
359. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
360. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
361. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
362. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
363. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
364. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
365. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
366. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
367. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
368. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
369. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
370. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
371. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
372. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
373. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
374. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
375. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
376. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
377. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
378. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
379. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
380. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
381. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
382. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
383. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
384. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
385. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
386. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
387. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
388. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
389. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
390. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
391. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
392. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
393. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
394. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
395. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
396. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
397. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
398. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
399. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
400. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
401. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
402. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
403. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
404. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
405. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
406. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
407. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
408. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
409. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
410. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
411. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
412. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
413. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
414. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
415. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
416. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
417. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
418. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
419. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
420. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
421. gbgen.idx - Index of the entries according to gene symbols.
422. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
423. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
424. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
425. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
426. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
427. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
428. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
429. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
430. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
431. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
432. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
433. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
434. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
435. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
436. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
437. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
438. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
439. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
440. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
441. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
442. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
443. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
444. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
445. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
446. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
447. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
448. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
449. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
450. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
451. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
452. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
453. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
454. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
455. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
456. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
457. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
458. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
459. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
460. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
461. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
462. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
463. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
464. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
465. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
466. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
467. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
468. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
469. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
470. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
471. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
472. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
473. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
474. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
475. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
476. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
477. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
478. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
479. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
480. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
481. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
482. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
483. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
484. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
485. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
486. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
487. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
488. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
489. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
490. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
491. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
492. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
493. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
494. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
495. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
496. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
497. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
498. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
499. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
500. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
501. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
502. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
503. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
504. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
505. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
506. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
507. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
508. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
509. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
510. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
511. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
512. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
513. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
514. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
515. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
516. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
517. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
518. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
519. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
520. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
521. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
522. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
523. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
524. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
525. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
526. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
527. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
528. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
529. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
530. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
531. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
532. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
533. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
534. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
535. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
536. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
537. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
538. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
539. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
540. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
541. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
542. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
543. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
544. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
545. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
546. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
547. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
548. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
549. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
550. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
551. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
552. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
553. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
554. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
555. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
556. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
557. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
558. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
559. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
560. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
561. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
562. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
563. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
564. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
565. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
566. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
567. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
568. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
569. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
570. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
571. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
572. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
573. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
574. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
575. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
576. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
577. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
578. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
579. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
580. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
581. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
582. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
583. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
584. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
585. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
586. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
587. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
588. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
589. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
590. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
591. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
592. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
593. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
594. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
595. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
596. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
597. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
598. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
599. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
600. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
601. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
602. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
603. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
604. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
605. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
606. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
607. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
608. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
609. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
610. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
611. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
612. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
613. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
614. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
615. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
616. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
617. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
618. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
619. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
620. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
621. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
622. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
623. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
624. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
625. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
626. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
627. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
628. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
629. gbinv1.seq - Invertebrate sequence entries, part 1.
630. gbinv2.seq - Invertebrate sequence entries, part 2.
631. gbinv3.seq - Invertebrate sequence entries, part 3.
632. gbinv4.seq - Invertebrate sequence entries, part 4.
633. gbinv5.seq - Invertebrate sequence entries, part 5.
634. gbinv6.seq - Invertebrate sequence entries, part 6.
635. gbinv7.seq - Invertebrate sequence entries, part 7.
636. gbjou.idx - Index of the entries according to journal citation.
637. gbkey.idx - Index of the entries according to keyword phrase.
638. gbmam1.seq - Other mammalian sequence entries, part 1.
639. gbmam2.seq - Other mammalian sequence entries, part 2.
640. gbnew.txt - Accession numbers of entries new since the previous release.
641. gbpat1.seq - Patent sequence entries, part 1.
642. gbpat10.seq - Patent sequence entries, part 10.
643. gbpat11.seq - Patent sequence entries, part 11.
644. gbpat12.seq - Patent sequence entries, part 12.
645. gbpat13.seq - Patent sequence entries, part 13.
646. gbpat14.seq - Patent sequence entries, part 14.
647. gbpat15.seq - Patent sequence entries, part 15.
648. gbpat16.seq - Patent sequence entries, part 16.
649. gbpat17.seq - Patent sequence entries, part 17.
650. gbpat2.seq - Patent sequence entries, part 2.
651. gbpat3.seq - Patent sequence entries, part 3.
652. gbpat4.seq - Patent sequence entries, part 4.
653. gbpat5.seq - Patent sequence entries, part 5.
654. gbpat6.seq - Patent sequence entries, part 6.
655. gbpat7.seq - Patent sequence entries, part 7.
656. gbpat8.seq - Patent sequence entries, part 8.
657. gbpat9.seq - Patent sequence entries, part 9.
658. gbphg.seq - Phage sequence entries.
659. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
660. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
661. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
662. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
663. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
664. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
665. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
666. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
667. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
668. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
669. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
670. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
671. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
672. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
673. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
674. gbpri1.seq - Primate sequence entries, part 1.
675. gbpri10.seq - Primate sequence entries, part 10.
676. gbpri11.seq - Primate sequence entries, part 11.
677. gbpri12.seq - Primate sequence entries, part 12.
678. gbpri13.seq - Primate sequence entries, part 13.
679. gbpri14.seq - Primate sequence entries, part 14.
680. gbpri15.seq - Primate sequence entries, part 15.
681. gbpri16.seq - Primate sequence entries, part 16.
682. gbpri17.seq - Primate sequence entries, part 17.
683. gbpri18.seq - Primate sequence entries, part 18.
684. gbpri19.seq - Primate sequence entries, part 19.
685. gbpri2.seq - Primate sequence entries, part 2.
686. gbpri20.seq - Primate sequence entries, part 20.
687. gbpri21.seq - Primate sequence entries, part 21.
688. gbpri22.seq - Primate sequence entries, part 22.
689. gbpri23.seq - Primate sequence entries, part 23.
690. gbpri24.seq - Primate sequence entries, part 24.
691. gbpri25.seq - Primate sequence entries, part 25.
692. gbpri26.seq - Primate sequence entries, part 26.
693. gbpri27.seq - Primate sequence entries, part 27.
694. gbpri28.seq - Primate sequence entries, part 28.
695. gbpri3.seq - Primate sequence entries, part 3.
696. gbpri4.seq - Primate sequence entries, part 4.
697. gbpri5.seq - Primate sequence entries, part 5.
698. gbpri6.seq - Primate sequence entries, part 6.
699. gbpri7.seq - Primate sequence entries, part 7.
700. gbpri8.seq - Primate sequence entries, part 8.
701. gbpri9.seq - Primate sequence entries, part 9.
702. gbrel.txt - Release notes (this document).
703. gbrod1.seq - Rodent sequence entries, part 1.
704. gbrod10.seq - Rodent sequence entries, part 10.
705. gbrod11.seq - Rodent sequence entries, part 11.
706. gbrod12.seq - Rodent sequence entries, part 12.
707. gbrod13.seq - Rodent sequence entries, part 13.
708. gbrod14.seq - Rodent sequence entries, part 14.
709. gbrod15.seq - Rodent sequence entries, part 15.
710. gbrod16.seq - Rodent sequence entries, part 16.
711. gbrod2.seq - Rodent sequence entries, part 2.
712. gbrod3.seq - Rodent sequence entries, part 3.
713. gbrod4.seq - Rodent sequence entries, part 4.
714. gbrod5.seq - Rodent sequence entries, part 5.
715. gbrod6.seq - Rodent sequence entries, part 6.
716. gbrod7.seq - Rodent sequence entries, part 7.
717. gbrod8.seq - Rodent sequence entries, part 8.
718. gbrod9.seq - Rodent sequence entries, part 9.
719. gbsdr.txt - Short directory of the data bank.
720. gbsec.idx - Index of the entries according to secondary accession number.
721. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
722. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
723. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
724. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
725. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
726. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
727. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
728. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
729. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
730. gbsyn.seq - Synthetic and chimeric sequence entries.
731. gbuna.seq - Unannotated sequence entries.
732. gbvrl1.seq - Viral sequence entries, part 1.
733. gbvrl2.seq - Viral sequence entries, part 2.
734. gbvrl3.seq - Viral sequence entries, part 3.
735. gbvrl4.seq - Viral sequence entries, part 4.
736. gbvrt1.seq - Other vertebrate sequence entries, part 1.
737. gbvrt2.seq - Other vertebrate sequence entries, part 2.
738. gbvrt3.seq - Other vertebrate sequence entries, part 3.
739. gbvrt4.seq - Other vertebrate sequence entries, part 4.
740. gbvrt5.seq - Other vertebrate sequence entries, part 5.
741. gbvrt6.seq - Other vertebrate sequence entries, part 6.
742. gbvrt7.seq - Other vertebrate sequence entries, part 7.
743. gbvrt8.seq - Other vertebrate sequence entries, part 8.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 146.0 flatfiles require roughly 162 GB (sequence
files only) or 180 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1402864615 gbacc.idx
509322177 gbaut1.idx
507044917 gbaut10.idx
520654371 gbaut11.idx
517073743 gbaut12.idx
501150830 gbaut13.idx
538810288 gbaut14.idx
513454539 gbaut15.idx
501136243 gbaut16.idx
500356423 gbaut17.idx
500347801 gbaut18.idx
522271355 gbaut19.idx
506485871 gbaut2.idx
517019434 gbaut20.idx
504686612 gbaut21.idx
500454404 gbaut22.idx
500307264 gbaut23.idx
513419260 gbaut24.idx
503481673 gbaut25.idx
506367599 gbaut26.idx
500393195 gbaut27.idx
397818992 gbaut28.idx
500475508 gbaut3.idx
508630417 gbaut4.idx
503223998 gbaut5.idx
501683978 gbaut6.idx
500324265 gbaut7.idx
500172014 gbaut8.idx
510599483 gbaut9.idx
250003604 gbbct1.seq
250004440 gbbct10.seq
202621298 gbbct11.seq
252759499 gbbct2.seq
250059521 gbbct3.seq
250011681 gbbct4.seq
255583354 gbbct5.seq
250004802 gbbct6.seq
254309778 gbbct7.seq
250121516 gbbct8.seq
250398906 gbbct9.seq
7700189 gbchg.txt
1066122635 gbcon.seq
71828 gbdel.txt
230690163 gbest1.seq
230689018 gbest10.seq
230690141 gbest100.seq
230688550 gbest101.seq
230688825 gbest102.seq
230687909 gbest103.seq
230689530 gbest104.seq
230687610 gbest105.seq
230688344 gbest106.seq
230690176 gbest107.seq
230687513 gbest108.seq
230688918 gbest109.seq
230689293 gbest11.seq
230038868 gbest110.seq
230690684 gbest111.seq
230689407 gbest112.seq
230687935 gbest113.seq
230691977 gbest114.seq
230689662 gbest115.seq
230690522 gbest116.seq
230689938 gbest117.seq
230688547 gbest118.seq
230690726 gbest119.seq
230689997 gbest12.seq
230689779 gbest120.seq
230689046 gbest121.seq
230688682 gbest122.seq
230690293 gbest123.seq
230689704 gbest124.seq
229461777 gbest125.seq
230690683 gbest126.seq
230689367 gbest127.seq
230689352 gbest128.seq
230690602 gbest129.seq
230688077 gbest13.seq
230688096 gbest130.seq
230687887 gbest131.seq
230690338 gbest132.seq
230690139 gbest133.seq
230688381 gbest134.seq
230690202 gbest135.seq
230688386 gbest136.seq
230687521 gbest137.seq
230688852 gbest138.seq
230689238 gbest139.seq
230688146 gbest14.seq
230688338 gbest140.seq
230688766 gbest141.seq
230689203 gbest142.seq
230689258 gbest143.seq
230687856 gbest144.seq
230689522 gbest145.seq
230688337 gbest146.seq
230689195 gbest147.seq
230687618 gbest148.seq
230689622 gbest149.seq
230687989 gbest15.seq
230689086 gbest150.seq
230690509 gbest151.seq
230692330 gbest152.seq
230691110 gbest153.seq
230690194 gbest154.seq
230688959 gbest155.seq
230687835 gbest156.seq
230688383 gbest157.seq
230687859 gbest158.seq
230690930 gbest159.seq
230689222 gbest16.seq
230688587 gbest160.seq
230689093 gbest161.seq
230688779 gbest162.seq
230688976 gbest163.seq
230687957 gbest164.seq
230687805 gbest165.seq
230689260 gbest166.seq
230687442 gbest167.seq
223703901 gbest168.seq
230688476 gbest169.seq
230689139 gbest17.seq
230688702 gbest170.seq
230689187 gbest171.seq
230689091 gbest172.seq
230689726 gbest173.seq
230688213 gbest174.seq
230687834 gbest175.seq
230688820 gbest176.seq
230688098 gbest177.seq
230689493 gbest178.seq
230688469 gbest179.seq
230687539 gbest18.seq
230688463 gbest180.seq
230688209 gbest181.seq
230689384 gbest182.seq
230689989 gbest183.seq
230690379 gbest184.seq
230688756 gbest185.seq
230690549 gbest186.seq
230687928 gbest187.seq
230687505 gbest188.seq
230690028 gbest189.seq
230690563 gbest19.seq
230690548 gbest190.seq
230689537 gbest191.seq
230690016 gbest192.seq
230690924 gbest193.seq
230687668 gbest194.seq
230689190 gbest195.seq
230688264 gbest196.seq
230687938 gbest197.seq
230687916 gbest198.seq
230689207 gbest199.seq
230689335 gbest2.seq
230689121 gbest20.seq
230689201 gbest200.seq
230687826 gbest201.seq
230688221 gbest202.seq
230689341 gbest203.seq
230689093 gbest204.seq
230687994 gbest205.seq
230689948 gbest206.seq
230691092 gbest207.seq
230688006 gbest208.seq
230689106 gbest209.seq
230687465 gbest21.seq
230688242 gbest210.seq
230689574 gbest211.seq
230688992 gbest212.seq
177241766 gbest213.seq
162562888 gbest214.seq
164401144 gbest215.seq
171041020 gbest216.seq
169797156 gbest217.seq
163411052 gbest218.seq
165067834 gbest219.seq
230687536 gbest22.seq
164633668 gbest220.seq
164067571 gbest221.seq
164575786 gbest222.seq
164073374 gbest223.seq
164143800 gbest224.seq
162921460 gbest225.seq
168236662 gbest226.seq
162346816 gbest227.seq
163184945 gbest228.seq
167401118 gbest229.seq
230687554 gbest23.seq
167601785 gbest230.seq
165843709 gbest231.seq
165694716 gbest232.seq
165327026 gbest233.seq
165138224 gbest234.seq
164252436 gbest235.seq
164196903 gbest236.seq
165119195 gbest237.seq
165206674 gbest238.seq
180796322 gbest239.seq
230688044 gbest24.seq
171949635 gbest240.seq
188662899 gbest241.seq
230689531 gbest242.seq
230687904 gbest243.seq
230687873 gbest244.seq
230687539 gbest245.seq
230689893 gbest246.seq
230689283 gbest247.seq
230689609 gbest248.seq
230689963 gbest249.seq
230690963 gbest25.seq
230691543 gbest250.seq
230687636 gbest251.seq
230690752 gbest252.seq
230689850 gbest253.seq
230690896 gbest254.seq
230688192 gbest255.seq
230689857 gbest256.seq
230690321 gbest257.seq
230689058 gbest258.seq
230687451 gbest259.seq
230687552 gbest26.seq
230689426 gbest260.seq
230687864 gbest261.seq
230688649 gbest262.seq
230687658 gbest263.seq
230689410 gbest264.seq
230688220 gbest265.seq
230688996 gbest266.seq
230688729 gbest267.seq
230689369 gbest268.seq
230687467 gbest269.seq
230690379 gbest27.seq
215797487 gbest270.seq
214580299 gbest271.seq
230687703 gbest272.seq
230687853 gbest273.seq
230690499 gbest274.seq
230689404 gbest275.seq
230688263 gbest276.seq
230688269 gbest277.seq
230687880 gbest278.seq
230689012 gbest279.seq
230689235 gbest28.seq
230688500 gbest280.seq
230687964 gbest281.seq
230690032 gbest282.seq
230691005 gbest283.seq
230691263 gbest284.seq
230688706 gbest285.seq
230688891 gbest286.seq
230687931 gbest287.seq
230689134 gbest288.seq
230689830 gbest289.seq
230688331 gbest29.seq
230690012 gbest290.seq
230687709 gbest291.seq
230690434 gbest292.seq
230688994 gbest293.seq
230689065 gbest294.seq
228254975 gbest295.seq
230690031 gbest296.seq
207822995 gbest297.seq
230690264 gbest298.seq
230688108 gbest299.seq
230688665 gbest3.seq
230688954 gbest30.seq
230689087 gbest300.seq
230688736 gbest301.seq
230689350 gbest302.seq
193409179 gbest303.seq
162905964 gbest304.seq
230688714 gbest305.seq
230689603 gbest306.seq
230689770 gbest307.seq
230690763 gbest308.seq
230690005 gbest309.seq
230687536 gbest31.seq
230688512 gbest310.seq
230687527 gbest311.seq
230689645 gbest312.seq
230687938 gbest313.seq
230688103 gbest314.seq
230690729 gbest315.seq
230688917 gbest316.seq
230689019 gbest317.seq
230689043 gbest318.seq
230689875 gbest319.seq
230690220 gbest32.seq
230690711 gbest320.seq
230689239 gbest321.seq
230689026 gbest322.seq
230688788 gbest323.seq
230689359 gbest324.seq
230689035 gbest325.seq
230690440 gbest326.seq
230687963 gbest327.seq
230689864 gbest328.seq
230690689 gbest329.seq
230689394 gbest33.seq
230688934 gbest330.seq
230688174 gbest331.seq
230688576 gbest332.seq
230689048 gbest333.seq
230688392 gbest334.seq
230691373 gbest335.seq
230689262 gbest336.seq
230689649 gbest337.seq
230688373 gbest338.seq
230690261 gbest339.seq
230687709 gbest34.seq
230687738 gbest340.seq
230689865 gbest341.seq
230689811 gbest342.seq
230688643 gbest343.seq
230687513 gbest344.seq
222264072 gbest345.seq
230688643 gbest346.seq
230689664 gbest347.seq
230687639 gbest348.seq
230688310 gbest349.seq
230687807 gbest35.seq
230688893 gbest350.seq
230687869 gbest351.seq
230689674 gbest352.seq
230689166 gbest353.seq
230688353 gbest354.seq
230689770 gbest355.seq
230687634 gbest356.seq
230687556 gbest357.seq
230689181 gbest358.seq
230689904 gbest359.seq
230690193 gbest36.seq
230689075 gbest360.seq
230689643 gbest361.seq
230688386 gbest362.seq
230690588 gbest363.seq
230691109 gbest364.seq
230690453 gbest365.seq
230689404 gbest366.seq
230687735 gbest367.seq
230690829 gbest368.seq
230690031 gbest369.seq
230687816 gbest37.seq
230689007 gbest370.seq
230689364 gbest371.seq
230687782 gbest372.seq
230688222 gbest373.seq
228494542 gbest374.seq
230690180 gbest375.seq
230688599 gbest376.seq
59798680 gbest377.seq
230689965 gbest38.seq
192525410 gbest39.seq
230687719 gbest4.seq
191429471 gbest40.seq
211598875 gbest41.seq
216179690 gbest42.seq
215941675 gbest43.seq
217013433 gbest44.seq
230689654 gbest45.seq
230687751 gbest46.seq
230482723 gbest47.seq
228549474 gbest48.seq
230689000 gbest49.seq
164506986 gbest5.seq
230690169 gbest50.seq
230689687 gbest51.seq
230690151 gbest52.seq
230687851 gbest53.seq
230688379 gbest54.seq
230689698 gbest55.seq
230688560 gbest56.seq
230687966 gbest57.seq
230689975 gbest58.seq
230689042 gbest59.seq
177385182 gbest6.seq
230689913 gbest60.seq
230687444 gbest61.seq
230662834 gbest62.seq
230688282 gbest63.seq
211426295 gbest64.seq
209413182 gbest65.seq
208929878 gbest66.seq
209120413 gbest67.seq
209290798 gbest68.seq
210838588 gbest69.seq
230687766 gbest7.seq
209206884 gbest70.seq
208734393 gbest71.seq
210165169 gbest72.seq
209623517 gbest73.seq
205083589 gbest74.seq
207926415 gbest75.seq
207128990 gbest76.seq
209612800 gbest77.seq
221232014 gbest78.seq
230691276 gbest79.seq
230688389 gbest8.seq
230689911 gbest80.seq
224626925 gbest81.seq
216601734 gbest82.seq
213515846 gbest83.seq
226815942 gbest84.seq
230690541 gbest85.seq
230688527 gbest86.seq
230689239 gbest87.seq
230688360 gbest88.seq
230688152 gbest89.seq
230689644 gbest9.seq
230690412 gbest90.seq
230689246 gbest91.seq
230688649 gbest92.seq
230687740 gbest93.seq
230688915 gbest94.seq
230687834 gbest95.seq
230687526 gbest96.seq
230690217 gbest97.seq
230689297 gbest98.seq
230689129 gbest99.seq
44538633 gbgen.idx
230687490 gbgss1.seq
230690144 gbgss10.seq
227097137 gbgss100.seq
227934635 gbgss101.seq
227691423 gbgss102.seq
227666767 gbgss103.seq
226914208 gbgss104.seq
230689878 gbgss105.seq
230689039 gbgss106.seq
230688307 gbgss107.seq
230688100 gbgss108.seq
230688186 gbgss109.seq
230690928 gbgss11.seq
230690774 gbgss110.seq
230688243 gbgss111.seq
230689604 gbgss112.seq
230687559 gbgss113.seq
51015185 gbgss114.seq
250000895 gbgss115.seq
250002311 gbgss116.seq
250001155 gbgss117.seq
250002033 gbgss118.seq
250000592 gbgss119.seq
230689462 gbgss12.seq
250002317 gbgss120.seq
250001405 gbgss121.seq
250000457 gbgss122.seq
250003073 gbgss123.seq
250002197 gbgss124.seq
250000176 gbgss125.seq
250002430 gbgss126.seq
250001365 gbgss127.seq
250001186 gbgss128.seq
250001403 gbgss129.seq
230689038 gbgss13.seq
250000220 gbgss130.seq
250003163 gbgss131.seq
250001152 gbgss132.seq
250001987 gbgss133.seq
250000921 gbgss134.seq
250000333 gbgss135.seq
250001207 gbgss136.seq
250001357 gbgss137.seq
225087958 gbgss138.seq
230688374 gbgss14.seq
230688528 gbgss15.seq
230689565 gbgss16.seq
230691285 gbgss17.seq
230690490 gbgss18.seq
230688534 gbgss19.seq
230688914 gbgss2.seq
230688025 gbgss20.seq
230687625 gbgss21.seq
230690436 gbgss22.seq
230688393 gbgss23.seq
230689306 gbgss24.seq
230687944 gbgss25.seq
230689757 gbgss26.seq
230689275 gbgss27.seq
230688662 gbgss28.seq
230687833 gbgss29.seq
230688225 gbgss3.seq
230690336 gbgss30.seq
230689644 gbgss31.seq
230688733 gbgss32.seq
230689517 gbgss33.seq
230687582 gbgss34.seq
230688283 gbgss35.seq
230689751 gbgss36.seq
230687933 gbgss37.seq
230689282 gbgss38.seq
230689003 gbgss39.seq
230689665 gbgss4.seq
230689621 gbgss40.seq
230688594 gbgss41.seq
230688204 gbgss42.seq
230689099 gbgss43.seq
230689202 gbgss44.seq
230688566 gbgss45.seq
230689466 gbgss46.seq
230688778 gbgss47.seq
230688005 gbgss48.seq
230687703 gbgss49.seq
230689634 gbgss5.seq
230688755 gbgss50.seq
230687558 gbgss51.seq
230688024 gbgss52.seq
230690809 gbgss53.seq
230687826 gbgss54.seq
230689010 gbgss55.seq
230689062 gbgss56.seq
230688405 gbgss57.seq
230687547 gbgss58.seq
230688739 gbgss59.seq
230689404 gbgss6.seq
230689106 gbgss60.seq
230340120 gbgss61.seq
230689145 gbgss62.seq
230689141 gbgss63.seq
230688062 gbgss64.seq
230687524 gbgss65.seq
230689537 gbgss66.seq
230689131 gbgss67.seq
230688943 gbgss68.seq
230688434 gbgss69.seq
230691190 gbgss7.seq
230688983 gbgss70.seq
230689278 gbgss71.seq
230688273 gbgss72.seq
230688649 gbgss73.seq
230687665 gbgss74.seq
230689269 gbgss75.seq
230688733 gbgss76.seq
230688921 gbgss77.seq
230688339 gbgss78.seq
230688969 gbgss79.seq
230690635 gbgss8.seq
228352660 gbgss80.seq
192843398 gbgss81.seq
193330296 gbgss82.seq
230690484 gbgss83.seq
230689320 gbgss84.seq
230688918 gbgss85.seq
230688635 gbgss86.seq
230689152 gbgss87.seq
230687774 gbgss88.seq
230687874 gbgss89.seq
230688984 gbgss9.seq
230689622 gbgss90.seq
230688118 gbgss91.seq
230690077 gbgss92.seq
230689845 gbgss93.seq
230689718 gbgss94.seq
230690055 gbgss95.seq
230688638 gbgss96.seq
230688808 gbgss97.seq
230689920 gbgss98.seq
230688860 gbgss99.seq
250004897 gbhtc1.seq
250000518 gbhtc2.seq
250008721 gbhtc3.seq
250001836 gbhtc4.seq
250001566 gbhtc5.seq
206919251 gbhtc6.seq
250036152 gbhtg1.seq
250261643 gbhtg10.seq
250243253 gbhtg11.seq
250274859 gbhtg12.seq
250243330 gbhtg13.seq
250087319 gbhtg14.seq
250059551 gbhtg15.seq
250269106 gbhtg16.seq
250254255 gbhtg17.seq
250048664 gbhtg18.seq
250204294 gbhtg19.seq
250003505 gbhtg2.seq
250410355 gbhtg20.seq
250067903 gbhtg21.seq
250040416 gbhtg22.seq
250262730 gbhtg23.seq
250021610 gbhtg24.seq
250126492 gbhtg25.seq
250214244 gbhtg26.seq
250162714 gbhtg27.seq
250190877 gbhtg28.seq
250074388 gbhtg29.seq
250129646 gbhtg3.seq
250048465 gbhtg30.seq
250024174 gbhtg31.seq
250223604 gbhtg32.seq
250065029 gbhtg33.seq
250039053 gbhtg34.seq
250103090 gbhtg35.seq
250083026 gbhtg36.seq
250237009 gbhtg37.seq
250179828 gbhtg38.seq
250036984 gbhtg39.seq
250088734 gbhtg4.seq
250010179 gbhtg40.seq
250158878 gbhtg41.seq
250199922 gbhtg42.seq
250267172 gbhtg43.seq
250008257 gbhtg44.seq
250033195 gbhtg45.seq
250155441 gbhtg46.seq
250248085 gbhtg47.seq
250122719 gbhtg48.seq
250196127 gbhtg49.seq
250187778 gbhtg5.seq
250094505 gbhtg50.seq
250008159 gbhtg51.seq
250149127 gbhtg52.seq
250062918 gbhtg53.seq
250099379 gbhtg54.seq
250132410 gbhtg55.seq
250327532 gbhtg56.seq
250088935 gbhtg57.seq
250119054 gbhtg58.seq
250123437 gbhtg59.seq
250123837 gbhtg6.seq
250001552 gbhtg60.seq
250143277 gbhtg61.seq
250179758 gbhtg62.seq
151754363 gbhtg63.seq
250148213 gbhtg7.seq
250125454 gbhtg8.seq
250142355 gbhtg9.seq
250030769 gbinv1.seq
250159377 gbinv2.seq
250001088 gbinv3.seq
250000987 gbinv4.seq
250001129 gbinv5.seq
250273096 gbinv6.seq
122433495 gbinv7.seq
1091264978 gbjou.idx
964750877 gbkey.idx
250003192 gbmam1.seq
37883197 gbmam2.seq
33434231 gbnew.txt
250000291 gbpat1.seq
250001072 gbpat10.seq
250001280 gbpat11.seq
250000255 gbpat12.seq
250001089 gbpat13.seq
250001114 gbpat14.seq
250001770 gbpat15.seq
250000182 gbpat16.seq
89261890 gbpat17.seq
250003767 gbpat2.seq
250001931 gbpat3.seq
250000533 gbpat4.seq
250023517 gbpat5.seq
250000385 gbpat6.seq
250000101 gbpat7.seq
250000351 gbpat8.seq
250000839 gbpat9.seq
36124733 gbphg.seq
250140740 gbpln1.seq
250001562 gbpln10.seq
250002584 gbpln11.seq
250000176 gbpln12.seq
251691579 gbpln13.seq
250185366 gbpln14.seq
246515806 gbpln15.seq
252685989 gbpln2.seq
250001583 gbpln3.seq
250037816 gbpln4.seq
250005947 gbpln5.seq
250099048 gbpln6.seq
250089750 gbpln7.seq
281281150 gbpln8.seq
252667749 gbpln9.seq
250130247 gbpri1.seq
250166016 gbpri10.seq
250117139 gbpri11.seq
250038148 gbpri12.seq
250037337 gbpri13.seq
250184466 gbpri14.seq
250011711 gbpri15.seq
250000973 gbpri16.seq
250036298 gbpri17.seq
250073599 gbpri18.seq
250096721 gbpri19.seq
250146611 gbpri2.seq
250121924 gbpri20.seq
250006124 gbpri21.seq
250009547 gbpri22.seq
250007185 gbpri23.seq
250052636 gbpri24.seq
250000041 gbpri25.seq
250000048 gbpri26.seq
250002833 gbpri27.seq
152982766 gbpri28.seq
250139228 gbpri3.seq
250059043 gbpri4.seq
250022923 gbpri5.seq
250053549 gbpri6.seq
250083679 gbpri7.seq
250012382 gbpri8.seq
250163200 gbpri9.seq
181998 gbrel.txt
250080058 gbrod1.seq
250086126 gbrod10.seq
250016237 gbrod11.seq
250147489 gbrod12.seq
250008565 gbrod13.seq
250004377 gbrod14.seq
250069540 gbrod15.seq
249557051 gbrod16.seq
250310472 gbrod2.seq
250134008 gbrod3.seq
250178032 gbrod4.seq
250101701 gbrod5.seq
250093845 gbrod6.seq
250017370 gbrod7.seq
250013248 gbrod8.seq
250161979 gbrod9.seq
3418804341 gbsdr.txt
1606934 gbsec.idx
250000160 gbsts1.seq
250000399 gbsts2.seq
250003405 gbsts3.seq
250004366 gbsts4.seq
250002068 gbsts5.seq
250000387 gbsts6.seq
250002036 gbsts7.seq
250002573 gbsts8.seq
150592619 gbsts9.seq
70839373 gbsyn.seq
4067850 gbuna.seq
250001235 gbvrl1.seq
250001735 gbvrl2.seq
250004095 gbvrl3.seq
193506315 gbvrl4.seq
250001013 gbvrt1.seq
250020458 gbvrt2.seq
250002846 gbvrt3.seq
250123230 gbvrt4.seq
250160424 gbvrt5.seq
250126990 gbvrt6.seq
250248880 gbvrt7.seq
78475354 gbvrt8.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 32153 98157363
BCT10 25414 100985020
BCT11 33343 73018945
BCT2 7888 108449937
BCT3 990 113856007
BCT4 32144 101303692
BCT5 50203 91368732
BCT6 61995 87318712
BCT7 53040 94047104
BCT8 7383 107080695
BCT9 2584 102387340
EST1 68123 26288742
EST10 76553 29777665
EST100 72078 43239985
EST101 70620 43828456
EST102 74164 37978682
EST103 69806 30875272
EST104 66444 31607386
EST105 66011 38790383
EST106 70256 37298243
EST107 69840 45574803
EST108 76189 34931669
EST109 74518 27664639
EST11 74773 28650824
EST110 75677 25974370
EST111 73446 38994912
EST112 63705 31944600
EST113 79027 46724657
EST114 79221 44926572
EST115 72693 45372173
EST116 68449 43561775
EST117 73060 47025395
EST118 67800 44977078
EST119 73920 43903131
EST12 77405 30641423
EST120 74956 45260618
EST121 73419 47717026
EST122 75306 48636949
EST123 73085 46681352
EST124 78255 38301779
EST125 77921 26237727
EST126 80622 48426724
EST127 74940 43925426
EST128 67235 37752459
EST129 70447 34968804
EST13 76282 29157335
EST130 67288 37921204
EST131 66728 36302867
EST132 69464 42515156
EST133 73006 41597794
EST134 68847 43391415
EST135 69388 41741522
EST136 73616 42169484
EST137 68563 41805544
EST138 58474 33354799
EST139 96316 52300461
EST14 78003 31388159
EST140 89251 51279761
EST141 78654 40498300
EST142 107339 58004602
EST143 108370 57992635
EST144 98543 54355427
EST145 73555 45116641
EST146 95676 56257389
EST147 95266 57718161
EST148 69526 39830729
EST149 66280 31235837
EST15 74381 31427617
EST150 61895 28194844
EST151 56841 27288797
EST152 63105 31211788
EST153 54453 27394256
EST154 79661 52827398
EST155 68545 37866694
EST156 72322 52521584
EST157 72569 41337850
EST158 60843 30553406
EST159 64554 38516536
EST16 75753 33341311
EST160 66447 32723452
EST161 63434 45953248
EST162 64724 37239683
EST163 102560 45177735
EST164 88829 52815189
EST165 102225 59205633
EST166 105221 57466750
EST167 89497 47537726
EST168 90666 37505749
EST169 95199 50978379
EST17 81740 33471291
EST170 95139 41444056
EST171 73705 37810477
EST172 67956 44890657
EST173 65975 37835001
EST174 64722 42516493
EST175 68228 31193868
EST176 76248 31240011
EST177 70456 44530446
EST178 82875 41269349
EST179 61612 31995753
EST18 80648 32659387
EST180 68632 48341931
EST181 70483 46331409
EST182 67946 36851802
EST183 67524 44692734
EST184 70593 54586500
EST185 69213 33403086
EST186 72353 40857598
EST187 70023 59705417
EST188 66613 50124936
EST189 64624 47000254
EST19 78730 31476944
EST190 64125 47543943
EST191 66064 46135640
EST192 65778 47708895
EST193 64099 46932163
EST194 62234 37604471
EST195 64128 34256880
EST196 63685 37202143
EST197 84685 47822318
EST198 84067 54915949
EST199 73768 43364566
EST2 74815 28708018
EST20 74198 30848101
EST200 106355 66498978
EST201 108668 65370671
EST202 108910 64412074
EST203 103284 66922221
EST204 112747 60921114
EST205 87072 45149804
EST206 69995 41239320
EST207 68562 59142016
EST208 70752 56564970
EST209 79106 39857510
EST21 74558 34295870
EST210 80721 46689318
EST211 74556 52918494
EST212 72237 49049719
EST213 35381 15603152
EST214 27827 10625362
EST215 27519 10168309
EST216 26374 9675917
EST217 26667 8974599
EST218 27679 10065418
EST219 27236 9877640
EST22 73981 29634712
EST220 27224 9826886
EST221 27335 10480880
EST222 27148 12039274
EST223 27256 11172438
EST224 27379 10037625
EST225 27653 9265593
EST226 26908 9363281
EST227 27840 11327370
EST228 27743 10872318
EST229 27011 11337982
EST23 77309 32952497
EST230 26703 12017628
EST231 27109 11279662
EST232 27068 10905941
EST233 27061 11667221
EST234 27186 11561081
EST235 27299 10994352
EST236 27294 10858521
EST237 27195 10485078
EST238 27170 11581106
EST239 24425 17249044
EST24 74322 32254712
EST240 25839 17267691
EST241 50305 21017374
EST242 105385 41802420
EST243 72040 41940832
EST244 68679 44528685
EST245 69410 44521739
EST246 69423 44014943
EST247 68703 40232523
EST248 71698 41375986
EST249 65212 49394099
EST25 74596 32434312
EST250 63832 31878180
EST251 82985 40988723
EST252 100767 46403685
EST253 71525 41525206
EST254 65864 33152493
EST255 69091 33370699
EST256 70451 42764417
EST257 74600 34579404
EST258 71049 37001557
EST259 72248 46506099
EST26 74486 30496494
EST260 63277 35427451
EST261 68724 35033852
EST262 85347 45608494
EST263 78156 44460947
EST264 79200 55410982
EST265 88996 53023527
EST266 104479 46791481
EST267 80384 46771061
EST268 70880 42243520
EST269 74922 38745520
EST27 74732 32477701
EST270 69377 33561290
EST271 70412 29417012
EST272 69040 40570452
EST273 60011 35675620
EST274 67371 42214169
EST275 68894 40291562
EST276 62333 42820860
EST277 77492 39136461
EST278 81301 43231413
EST279 73852 42522824
EST28 107166 50741139
EST280 92024 54076694
EST281 116134 49932069
EST282 102671 45931849
EST283 68059 36406707
EST284 69514 40547351
EST285 76554 45178958
EST286 77056 38501760
EST287 71175 45445202
EST288 69091 37564153
EST289 59982 37065528
EST29 97893 45944661
EST290 52201 26761243
EST291 72143 51381244
EST292 68443 40701354
EST293 75508 45358277
EST294 65749 37851874
EST295 74801 40556318
EST296 74578 48257506
EST297 75921 38085439
EST298 68997 54398548
EST299 65626 50394874
EST3 73672 29896385
EST30 98393 51673884
EST300 57854 43325960
EST301 63804 34467096
EST302 72331 46956681
EST303 63264 39267499
EST304 56895 27951814
EST305 66800 36618204
EST306 64174 34322305
EST307 63629 31556977
EST308 63206 40533929
EST309 84500 43807621
EST31 69479 44015163
EST310 70792 41864495
EST311 68787 43787332
EST312 68690 38314846
EST313 63332 41639951
EST314 90733 52241306
EST315 84655 50514484
EST316 75644 41789384
EST317 61928 36522241
EST318 71261 38269502
EST319 65770 34551414
EST32 71744 57204754
EST320 47405 24325750
EST321 66398 36882929
EST322 85962 46808049
EST323 95525 48941689
EST324 64490 43855320
EST325 79806 54005250
EST326 68765 38482065
EST327 58682 33694938
EST328 93329 39029674
EST329 59499 38879501
EST33 85225 48665864
EST330 66361 38615562
EST331 68226 44428083
EST332 102182 56664511
EST333 71899 36733560
EST334 79457 43888761
EST335 61139 38980671
EST336 43220 22256328
EST337 57640 34367691
EST338 84954 46158979
EST339 78933 46595773
EST34 86445 43611874
EST340 74072 40287298
EST341 66464 39189273
EST342 61931 39975580
EST343 66686 38281222
EST344 63963 33943269
EST345 80095 25412153
EST346 71636 36074614
EST347 70256 39054133
EST348 69724 39716442
EST349 67996 38094847
EST35 91991 45373694
EST350 65971 46333767
EST351 73527 43380976
EST352 61755 34320194
EST353 71487 43083867
EST354 78134 49800874
EST355 81954 47759801
EST356 59513 41830587
EST357 57391 41704601
EST358 57663 41243778
EST359 62386 39385833
EST36 100482 47221294
EST360 78391 47951613
EST361 49384 31429689
EST362 59355 37703906
EST363 57951 40804513
EST364 61449 42438093
EST365 55536 41665083
EST366 46994 33567711
EST367 83326 39006711
EST368 52305 40653085
EST369 65283 46567712
EST37 98739 51247706
EST370 77384 26858823
EST371 71492 25414055
EST372 73307 27221025
EST373 72831 26363092
EST374 79528 26789404
EST375 72880 27419265
EST376 68059 28894962
EST377 24308 7558478
EST38 97456 39722394
EST39 68672 18446777
EST4 74041 28187828
EST40 68902 18416951
EST41 67261 20337557
EST42 43369 11822923
EST43 43167 12129700
EST44 42898 11425381
EST45 67626 25933033
EST46 97798 44198962
EST47 94554 45778690
EST48 90353 44738454
EST49 98887 49129158
EST5 48459 15406631
EST50 105211 54118998
EST51 75786 33346217
EST52 67359 28541255
EST53 72313 32685084
EST54 71894 30452437
EST55 78213 32081328
EST56 78223 30907530
EST57 70515 28064880
EST58 63966 29349960
EST59 73170 32480168
EST6 55075 17489987
EST60 79925 35972873
EST61 73702 29097679
EST62 74263 25641741
EST63 87367 42155645
EST64 44487 13152695
EST65 40093 11043199
EST66 40109 12168876
EST67 40428 12524046
EST68 40513 12076629
EST69 40420 13076747
EST7 74128 29185667
EST70 40466 12608864
EST71 40334 12301848
EST72 40031 12011183
EST73 40608 12707472
EST74 41416 11705060
EST75 41125 13136568
EST76 40997 12687219
EST77 41120 13360244
EST78 45696 11924842
EST79 39935 25487085
EST8 75478 30478367
EST80 42139 21728542
EST81 46231 18900831
EST82 49727 22824145
EST83 51608 21392053
EST84 57264 23509802
EST85 76211 31671527
EST86 74878 29010411
EST87 73070 34599265
EST88 77147 45503367
EST89 77089 42629477
EST9 77494 29869459
EST90 76751 37452711
EST91 75910 41759985
EST92 72783 39380075
EST93 73087 30282406
EST94 75082 45541228
EST95 70328 30966906
EST96 77289 49372772
EST97 64129 34980411
EST98 71776 36924983
EST99 74017 44221782
GSS1 90866 38853302
GSS10 75262 43850301
GSS100 74642 43218254
GSS101 73683 45640064
GSS102 73958 44948630
GSS103 73442 45786487
GSS104 73496 44973273
GSS105 76036 47197634
GSS106 85577 57658979
GSS107 84762 55800853
GSS108 82098 52329993
GSS109 86743 53213736
GSS11 70022 35807872
GSS110 79292 56143126
GSS111 86596 45875656
GSS112 96129 52412771
GSS113 77722 49027772
GSS114 16183 10634005
GSS115 87937 65332512
GSS116 84794 63625335
GSS117 101966 47336460
GSS118 69758 59668655
GSS119 69744 59657480
GSS12 73865 38761271
GSS120 70691 57799468
GSS121 70935 57336128
GSS122 73416 58490049
GSS123 85642 69687025
GSS124 83704 44345563
GSS125 74241 44610906
GSS126 110837 74274364
GSS127 85472 35409652
GSS128 87008 68191488
GSS129 70175 58704869
GSS13 76108 38160348
GSS130 69658 58570490
GSS131 64463 62366102
GSS132 82271 58602141
GSS133 123533 74895062
GSS134 120396 78003542
GSS135 104443 56960372
GSS136 85075 54966704
GSS137 102694 56119999
GSS138 90637 42272215
GSS14 71690 32209826
GSS15 71814 35869998
GSS16 76929 45309577
GSS17 71165 33395708
GSS18 57400 27928835
GSS19 57027 28891385
GSS2 89464 39573405
GSS20 58000 26274974
GSS21 62584 32552559
GSS22 64073 34908296
GSS23 57686 27112034
GSS24 68638 43546020
GSS25 65993 26951436
GSS26 58186 25787401
GSS27 69081 32213996
GSS28 61827 32970553
GSS29 82569 41229585
GSS3 87785 41976203
GSS30 80760 39721324
GSS31 74478 40462500
GSS32 70956 47964974
GSS33 80076 38500705
GSS34 76230 40278978
GSS35 76467 41432109
GSS36 94360 62681097
GSS37 93865 60181318
GSS38 90259 49377839
GSS39 87236 45731581
GSS4 79520 41321610
GSS40 86965 35321681
GSS41 82044 43482986
GSS42 81423 57056091
GSS43 76703 54283694
GSS44 72191 47720100
GSS45 72244 47604211
GSS46 79234 43052232
GSS47 80297 44112270
GSS48 90946 65216198
GSS49 85097 64189533
GSS5 79098 40780176
GSS50 89704 52567925
GSS51 89389 57338290
GSS52 83554 55544961
GSS53 72387 37606330
GSS54 84955 55602712
GSS55 84599 43502922
GSS56 84551 56280339
GSS57 73007 78374953
GSS58 76831 74950133
GSS59 92192 68252742
GSS6 78215 38872615
GSS60 74600 47164031
GSS61 64261 45401505
GSS62 80033 58185415
GSS63 89751 66798254
GSS64 84255 50341600
GSS65 88510 56533963
GSS66 91534 62289941
GSS67 101437 53482573
GSS68 100391 54809947
GSS69 100993 54045835
GSS7 77498 39463494
GSS70 102273 52422567
GSS71 101874 52929505
GSS72 102730 51842371
GSS73 102760 51804622
GSS74 100890 54175743
GSS75 93808 63791428
GSS76 89872 70730129
GSS77 89089 70227513
GSS78 87876 69612165
GSS79 88987 65617823
GSS8 76456 38112473
GSS80 89931 48388651
GSS81 78978 23012019
GSS82 78579 24003955
GSS83 86369 47446573
GSS84 77495 47405112
GSS85 91741 57716721
GSS86 84859 59031635
GSS87 76542 77433607
GSS88 79400 72447656
GSS89 86507 48126844
GSS9 72655 37341553
GSS90 85763 49179733
GSS91 76241 42198173
GSS92 80056 60282091
GSS93 80098 54999379
GSS94 81179 55414604
GSS95 87817 58955288
GSS96 84875 57793437
GSS97 88427 52563572
GSS98 82321 70726267
GSS99 80321 47881548
HTC1 32058 55427883
HTC2 31311 66327861
HTC3 71322 42308266
HTC4 86144 77056088
HTC5 97225 85566547
HTC6 49778 84857258
HTG1 1318 188913628
HTG10 1238 186866133
HTG11 1426 184277921
HTG12 906 192064850
HTG13 751 192431886
HTG14 744 192254744
HTG15 774 192209055
HTG16 802 192205752
HTG17 768 192379157
HTG18 1956 172868961
HTG19 997 189377812
HTG2 2426 186092649
HTG20 1190 186782551
HTG21 808 191552631
HTG22 886 190744541
HTG23 876 191284403
HTG24 891 190628102
HTG25 781 191939488
HTG26 824 191792268
HTG27 845 191711504
HTG28 914 190720208
HTG29 948 190385907
HTG3 2526 185355565
HTG30 921 190897622
HTG31 937 190489228
HTG32 886 191447211
HTG33 897 190926664
HTG34 927 190524711
HTG35 902 190989014
HTG36 826 191852112
HTG37 868 191371193
HTG38 920 190733158
HTG39 950 190842372
HTG4 2582 188604506
HTG40 948 190414656
HTG41 1045 189522709
HTG42 1210 187046676
HTG43 1216 188986234
HTG44 1184 188583875
HTG45 1161 187091122
HTG46 1097 191298835
HTG47 1220 191011631
HTG48 1234 191249359
HTG49 1173 191614445
HTG5 1288 185690221
HTG50 1220 191238863
HTG51 1129 190645705
HTG52 1077 188904189
HTG53 997 192013312
HTG54 1330 189069677
HTG55 1521 187353300
HTG56 1171 192588472
HTG57 1197 190910182
HTG58 1463 188808649
HTG59 976 194150926
HTG6 1275 185330254
HTG60 1100 193431569
HTG61 1043 193753226
HTG62 1062 193428386
HTG63 657 113750703
HTG7 1243 185695093
HTG8 1289 184983538
HTG9 1189 187146580
INV1 14688 166458291
INV2 1522 168012538
INV3 47218 102194192
INV4 72279 76120367
INV5 81060 73770453
INV6 31345 115998984
INV7 20805 51663451
MAM1 58740 106764584
MAM2 11446 11672356
PAT1 223049 70322900
PAT10 103344 62799635
PAT11 113959 51806385
PAT12 151071 55874938
PAT13 157696 78034667
PAT14 105100 119845276
PAT15 144558 91874183
PAT16 110540 99228423
PAT17 80264 22721927
PAT2 199596 89436008
PAT3 180802 98886429
PAT4 147774 100223840
PAT5 146085 88487184
PAT6 112956 115426145
PAT7 136389 97002657
PAT8 132252 95027292
PAT9 141054 56903730
PHG 2893 14104224
PLN1 31413 126266339
PLN10 28041 124739025
PLN11 65593 67643235
PLN12 75890 80594651
PLN13 50571 105878243
PLN14 35595 114012323
PLN15 38732 109641264
PLN2 1390 181644675
PLN3 23985 136748759
PLN4 78524 76072697
PLN5 56153 60948365
PLN6 23960 85174220
PLN7 1263 166020802
PLN8 794 208173385
PLN9 7 199428952
PRI1 18246 151079293
PRI10 1410 176531490
PRI11 1267 175606184
PRI12 1499 175135043
PRI13 1595 178584996
PRI14 1522 184318040
PRI15 22027 155280843
PRI16 42975 98352856
PRI17 15409 143604578
PRI18 1605 184258867
PRI19 1752 183474573
PRI2 1425 172809320
PRI20 2105 181959490
PRI21 1611 185770752
PRI22 33672 132480208
PRI23 43317 76739844
PRI24 12750 152317468
PRI25 18092 159476804
PRI26 49123 121788208
PRI27 32919 135545879
PRI28 37416 59839534
PRI3 1255 182763769
PRI4 1296 178043212
PRI5 1145 173874105
PRI6 1193 178691360
PRI7 1215 177223446
PRI8 1329 169495429
PRI9 1224 177401310
ROD1 8892 170680557
ROD10 1020 185293671
ROD11 26934 145713127
ROD12 1183 191754021
ROD13 1250 193464533
ROD14 22781 157341942
ROD15 26572 90256299
ROD16 46313 117648036
ROD2 919 174394094
ROD3 889 174201377
ROD4 921 175193162
ROD5 980 178616478
ROD6 955 179590481
ROD7 994 181585305
ROD8 1009 182562421
ROD9 991 182988423
STS1 89273 48299744
STS2 75702 31837237
STS3 85627 37158362
STS4 54998 32328154
STS5 55264 32081319
STS6 55030 32473038
STS7 54834 32737860
STS8 86643 33713021
STS9 58921 27093025
SYN 16275 24564891
UNA 1734 790144
VRL1 72663 65439642
VRL2 73160 65516848
VRL3 71460 70581252
VRL4 57062 52527159
VRT1 62187 98889396
VRT2 9633 176357458
VRT3 72780 69196447
VRT4 15743 133315728
VRT5 1248 193203874
VRT6 1307 192888533
VRT7 28337 152161552
VRT8 22992 24961972
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 146.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
8435475 11032844920 Homo sapiens
6203790 6959285980 Mus musculus
996433 5652351332 Rattus norvegicus
778953 2073169626 Danio rerio
2298240 1509886463 Zea mays
352657 1163611693 Oryza sativa (japonica cultivar-group)
994193 956137062 Bos taurus
1026679 825588168 Xenopus tropicalis
499736 770996863 Drosophila melanogaster
1230325 709950181 Canis familiaris
923884 621715458 Arabidopsis thaliana
716057 613208621 Gallus gallus
784398 462478825 Sorghum bicolor
194013 454788588 Pan troglodytes
693181 418408085 Ciona intestinalis
596153 404042658 Brassica oleracea
597184 379878761 Sus scrofa
56716 377364740 Macaca mulatta
377465 363622217 Medicago truncatula
596448 334178050 Triticum aestivum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 October 2005
NCBI-GenBank Flat File Release 146.0
Bacterial Sequences (Part 1)
37811 loci, 97585608 bases, from 37811 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
bits-request@ncbi.nlm.nih.gov
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A.,
Wheeler D.L. GenBank. Nucl. Acids Res. 28(1):15-18 (2000)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:
ftp://genbank.sdsc.edu/pub
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to
indicate the GenBank release number (e.g., Release 146.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
Renata Geer, Scott McGinnis, Donna Messersmith, Rana Morris, Vyvy Pham,
Monica Romiti, Eric Sayers, Tao Tao, David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
