Release Notes For GenBank Release 146

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2005

               NCBI-GenBank Flat File Release 146.0

                    Distribution Release Notes

 42734478 loci, 46849831226 bases, from 42734478 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 146.0
1.2 Cutoff Date
1.3 Important Changes in Release 146.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 146.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 146.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

Mirrors of the GenBank FTP site at the NCBI are available from the San Diego
Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from these alternate sites when traffic at
the NCBI is high.

        *** NOTE *** The SDSC GenBank mirror site is experiencing problems
	caused by disk space limitations. Users of this site should closely
	check the file content (total number of files and their dates) at
	the mirror before using it. We will provide further details about
	the status of the SDSC mirror as they become available.

1.2 Cutoff Date

  This full release, 146.0, incorporates data available to the collaborating
databases as of February 16, 2005 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 146.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 37 with this release:

  - the EST division is now comprised of 377 files (+22)
  - the GSS division is now comprised of 138 files (+6)
  - the HTG division is now comprised of  63 files (+1)
  - the PLN division is now comprised of  15 files (+2)
  - the ROD division is now comprised of  16 files (+1)
  - the STS division is now comprised of   9 files (+4)
  - the VRT division is now comprised of   8 files (+1)

1.3.2 Continuous ranges of secondary accessions

  With the removal of sequence length limits, some genomes (typically
bacterial) that had been split into many pieces are gradually being
replaced by a single sequence record. U00096 is a good example.

  When this happens, the accessions of the former small pieces become
secondary accessions for the single large sequence record. When each
secondary is separately listed, the ACCESSION line becomes excessively
lengthy.

  As of this February 2005 GenBank Release, continuous ranges of secondary
accessions (represented by a start accession, a dash character, and an end
accession) will begin to appear, initially within the GenBank Updates. In
the case of U00096, the ACCESSION line would look like:

	ACCESSION   U00096 AE000111-AE000510

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
twenty-four GSS flatfiles in Release 146.0. Consider gbgss115.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                          February 15 2005

                NCBI-GenBank Flat File Release 146.0

                           GSS Sequences (Part 1)

   87937 loci,    65332512 bases, from    87937 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "115" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New ENV Division in April 2005

  A new division for sequences obtained via environmental sampling methods
will be introduced with GenBank Release 147.0 in April 2005 . Records in this
new division will have these characteristics:

  1. ENV division code on the LOCUS line
  2. ENV keyword
  3. /environmental_sample qualifier in the source feature

This new division will segregate sequences for which the source organism is
unknown, or can only be inferred by sequence comparison.

  Sequences from WGS projects that involve environmental sampling will *not*
be distributed via this new division. All WGS projects will continue to be
distributed using project-specific data files at the NCBI FTP site:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	ftp://ftp.ncbi.nih.gov/genbank/wgs

  Additional information about the new ENV division will be provided via
these release notes and the GenBank newsgroup.  

1.4.2 Removal of MEDLINE linetype in April 2005

The PUBMED linetype was introduced in December of 1997, as a means of
linking references in sequence records to the PubMed biomedical literature
database, based on a PubMed ID (PMID) .

Since then, we have been displaying both the PMID and its predecessor
(Medline Unique ID / MUID) for all references. For example :

LOCUS       ECOGUABA                3531 bp    DNA     linear   BCT
09-FEB-2005
DEFINITION  Escherichia coli guaBA operon operon, complete sequence.
ACCESSION   M10101 M10102
VERSION     M10101.1  GI:146274
....
REFERENCE   1  (bases 1768 to 3531)
  AUTHORS   Tiedeman,A.A., Smith,J.M. and Zalkin,H.
  TITLE     Nucleotide sequence of the guaA gene encoding GMP synthetase of
            Escherichia coli K12
  JOURNAL   J. Biol. Chem. 260 (15), 8676-8679 (1985)
  MEDLINE   85261223
   PUBMED   3894345

Subsequent to 1997, PMID article identifiers subsumed MUIDs. Some background
information about that evolution can be found at:

  http://www.nlm.nih.gov/pubs/techbull/mj01/mj01_medline_ui.html

Starting with GenBank Release 147.0 in April of 2005, the older MEDLINE
linetype will be displayed in GenBank sequence records only for (very rare)
articles that lack a PMID identifier.

For the vast majority of cases, this means that the MEDLINE linetype will
no longer be displayed; only the PUBMED identifier will be presented.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

  The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 743 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut28.idx - Index of the entries according to accession number, part 28.
23. gbaut3.idx - Index of the entries according to accession number, part 3.
24. gbaut4.idx - Index of the entries according to accession number, part 4.
25. gbaut5.idx - Index of the entries according to accession number, part 5.
26. gbaut6.idx - Index of the entries according to accession number, part 6.
27. gbaut7.idx - Index of the entries according to accession number, part 7.
28. gbaut8.idx - Index of the entries according to accession number, part 8.
29. gbaut9.idx - Index of the entries according to accession number, part 9.
30. gbbct1.seq - Bacterial sequence entries, part 1.
31. gbbct10.seq - Bacterial sequence entries, part 10.
32. gbbct11.seq - Bacterial sequence entries, part 11.
33. gbbct2.seq - Bacterial sequence entries, part 2.
34. gbbct3.seq - Bacterial sequence entries, part 3.
35. gbbct4.seq - Bacterial sequence entries, part 4.
36. gbbct5.seq - Bacterial sequence entries, part 5.
37. gbbct6.seq - Bacterial sequence entries, part 6.
38. gbbct7.seq - Bacterial sequence entries, part 7.
39. gbbct8.seq - Bacterial sequence entries, part 8.
40. gbbct9.seq - Bacterial sequence entries, part 9.
41. gbchg.txt - Accession numbers of entries updated since the previous release.
42. gbcon.seq - Constructed sequence entries.
43. gbdel.txt - Accession numbers of entries deleted since the previous release.
44. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
45. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
46. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
47. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
48. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
49. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
50. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
51. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
52. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
53. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
54. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
55. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
56. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
57. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
58. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
59. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
60. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
61. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
62. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
63. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
64. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
65. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
66. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
67. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
68. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
69. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
70. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
71. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
72. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
73. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
74. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
75. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
76. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
77. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
78. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
79. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
80. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
81. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
82. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
83. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
84. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
85. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
86. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
87. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
88. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
89. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
90. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
91. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
92. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
93. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
94. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
95. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
96. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
97. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
98. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
99. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
100. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
101. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
102. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
103. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
104. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
105. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
106. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
107. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
108. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
109. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
110. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
111. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
112. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
113. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
114. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
115. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
116. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
117. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
118. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
119. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
120. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
121. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
122. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
123. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
124. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
125. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
126. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
127. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
128. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
129. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
130. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
131. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
132. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
133. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
134. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
135. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
136. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
137. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
138. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
139. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
140. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
141. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
142. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
143. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
144. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
145. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
146. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
147. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
148. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
149. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
150. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
151. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
152. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
153. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
154. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
155. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
156. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
157. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
158. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
159. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
160. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
161. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
162. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
163. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
164. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
165. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
166. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
167. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
168. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
169. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
170. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
171. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
172. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
173. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
174. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
175. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
176. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
177. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
178. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
179. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
180. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
181. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
182. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
183. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
184. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
185. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
186. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
187. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
188. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
189. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
190. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
191. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
192. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
193. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
194. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
195. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
196. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
197. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
198. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
199. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
200. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
201. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
202. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
203. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
204. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
205. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
206. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
207. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
208. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
209. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
210. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
211. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
212. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
213. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
214. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
215. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
216. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
217. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
218. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
219. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
220. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
221. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
222. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
223. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
224. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
225. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
226. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
227. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
228. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
229. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
230. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
231. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
232. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
233. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
234. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
235. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
236. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
237. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
238. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
239. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
240. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
241. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
242. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
243. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
244. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
245. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
246. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
247. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
248. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
249. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
250. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
251. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
252. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
253. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
254. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
255. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
256. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
257. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
258. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
259. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
260. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
261. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
262. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
263. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
264. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
265. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
266. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
267. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
268. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
269. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
270. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
271. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
272. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
273. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
274. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
275. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
276. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
277. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
278. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
279. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
280. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
281. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
282. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
283. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
284. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
285. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
286. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
287. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
288. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
289. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
290. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
291. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
292. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
293. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
294. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
295. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
296. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
297. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
298. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
299. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
300. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
301. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
302. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
303. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
304. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
305. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
306. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
307. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
308. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
309. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
310. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
311. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
312. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
313. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
314. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
315. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
316. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
317. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
318. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
319. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
320. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
321. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
322. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
323. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
324. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
325. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
326. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
327. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
328. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
329. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
330. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
331. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
332. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
333. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
334. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
335. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
336. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
337. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
338. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
339. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
340. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
341. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
342. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
343. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
344. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
345. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
346. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
347. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
348. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
349. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
350. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
351. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
352. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
353. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
354. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
355. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
356. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
357. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
358. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
359. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
360. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
361. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
362. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
363. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
364. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
365. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
366. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
367. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
368. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
369. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
370. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
371. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
372. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
373. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
374. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
375. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
376. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
377. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
378. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
379. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
380. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
381. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
382. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
383. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
384. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
385. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
386. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
387. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
388. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
389. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
390. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
391. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
392. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
393. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
394. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
395. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
396. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
397. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
398. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
399. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
400. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
401. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
402. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
403. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
404. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
405. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
406. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
407. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
408. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
409. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
410. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
411. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
412. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
413. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
414. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
415. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
416. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
417. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
418. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
419. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
420. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
421. gbgen.idx - Index of the entries according to gene symbols.
422. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
423. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
424. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
425. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
426. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
427. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
428. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
429. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
430. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
431. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
432. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
433. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
434. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
435. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
436. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
437. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
438. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
439. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
440. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
441. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
442. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
443. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
444. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
445. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
446. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
447. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
448. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
449. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
450. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
451. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
452. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
453. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
454. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
455. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
456. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
457. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
458. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
459. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
460. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
461. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
462. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
463. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
464. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
465. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
466. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
467. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
468. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
469. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
470. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
471. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
472. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
473. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
474. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
475. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
476. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
477. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
478. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
479. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
480. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
481. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
482. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
483. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
484. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
485. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
486. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
487. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
488. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
489. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
490. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
491. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
492. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
493. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
494. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
495. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
496. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
497. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
498. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
499. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
500. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
501. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
502. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
503. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
504. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
505. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
506. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
507. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
508. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
509. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
510. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
511. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
512. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
513. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
514. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
515. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
516. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
517. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
518. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
519. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
520. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
521. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
522. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
523. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
524. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
525. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
526. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
527. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
528. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
529. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
530. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
531. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
532. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
533. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
534. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
535. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
536. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
537. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
538. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
539. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
540. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
541. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
542. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
543. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
544. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
545. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
546. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
547. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
548. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
549. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
550. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
551. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
552. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
553. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
554. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
555. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
556. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
557. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
558. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
559. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
560. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
561. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
562. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
563. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
564. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
565. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
566. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
567. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
568. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
569. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
570. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
571. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
572. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
573. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
574. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
575. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
576. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
577. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
578. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
579. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
580. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
581. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
582. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
583. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
584. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
585. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
586. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
587. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
588. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
589. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
590. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
591. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
592. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
593. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
594. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
595. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
596. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
597. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
598. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
599. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
600. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
601. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
602. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
603. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
604. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
605. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
606. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
607. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
608. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
609. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
610. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
611. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
612. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
613. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
614. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
615. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
616. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
617. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
618. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
619. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
620. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
621. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
622. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
623. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
624. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
625. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
626. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
627. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
628. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
629. gbinv1.seq - Invertebrate sequence entries, part 1.
630. gbinv2.seq - Invertebrate sequence entries, part 2.
631. gbinv3.seq - Invertebrate sequence entries, part 3.
632. gbinv4.seq - Invertebrate sequence entries, part 4.
633. gbinv5.seq - Invertebrate sequence entries, part 5.
634. gbinv6.seq - Invertebrate sequence entries, part 6.
635. gbinv7.seq - Invertebrate sequence entries, part 7.
636. gbjou.idx - Index of the entries according to journal citation.
637. gbkey.idx - Index of the entries according to keyword phrase.
638. gbmam1.seq - Other mammalian sequence entries, part 1.
639. gbmam2.seq - Other mammalian sequence entries, part 2.
640. gbnew.txt - Accession numbers of entries new since the previous release.
641. gbpat1.seq - Patent sequence entries, part 1.
642. gbpat10.seq - Patent sequence entries, part 10.
643. gbpat11.seq - Patent sequence entries, part 11.
644. gbpat12.seq - Patent sequence entries, part 12.
645. gbpat13.seq - Patent sequence entries, part 13.
646. gbpat14.seq - Patent sequence entries, part 14.
647. gbpat15.seq - Patent sequence entries, part 15.
648. gbpat16.seq - Patent sequence entries, part 16.
649. gbpat17.seq - Patent sequence entries, part 17.
650. gbpat2.seq - Patent sequence entries, part 2.
651. gbpat3.seq - Patent sequence entries, part 3.
652. gbpat4.seq - Patent sequence entries, part 4.
653. gbpat5.seq - Patent sequence entries, part 5.
654. gbpat6.seq - Patent sequence entries, part 6.
655. gbpat7.seq - Patent sequence entries, part 7.
656. gbpat8.seq - Patent sequence entries, part 8.
657. gbpat9.seq - Patent sequence entries, part 9.
658. gbphg.seq - Phage sequence entries.
659. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
660. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
661. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
662. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
663. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
664. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
665. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
666. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
667. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
668. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
669. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
670. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
671. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
672. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
673. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
674. gbpri1.seq - Primate sequence entries, part 1.
675. gbpri10.seq - Primate sequence entries, part 10.
676. gbpri11.seq - Primate sequence entries, part 11.
677. gbpri12.seq - Primate sequence entries, part 12.
678. gbpri13.seq - Primate sequence entries, part 13.
679. gbpri14.seq - Primate sequence entries, part 14.
680. gbpri15.seq - Primate sequence entries, part 15.
681. gbpri16.seq - Primate sequence entries, part 16.
682. gbpri17.seq - Primate sequence entries, part 17.
683. gbpri18.seq - Primate sequence entries, part 18.
684. gbpri19.seq - Primate sequence entries, part 19.
685. gbpri2.seq - Primate sequence entries, part 2.
686. gbpri20.seq - Primate sequence entries, part 20.
687. gbpri21.seq - Primate sequence entries, part 21.
688. gbpri22.seq - Primate sequence entries, part 22.
689. gbpri23.seq - Primate sequence entries, part 23.
690. gbpri24.seq - Primate sequence entries, part 24.
691. gbpri25.seq - Primate sequence entries, part 25.
692. gbpri26.seq - Primate sequence entries, part 26.
693. gbpri27.seq - Primate sequence entries, part 27.
694. gbpri28.seq - Primate sequence entries, part 28.
695. gbpri3.seq - Primate sequence entries, part 3.
696. gbpri4.seq - Primate sequence entries, part 4.
697. gbpri5.seq - Primate sequence entries, part 5.
698. gbpri6.seq - Primate sequence entries, part 6.
699. gbpri7.seq - Primate sequence entries, part 7.
700. gbpri8.seq - Primate sequence entries, part 8.
701. gbpri9.seq - Primate sequence entries, part 9.
702. gbrel.txt - Release notes (this document).
703. gbrod1.seq - Rodent sequence entries, part 1.
704. gbrod10.seq - Rodent sequence entries, part 10.
705. gbrod11.seq - Rodent sequence entries, part 11.
706. gbrod12.seq - Rodent sequence entries, part 12.
707. gbrod13.seq - Rodent sequence entries, part 13.
708. gbrod14.seq - Rodent sequence entries, part 14.
709. gbrod15.seq - Rodent sequence entries, part 15.
710. gbrod16.seq - Rodent sequence entries, part 16.
711. gbrod2.seq - Rodent sequence entries, part 2.
712. gbrod3.seq - Rodent sequence entries, part 3.
713. gbrod4.seq - Rodent sequence entries, part 4.
714. gbrod5.seq - Rodent sequence entries, part 5.
715. gbrod6.seq - Rodent sequence entries, part 6.
716. gbrod7.seq - Rodent sequence entries, part 7.
717. gbrod8.seq - Rodent sequence entries, part 8.
718. gbrod9.seq - Rodent sequence entries, part 9.
719. gbsdr.txt - Short directory of the data bank.
720. gbsec.idx - Index of the entries according to secondary accession number.
721. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
722. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
723. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
724. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
725. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
726. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
727. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
728. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
729. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
730. gbsyn.seq - Synthetic and chimeric sequence entries.
731. gbuna.seq - Unannotated sequence entries.
732. gbvrl1.seq - Viral sequence entries, part 1.
733. gbvrl2.seq - Viral sequence entries, part 2.
734. gbvrl3.seq - Viral sequence entries, part 3.
735. gbvrl4.seq - Viral sequence entries, part 4.
736. gbvrt1.seq - Other vertebrate sequence entries, part 1.
737. gbvrt2.seq - Other vertebrate sequence entries, part 2.
738. gbvrt3.seq - Other vertebrate sequence entries, part 3.
739. gbvrt4.seq - Other vertebrate sequence entries, part 4.
740. gbvrt5.seq - Other vertebrate sequence entries, part 5.
741. gbvrt6.seq - Other vertebrate sequence entries, part 6.
742. gbvrt7.seq - Other vertebrate sequence entries, part 7.
743. gbvrt8.seq - Other vertebrate sequence entries, part 8.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 146.0 flatfiles require roughly 162 GB (sequence
files only) or 180 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1402864615     gbacc.idx
 509322177     gbaut1.idx
 507044917     gbaut10.idx
 520654371     gbaut11.idx
 517073743     gbaut12.idx
 501150830     gbaut13.idx
 538810288     gbaut14.idx
 513454539     gbaut15.idx
 501136243     gbaut16.idx
 500356423     gbaut17.idx
 500347801     gbaut18.idx
 522271355     gbaut19.idx
 506485871     gbaut2.idx
 517019434     gbaut20.idx
 504686612     gbaut21.idx
 500454404     gbaut22.idx
 500307264     gbaut23.idx
 513419260     gbaut24.idx
 503481673     gbaut25.idx
 506367599     gbaut26.idx
 500393195     gbaut27.idx
 397818992     gbaut28.idx
 500475508     gbaut3.idx
 508630417     gbaut4.idx
 503223998     gbaut5.idx
 501683978     gbaut6.idx
 500324265     gbaut7.idx
 500172014     gbaut8.idx
 510599483     gbaut9.idx
 250003604     gbbct1.seq
 250004440     gbbct10.seq
 202621298     gbbct11.seq
 252759499     gbbct2.seq
 250059521     gbbct3.seq
 250011681     gbbct4.seq
 255583354     gbbct5.seq
 250004802     gbbct6.seq
 254309778     gbbct7.seq
 250121516     gbbct8.seq
 250398906     gbbct9.seq
   7700189     gbchg.txt
1066122635     gbcon.seq
     71828     gbdel.txt
 230690163     gbest1.seq
 230689018     gbest10.seq
 230690141     gbest100.seq
 230688550     gbest101.seq
 230688825     gbest102.seq
 230687909     gbest103.seq
 230689530     gbest104.seq
 230687610     gbest105.seq
 230688344     gbest106.seq
 230690176     gbest107.seq
 230687513     gbest108.seq
 230688918     gbest109.seq
 230689293     gbest11.seq
 230038868     gbest110.seq
 230690684     gbest111.seq
 230689407     gbest112.seq
 230687935     gbest113.seq
 230691977     gbest114.seq
 230689662     gbest115.seq
 230690522     gbest116.seq
 230689938     gbest117.seq
 230688547     gbest118.seq
 230690726     gbest119.seq
 230689997     gbest12.seq
 230689779     gbest120.seq
 230689046     gbest121.seq
 230688682     gbest122.seq
 230690293     gbest123.seq
 230689704     gbest124.seq
 229461777     gbest125.seq
 230690683     gbest126.seq
 230689367     gbest127.seq
 230689352     gbest128.seq
 230690602     gbest129.seq
 230688077     gbest13.seq
 230688096     gbest130.seq
 230687887     gbest131.seq
 230690338     gbest132.seq
 230690139     gbest133.seq
 230688381     gbest134.seq
 230690202     gbest135.seq
 230688386     gbest136.seq
 230687521     gbest137.seq
 230688852     gbest138.seq
 230689238     gbest139.seq
 230688146     gbest14.seq
 230688338     gbest140.seq
 230688766     gbest141.seq
 230689203     gbest142.seq
 230689258     gbest143.seq
 230687856     gbest144.seq
 230689522     gbest145.seq
 230688337     gbest146.seq
 230689195     gbest147.seq
 230687618     gbest148.seq
 230689622     gbest149.seq
 230687989     gbest15.seq
 230689086     gbest150.seq
 230690509     gbest151.seq
 230692330     gbest152.seq
 230691110     gbest153.seq
 230690194     gbest154.seq
 230688959     gbest155.seq
 230687835     gbest156.seq
 230688383     gbest157.seq
 230687859     gbest158.seq
 230690930     gbest159.seq
 230689222     gbest16.seq
 230688587     gbest160.seq
 230689093     gbest161.seq
 230688779     gbest162.seq
 230688976     gbest163.seq
 230687957     gbest164.seq
 230687805     gbest165.seq
 230689260     gbest166.seq
 230687442     gbest167.seq
 223703901     gbest168.seq
 230688476     gbest169.seq
 230689139     gbest17.seq
 230688702     gbest170.seq
 230689187     gbest171.seq
 230689091     gbest172.seq
 230689726     gbest173.seq
 230688213     gbest174.seq
 230687834     gbest175.seq
 230688820     gbest176.seq
 230688098     gbest177.seq
 230689493     gbest178.seq
 230688469     gbest179.seq
 230687539     gbest18.seq
 230688463     gbest180.seq
 230688209     gbest181.seq
 230689384     gbest182.seq
 230689989     gbest183.seq
 230690379     gbest184.seq
 230688756     gbest185.seq
 230690549     gbest186.seq
 230687928     gbest187.seq
 230687505     gbest188.seq
 230690028     gbest189.seq
 230690563     gbest19.seq
 230690548     gbest190.seq
 230689537     gbest191.seq
 230690016     gbest192.seq
 230690924     gbest193.seq
 230687668     gbest194.seq
 230689190     gbest195.seq
 230688264     gbest196.seq
 230687938     gbest197.seq
 230687916     gbest198.seq
 230689207     gbest199.seq
 230689335     gbest2.seq
 230689121     gbest20.seq
 230689201     gbest200.seq
 230687826     gbest201.seq
 230688221     gbest202.seq
 230689341     gbest203.seq
 230689093     gbest204.seq
 230687994     gbest205.seq
 230689948     gbest206.seq
 230691092     gbest207.seq
 230688006     gbest208.seq
 230689106     gbest209.seq
 230687465     gbest21.seq
 230688242     gbest210.seq
 230689574     gbest211.seq
 230688992     gbest212.seq
 177241766     gbest213.seq
 162562888     gbest214.seq
 164401144     gbest215.seq
 171041020     gbest216.seq
 169797156     gbest217.seq
 163411052     gbest218.seq
 165067834     gbest219.seq
 230687536     gbest22.seq
 164633668     gbest220.seq
 164067571     gbest221.seq
 164575786     gbest222.seq
 164073374     gbest223.seq
 164143800     gbest224.seq
 162921460     gbest225.seq
 168236662     gbest226.seq
 162346816     gbest227.seq
 163184945     gbest228.seq
 167401118     gbest229.seq
 230687554     gbest23.seq
 167601785     gbest230.seq
 165843709     gbest231.seq
 165694716     gbest232.seq
 165327026     gbest233.seq
 165138224     gbest234.seq
 164252436     gbest235.seq
 164196903     gbest236.seq
 165119195     gbest237.seq
 165206674     gbest238.seq
 180796322     gbest239.seq
 230688044     gbest24.seq
 171949635     gbest240.seq
 188662899     gbest241.seq
 230689531     gbest242.seq
 230687904     gbest243.seq
 230687873     gbest244.seq
 230687539     gbest245.seq
 230689893     gbest246.seq
 230689283     gbest247.seq
 230689609     gbest248.seq
 230689963     gbest249.seq
 230690963     gbest25.seq
 230691543     gbest250.seq
 230687636     gbest251.seq
 230690752     gbest252.seq
 230689850     gbest253.seq
 230690896     gbest254.seq
 230688192     gbest255.seq
 230689857     gbest256.seq
 230690321     gbest257.seq
 230689058     gbest258.seq
 230687451     gbest259.seq
 230687552     gbest26.seq
 230689426     gbest260.seq
 230687864     gbest261.seq
 230688649     gbest262.seq
 230687658     gbest263.seq
 230689410     gbest264.seq
 230688220     gbest265.seq
 230688996     gbest266.seq
 230688729     gbest267.seq
 230689369     gbest268.seq
 230687467     gbest269.seq
 230690379     gbest27.seq
 215797487     gbest270.seq
 214580299     gbest271.seq
 230687703     gbest272.seq
 230687853     gbest273.seq
 230690499     gbest274.seq
 230689404     gbest275.seq
 230688263     gbest276.seq
 230688269     gbest277.seq
 230687880     gbest278.seq
 230689012     gbest279.seq
 230689235     gbest28.seq
 230688500     gbest280.seq
 230687964     gbest281.seq
 230690032     gbest282.seq
 230691005     gbest283.seq
 230691263     gbest284.seq
 230688706     gbest285.seq
 230688891     gbest286.seq
 230687931     gbest287.seq
 230689134     gbest288.seq
 230689830     gbest289.seq
 230688331     gbest29.seq
 230690012     gbest290.seq
 230687709     gbest291.seq
 230690434     gbest292.seq
 230688994     gbest293.seq
 230689065     gbest294.seq
 228254975     gbest295.seq
 230690031     gbest296.seq
 207822995     gbest297.seq
 230690264     gbest298.seq
 230688108     gbest299.seq
 230688665     gbest3.seq
 230688954     gbest30.seq
 230689087     gbest300.seq
 230688736     gbest301.seq
 230689350     gbest302.seq
 193409179     gbest303.seq
 162905964     gbest304.seq
 230688714     gbest305.seq
 230689603     gbest306.seq
 230689770     gbest307.seq
 230690763     gbest308.seq
 230690005     gbest309.seq
 230687536     gbest31.seq
 230688512     gbest310.seq
 230687527     gbest311.seq
 230689645     gbest312.seq
 230687938     gbest313.seq
 230688103     gbest314.seq
 230690729     gbest315.seq
 230688917     gbest316.seq
 230689019     gbest317.seq
 230689043     gbest318.seq
 230689875     gbest319.seq
 230690220     gbest32.seq
 230690711     gbest320.seq
 230689239     gbest321.seq
 230689026     gbest322.seq
 230688788     gbest323.seq
 230689359     gbest324.seq
 230689035     gbest325.seq
 230690440     gbest326.seq
 230687963     gbest327.seq
 230689864     gbest328.seq
 230690689     gbest329.seq
 230689394     gbest33.seq
 230688934     gbest330.seq
 230688174     gbest331.seq
 230688576     gbest332.seq
 230689048     gbest333.seq
 230688392     gbest334.seq
 230691373     gbest335.seq
 230689262     gbest336.seq
 230689649     gbest337.seq
 230688373     gbest338.seq
 230690261     gbest339.seq
 230687709     gbest34.seq
 230687738     gbest340.seq
 230689865     gbest341.seq
 230689811     gbest342.seq
 230688643     gbest343.seq
 230687513     gbest344.seq
 222264072     gbest345.seq
 230688643     gbest346.seq
 230689664     gbest347.seq
 230687639     gbest348.seq
 230688310     gbest349.seq
 230687807     gbest35.seq
 230688893     gbest350.seq
 230687869     gbest351.seq
 230689674     gbest352.seq
 230689166     gbest353.seq
 230688353     gbest354.seq
 230689770     gbest355.seq
 230687634     gbest356.seq
 230687556     gbest357.seq
 230689181     gbest358.seq
 230689904     gbest359.seq
 230690193     gbest36.seq
 230689075     gbest360.seq
 230689643     gbest361.seq
 230688386     gbest362.seq
 230690588     gbest363.seq
 230691109     gbest364.seq
 230690453     gbest365.seq
 230689404     gbest366.seq
 230687735     gbest367.seq
 230690829     gbest368.seq
 230690031     gbest369.seq
 230687816     gbest37.seq
 230689007     gbest370.seq
 230689364     gbest371.seq
 230687782     gbest372.seq
 230688222     gbest373.seq
 228494542     gbest374.seq
 230690180     gbest375.seq
 230688599     gbest376.seq
  59798680     gbest377.seq
 230689965     gbest38.seq
 192525410     gbest39.seq
 230687719     gbest4.seq
 191429471     gbest40.seq
 211598875     gbest41.seq
 216179690     gbest42.seq
 215941675     gbest43.seq
 217013433     gbest44.seq
 230689654     gbest45.seq
 230687751     gbest46.seq
 230482723     gbest47.seq
 228549474     gbest48.seq
 230689000     gbest49.seq
 164506986     gbest5.seq
 230690169     gbest50.seq
 230689687     gbest51.seq
 230690151     gbest52.seq
 230687851     gbest53.seq
 230688379     gbest54.seq
 230689698     gbest55.seq
 230688560     gbest56.seq
 230687966     gbest57.seq
 230689975     gbest58.seq
 230689042     gbest59.seq
 177385182     gbest6.seq
 230689913     gbest60.seq
 230687444     gbest61.seq
 230662834     gbest62.seq
 230688282     gbest63.seq
 211426295     gbest64.seq
 209413182     gbest65.seq
 208929878     gbest66.seq
 209120413     gbest67.seq
 209290798     gbest68.seq
 210838588     gbest69.seq
 230687766     gbest7.seq
 209206884     gbest70.seq
 208734393     gbest71.seq
 210165169     gbest72.seq
 209623517     gbest73.seq
 205083589     gbest74.seq
 207926415     gbest75.seq
 207128990     gbest76.seq
 209612800     gbest77.seq
 221232014     gbest78.seq
 230691276     gbest79.seq
 230688389     gbest8.seq
 230689911     gbest80.seq
 224626925     gbest81.seq
 216601734     gbest82.seq
 213515846     gbest83.seq
 226815942     gbest84.seq
 230690541     gbest85.seq
 230688527     gbest86.seq
 230689239     gbest87.seq
 230688360     gbest88.seq
 230688152     gbest89.seq
 230689644     gbest9.seq
 230690412     gbest90.seq
 230689246     gbest91.seq
 230688649     gbest92.seq
 230687740     gbest93.seq
 230688915     gbest94.seq
 230687834     gbest95.seq
 230687526     gbest96.seq
 230690217     gbest97.seq
 230689297     gbest98.seq
 230689129     gbest99.seq
  44538633     gbgen.idx
 230687490     gbgss1.seq
 230690144     gbgss10.seq
 227097137     gbgss100.seq
 227934635     gbgss101.seq
 227691423     gbgss102.seq
 227666767     gbgss103.seq
 226914208     gbgss104.seq
 230689878     gbgss105.seq
 230689039     gbgss106.seq
 230688307     gbgss107.seq
 230688100     gbgss108.seq
 230688186     gbgss109.seq
 230690928     gbgss11.seq
 230690774     gbgss110.seq
 230688243     gbgss111.seq
 230689604     gbgss112.seq
 230687559     gbgss113.seq
  51015185     gbgss114.seq
 250000895     gbgss115.seq
 250002311     gbgss116.seq
 250001155     gbgss117.seq
 250002033     gbgss118.seq
 250000592     gbgss119.seq
 230689462     gbgss12.seq
 250002317     gbgss120.seq
 250001405     gbgss121.seq
 250000457     gbgss122.seq
 250003073     gbgss123.seq
 250002197     gbgss124.seq
 250000176     gbgss125.seq
 250002430     gbgss126.seq
 250001365     gbgss127.seq
 250001186     gbgss128.seq
 250001403     gbgss129.seq
 230689038     gbgss13.seq
 250000220     gbgss130.seq
 250003163     gbgss131.seq
 250001152     gbgss132.seq
 250001987     gbgss133.seq
 250000921     gbgss134.seq
 250000333     gbgss135.seq
 250001207     gbgss136.seq
 250001357     gbgss137.seq
 225087958     gbgss138.seq
 230688374     gbgss14.seq
 230688528     gbgss15.seq
 230689565     gbgss16.seq
 230691285     gbgss17.seq
 230690490     gbgss18.seq
 230688534     gbgss19.seq
 230688914     gbgss2.seq
 230688025     gbgss20.seq
 230687625     gbgss21.seq
 230690436     gbgss22.seq
 230688393     gbgss23.seq
 230689306     gbgss24.seq
 230687944     gbgss25.seq
 230689757     gbgss26.seq
 230689275     gbgss27.seq
 230688662     gbgss28.seq
 230687833     gbgss29.seq
 230688225     gbgss3.seq
 230690336     gbgss30.seq
 230689644     gbgss31.seq
 230688733     gbgss32.seq
 230689517     gbgss33.seq
 230687582     gbgss34.seq
 230688283     gbgss35.seq
 230689751     gbgss36.seq
 230687933     gbgss37.seq
 230689282     gbgss38.seq
 230689003     gbgss39.seq
 230689665     gbgss4.seq
 230689621     gbgss40.seq
 230688594     gbgss41.seq
 230688204     gbgss42.seq
 230689099     gbgss43.seq
 230689202     gbgss44.seq
 230688566     gbgss45.seq
 230689466     gbgss46.seq
 230688778     gbgss47.seq
 230688005     gbgss48.seq
 230687703     gbgss49.seq
 230689634     gbgss5.seq
 230688755     gbgss50.seq
 230687558     gbgss51.seq
 230688024     gbgss52.seq
 230690809     gbgss53.seq
 230687826     gbgss54.seq
 230689010     gbgss55.seq
 230689062     gbgss56.seq
 230688405     gbgss57.seq
 230687547     gbgss58.seq
 230688739     gbgss59.seq
 230689404     gbgss6.seq
 230689106     gbgss60.seq
 230340120     gbgss61.seq
 230689145     gbgss62.seq
 230689141     gbgss63.seq
 230688062     gbgss64.seq
 230687524     gbgss65.seq
 230689537     gbgss66.seq
 230689131     gbgss67.seq
 230688943     gbgss68.seq
 230688434     gbgss69.seq
 230691190     gbgss7.seq
 230688983     gbgss70.seq
 230689278     gbgss71.seq
 230688273     gbgss72.seq
 230688649     gbgss73.seq
 230687665     gbgss74.seq
 230689269     gbgss75.seq
 230688733     gbgss76.seq
 230688921     gbgss77.seq
 230688339     gbgss78.seq
 230688969     gbgss79.seq
 230690635     gbgss8.seq
 228352660     gbgss80.seq
 192843398     gbgss81.seq
 193330296     gbgss82.seq
 230690484     gbgss83.seq
 230689320     gbgss84.seq
 230688918     gbgss85.seq
 230688635     gbgss86.seq
 230689152     gbgss87.seq
 230687774     gbgss88.seq
 230687874     gbgss89.seq
 230688984     gbgss9.seq
 230689622     gbgss90.seq
 230688118     gbgss91.seq
 230690077     gbgss92.seq
 230689845     gbgss93.seq
 230689718     gbgss94.seq
 230690055     gbgss95.seq
 230688638     gbgss96.seq
 230688808     gbgss97.seq
 230689920     gbgss98.seq
 230688860     gbgss99.seq
 250004897     gbhtc1.seq
 250000518     gbhtc2.seq
 250008721     gbhtc3.seq
 250001836     gbhtc4.seq
 250001566     gbhtc5.seq
 206919251     gbhtc6.seq
 250036152     gbhtg1.seq
 250261643     gbhtg10.seq
 250243253     gbhtg11.seq
 250274859     gbhtg12.seq
 250243330     gbhtg13.seq
 250087319     gbhtg14.seq
 250059551     gbhtg15.seq
 250269106     gbhtg16.seq
 250254255     gbhtg17.seq
 250048664     gbhtg18.seq
 250204294     gbhtg19.seq
 250003505     gbhtg2.seq
 250410355     gbhtg20.seq
 250067903     gbhtg21.seq
 250040416     gbhtg22.seq
 250262730     gbhtg23.seq
 250021610     gbhtg24.seq
 250126492     gbhtg25.seq
 250214244     gbhtg26.seq
 250162714     gbhtg27.seq
 250190877     gbhtg28.seq
 250074388     gbhtg29.seq
 250129646     gbhtg3.seq
 250048465     gbhtg30.seq
 250024174     gbhtg31.seq
 250223604     gbhtg32.seq
 250065029     gbhtg33.seq
 250039053     gbhtg34.seq
 250103090     gbhtg35.seq
 250083026     gbhtg36.seq
 250237009     gbhtg37.seq
 250179828     gbhtg38.seq
 250036984     gbhtg39.seq
 250088734     gbhtg4.seq
 250010179     gbhtg40.seq
 250158878     gbhtg41.seq
 250199922     gbhtg42.seq
 250267172     gbhtg43.seq
 250008257     gbhtg44.seq
 250033195     gbhtg45.seq
 250155441     gbhtg46.seq
 250248085     gbhtg47.seq
 250122719     gbhtg48.seq
 250196127     gbhtg49.seq
 250187778     gbhtg5.seq
 250094505     gbhtg50.seq
 250008159     gbhtg51.seq
 250149127     gbhtg52.seq
 250062918     gbhtg53.seq
 250099379     gbhtg54.seq
 250132410     gbhtg55.seq
 250327532     gbhtg56.seq
 250088935     gbhtg57.seq
 250119054     gbhtg58.seq
 250123437     gbhtg59.seq
 250123837     gbhtg6.seq
 250001552     gbhtg60.seq
 250143277     gbhtg61.seq
 250179758     gbhtg62.seq
 151754363     gbhtg63.seq
 250148213     gbhtg7.seq
 250125454     gbhtg8.seq
 250142355     gbhtg9.seq
 250030769     gbinv1.seq
 250159377     gbinv2.seq
 250001088     gbinv3.seq
 250000987     gbinv4.seq
 250001129     gbinv5.seq
 250273096     gbinv6.seq
 122433495     gbinv7.seq
1091264978     gbjou.idx
 964750877     gbkey.idx
 250003192     gbmam1.seq
  37883197     gbmam2.seq
  33434231     gbnew.txt
 250000291     gbpat1.seq
 250001072     gbpat10.seq
 250001280     gbpat11.seq
 250000255     gbpat12.seq
 250001089     gbpat13.seq
 250001114     gbpat14.seq
 250001770     gbpat15.seq
 250000182     gbpat16.seq
  89261890     gbpat17.seq
 250003767     gbpat2.seq
 250001931     gbpat3.seq
 250000533     gbpat4.seq
 250023517     gbpat5.seq
 250000385     gbpat6.seq
 250000101     gbpat7.seq
 250000351     gbpat8.seq
 250000839     gbpat9.seq
  36124733     gbphg.seq
 250140740     gbpln1.seq
 250001562     gbpln10.seq
 250002584     gbpln11.seq
 250000176     gbpln12.seq
 251691579     gbpln13.seq
 250185366     gbpln14.seq
 246515806     gbpln15.seq
 252685989     gbpln2.seq
 250001583     gbpln3.seq
 250037816     gbpln4.seq
 250005947     gbpln5.seq
 250099048     gbpln6.seq
 250089750     gbpln7.seq
 281281150     gbpln8.seq
 252667749     gbpln9.seq
 250130247     gbpri1.seq
 250166016     gbpri10.seq
 250117139     gbpri11.seq
 250038148     gbpri12.seq
 250037337     gbpri13.seq
 250184466     gbpri14.seq
 250011711     gbpri15.seq
 250000973     gbpri16.seq
 250036298     gbpri17.seq
 250073599     gbpri18.seq
 250096721     gbpri19.seq
 250146611     gbpri2.seq
 250121924     gbpri20.seq
 250006124     gbpri21.seq
 250009547     gbpri22.seq
 250007185     gbpri23.seq
 250052636     gbpri24.seq
 250000041     gbpri25.seq
 250000048     gbpri26.seq
 250002833     gbpri27.seq
 152982766     gbpri28.seq
 250139228     gbpri3.seq
 250059043     gbpri4.seq
 250022923     gbpri5.seq
 250053549     gbpri6.seq
 250083679     gbpri7.seq
 250012382     gbpri8.seq
 250163200     gbpri9.seq
    181998     gbrel.txt
 250080058     gbrod1.seq
 250086126     gbrod10.seq
 250016237     gbrod11.seq
 250147489     gbrod12.seq
 250008565     gbrod13.seq
 250004377     gbrod14.seq
 250069540     gbrod15.seq
 249557051     gbrod16.seq
 250310472     gbrod2.seq
 250134008     gbrod3.seq
 250178032     gbrod4.seq
 250101701     gbrod5.seq
 250093845     gbrod6.seq
 250017370     gbrod7.seq
 250013248     gbrod8.seq
 250161979     gbrod9.seq
3418804341     gbsdr.txt
   1606934     gbsec.idx
 250000160     gbsts1.seq
 250000399     gbsts2.seq
 250003405     gbsts3.seq
 250004366     gbsts4.seq
 250002068     gbsts5.seq
 250000387     gbsts6.seq
 250002036     gbsts7.seq
 250002573     gbsts8.seq
 150592619     gbsts9.seq
  70839373     gbsyn.seq
   4067850     gbuna.seq
 250001235     gbvrl1.seq
 250001735     gbvrl2.seq
 250004095     gbvrl3.seq
 193506315     gbvrl4.seq
 250001013     gbvrt1.seq
 250020458     gbvrt2.seq
 250002846     gbvrt3.seq
 250123230     gbvrt4.seq
 250160424     gbvrt5.seq
 250126990     gbvrt6.seq
 250248880     gbvrt7.seq
  78475354     gbvrt8.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         32153      98157363
BCT10        25414      100985020
BCT11        33343      73018945
BCT2         7888       108449937
BCT3         990        113856007
BCT4         32144      101303692
BCT5         50203      91368732
BCT6         61995      87318712
BCT7         53040      94047104
BCT8         7383       107080695
BCT9         2584       102387340
EST1         68123      26288742
EST10        76553      29777665
EST100       72078      43239985
EST101       70620      43828456
EST102       74164      37978682
EST103       69806      30875272
EST104       66444      31607386
EST105       66011      38790383
EST106       70256      37298243
EST107       69840      45574803
EST108       76189      34931669
EST109       74518      27664639
EST11        74773      28650824
EST110       75677      25974370
EST111       73446      38994912
EST112       63705      31944600
EST113       79027      46724657
EST114       79221      44926572
EST115       72693      45372173
EST116       68449      43561775
EST117       73060      47025395
EST118       67800      44977078
EST119       73920      43903131
EST12        77405      30641423
EST120       74956      45260618
EST121       73419      47717026
EST122       75306      48636949
EST123       73085      46681352
EST124       78255      38301779
EST125       77921      26237727
EST126       80622      48426724
EST127       74940      43925426
EST128       67235      37752459
EST129       70447      34968804
EST13        76282      29157335
EST130       67288      37921204
EST131       66728      36302867
EST132       69464      42515156
EST133       73006      41597794
EST134       68847      43391415
EST135       69388      41741522
EST136       73616      42169484
EST137       68563      41805544
EST138       58474      33354799
EST139       96316      52300461
EST14        78003      31388159
EST140       89251      51279761
EST141       78654      40498300
EST142       107339     58004602
EST143       108370     57992635
EST144       98543      54355427
EST145       73555      45116641
EST146       95676      56257389
EST147       95266      57718161
EST148       69526      39830729
EST149       66280      31235837
EST15        74381      31427617
EST150       61895      28194844
EST151       56841      27288797
EST152       63105      31211788
EST153       54453      27394256
EST154       79661      52827398
EST155       68545      37866694
EST156       72322      52521584
EST157       72569      41337850
EST158       60843      30553406
EST159       64554      38516536
EST16        75753      33341311
EST160       66447      32723452
EST161       63434      45953248
EST162       64724      37239683
EST163       102560     45177735
EST164       88829      52815189
EST165       102225     59205633
EST166       105221     57466750
EST167       89497      47537726
EST168       90666      37505749
EST169       95199      50978379
EST17        81740      33471291
EST170       95139      41444056
EST171       73705      37810477
EST172       67956      44890657
EST173       65975      37835001
EST174       64722      42516493
EST175       68228      31193868
EST176       76248      31240011
EST177       70456      44530446
EST178       82875      41269349
EST179       61612      31995753
EST18        80648      32659387
EST180       68632      48341931
EST181       70483      46331409
EST182       67946      36851802
EST183       67524      44692734
EST184       70593      54586500
EST185       69213      33403086
EST186       72353      40857598
EST187       70023      59705417
EST188       66613      50124936
EST189       64624      47000254
EST19        78730      31476944
EST190       64125      47543943
EST191       66064      46135640
EST192       65778      47708895
EST193       64099      46932163
EST194       62234      37604471
EST195       64128      34256880
EST196       63685      37202143
EST197       84685      47822318
EST198       84067      54915949
EST199       73768      43364566
EST2         74815      28708018
EST20        74198      30848101
EST200       106355     66498978
EST201       108668     65370671
EST202       108910     64412074
EST203       103284     66922221
EST204       112747     60921114
EST205       87072      45149804
EST206       69995      41239320
EST207       68562      59142016
EST208       70752      56564970
EST209       79106      39857510
EST21        74558      34295870
EST210       80721      46689318
EST211       74556      52918494
EST212       72237      49049719
EST213       35381      15603152
EST214       27827      10625362
EST215       27519      10168309
EST216       26374      9675917
EST217       26667      8974599
EST218       27679      10065418
EST219       27236      9877640
EST22        73981      29634712
EST220       27224      9826886
EST221       27335      10480880
EST222       27148      12039274
EST223       27256      11172438
EST224       27379      10037625
EST225       27653      9265593
EST226       26908      9363281
EST227       27840      11327370
EST228       27743      10872318
EST229       27011      11337982
EST23        77309      32952497
EST230       26703      12017628
EST231       27109      11279662
EST232       27068      10905941
EST233       27061      11667221
EST234       27186      11561081
EST235       27299      10994352
EST236       27294      10858521
EST237       27195      10485078
EST238       27170      11581106
EST239       24425      17249044
EST24        74322      32254712
EST240       25839      17267691
EST241       50305      21017374
EST242       105385     41802420
EST243       72040      41940832
EST244       68679      44528685
EST245       69410      44521739
EST246       69423      44014943
EST247       68703      40232523
EST248       71698      41375986
EST249       65212      49394099
EST25        74596      32434312
EST250       63832      31878180
EST251       82985      40988723
EST252       100767     46403685
EST253       71525      41525206
EST254       65864      33152493
EST255       69091      33370699
EST256       70451      42764417
EST257       74600      34579404
EST258       71049      37001557
EST259       72248      46506099
EST26        74486      30496494
EST260       63277      35427451
EST261       68724      35033852
EST262       85347      45608494
EST263       78156      44460947
EST264       79200      55410982
EST265       88996      53023527
EST266       104479     46791481
EST267       80384      46771061
EST268       70880      42243520
EST269       74922      38745520
EST27        74732      32477701
EST270       69377      33561290
EST271       70412      29417012
EST272       69040      40570452
EST273       60011      35675620
EST274       67371      42214169
EST275       68894      40291562
EST276       62333      42820860
EST277       77492      39136461
EST278       81301      43231413
EST279       73852      42522824
EST28        107166     50741139
EST280       92024      54076694
EST281       116134     49932069
EST282       102671     45931849
EST283       68059      36406707
EST284       69514      40547351
EST285       76554      45178958
EST286       77056      38501760
EST287       71175      45445202
EST288       69091      37564153
EST289       59982      37065528
EST29        97893      45944661
EST290       52201      26761243
EST291       72143      51381244
EST292       68443      40701354
EST293       75508      45358277
EST294       65749      37851874
EST295       74801      40556318
EST296       74578      48257506
EST297       75921      38085439
EST298       68997      54398548
EST299       65626      50394874
EST3         73672      29896385
EST30        98393      51673884
EST300       57854      43325960
EST301       63804      34467096
EST302       72331      46956681
EST303       63264      39267499
EST304       56895      27951814
EST305       66800      36618204
EST306       64174      34322305
EST307       63629      31556977
EST308       63206      40533929
EST309       84500      43807621
EST31        69479      44015163
EST310       70792      41864495
EST311       68787      43787332
EST312       68690      38314846
EST313       63332      41639951
EST314       90733      52241306
EST315       84655      50514484
EST316       75644      41789384
EST317       61928      36522241
EST318       71261      38269502
EST319       65770      34551414
EST32        71744      57204754
EST320       47405      24325750
EST321       66398      36882929
EST322       85962      46808049
EST323       95525      48941689
EST324       64490      43855320
EST325       79806      54005250
EST326       68765      38482065
EST327       58682      33694938
EST328       93329      39029674
EST329       59499      38879501
EST33        85225      48665864
EST330       66361      38615562
EST331       68226      44428083
EST332       102182     56664511
EST333       71899      36733560
EST334       79457      43888761
EST335       61139      38980671
EST336       43220      22256328
EST337       57640      34367691
EST338       84954      46158979
EST339       78933      46595773
EST34        86445      43611874
EST340       74072      40287298
EST341       66464      39189273
EST342       61931      39975580
EST343       66686      38281222
EST344       63963      33943269
EST345       80095      25412153
EST346       71636      36074614
EST347       70256      39054133
EST348       69724      39716442
EST349       67996      38094847
EST35        91991      45373694
EST350       65971      46333767
EST351       73527      43380976
EST352       61755      34320194
EST353       71487      43083867
EST354       78134      49800874
EST355       81954      47759801
EST356       59513      41830587
EST357       57391      41704601
EST358       57663      41243778
EST359       62386      39385833
EST36        100482     47221294
EST360       78391      47951613
EST361       49384      31429689
EST362       59355      37703906
EST363       57951      40804513
EST364       61449      42438093
EST365       55536      41665083
EST366       46994      33567711
EST367       83326      39006711
EST368       52305      40653085
EST369       65283      46567712
EST37        98739      51247706
EST370       77384      26858823
EST371       71492      25414055
EST372       73307      27221025
EST373       72831      26363092
EST374       79528      26789404
EST375       72880      27419265
EST376       68059      28894962
EST377       24308      7558478
EST38        97456      39722394
EST39        68672      18446777
EST4         74041      28187828
EST40        68902      18416951
EST41        67261      20337557
EST42        43369      11822923
EST43        43167      12129700
EST44        42898      11425381
EST45        67626      25933033
EST46        97798      44198962
EST47        94554      45778690
EST48        90353      44738454
EST49        98887      49129158
EST5         48459      15406631
EST50        105211     54118998
EST51        75786      33346217
EST52        67359      28541255
EST53        72313      32685084
EST54        71894      30452437
EST55        78213      32081328
EST56        78223      30907530
EST57        70515      28064880
EST58        63966      29349960
EST59        73170      32480168
EST6         55075      17489987
EST60        79925      35972873
EST61        73702      29097679
EST62        74263      25641741
EST63        87367      42155645
EST64        44487      13152695
EST65        40093      11043199
EST66        40109      12168876
EST67        40428      12524046
EST68        40513      12076629
EST69        40420      13076747
EST7         74128      29185667
EST70        40466      12608864
EST71        40334      12301848
EST72        40031      12011183
EST73        40608      12707472
EST74        41416      11705060
EST75        41125      13136568
EST76        40997      12687219
EST77        41120      13360244
EST78        45696      11924842
EST79        39935      25487085
EST8         75478      30478367
EST80        42139      21728542
EST81        46231      18900831
EST82        49727      22824145
EST83        51608      21392053
EST84        57264      23509802
EST85        76211      31671527
EST86        74878      29010411
EST87        73070      34599265
EST88        77147      45503367
EST89        77089      42629477
EST9         77494      29869459
EST90        76751      37452711
EST91        75910      41759985
EST92        72783      39380075
EST93        73087      30282406
EST94        75082      45541228
EST95        70328      30966906
EST96        77289      49372772
EST97        64129      34980411
EST98        71776      36924983
EST99        74017      44221782
GSS1         90866      38853302
GSS10        75262      43850301
GSS100       74642      43218254
GSS101       73683      45640064
GSS102       73958      44948630
GSS103       73442      45786487
GSS104       73496      44973273
GSS105       76036      47197634
GSS106       85577      57658979
GSS107       84762      55800853
GSS108       82098      52329993
GSS109       86743      53213736
GSS11        70022      35807872
GSS110       79292      56143126
GSS111       86596      45875656
GSS112       96129      52412771
GSS113       77722      49027772
GSS114       16183      10634005
GSS115       87937      65332512
GSS116       84794      63625335
GSS117       101966     47336460
GSS118       69758      59668655
GSS119       69744      59657480
GSS12        73865      38761271
GSS120       70691      57799468
GSS121       70935      57336128
GSS122       73416      58490049
GSS123       85642      69687025
GSS124       83704      44345563
GSS125       74241      44610906
GSS126       110837     74274364
GSS127       85472      35409652
GSS128       87008      68191488
GSS129       70175      58704869
GSS13        76108      38160348
GSS130       69658      58570490
GSS131       64463      62366102
GSS132       82271      58602141
GSS133       123533     74895062
GSS134       120396     78003542
GSS135       104443     56960372
GSS136       85075      54966704
GSS137       102694     56119999
GSS138       90637      42272215
GSS14        71690      32209826
GSS15        71814      35869998
GSS16        76929      45309577
GSS17        71165      33395708
GSS18        57400      27928835
GSS19        57027      28891385
GSS2         89464      39573405
GSS20        58000      26274974
GSS21        62584      32552559
GSS22        64073      34908296
GSS23        57686      27112034
GSS24        68638      43546020
GSS25        65993      26951436
GSS26        58186      25787401
GSS27        69081      32213996
GSS28        61827      32970553
GSS29        82569      41229585
GSS3         87785      41976203
GSS30        80760      39721324
GSS31        74478      40462500
GSS32        70956      47964974
GSS33        80076      38500705
GSS34        76230      40278978
GSS35        76467      41432109
GSS36        94360      62681097
GSS37        93865      60181318
GSS38        90259      49377839
GSS39        87236      45731581
GSS4         79520      41321610
GSS40        86965      35321681
GSS41        82044      43482986
GSS42        81423      57056091
GSS43        76703      54283694
GSS44        72191      47720100
GSS45        72244      47604211
GSS46        79234      43052232
GSS47        80297      44112270
GSS48        90946      65216198
GSS49        85097      64189533
GSS5         79098      40780176
GSS50        89704      52567925
GSS51        89389      57338290
GSS52        83554      55544961
GSS53        72387      37606330
GSS54        84955      55602712
GSS55        84599      43502922
GSS56        84551      56280339
GSS57        73007      78374953
GSS58        76831      74950133
GSS59        92192      68252742
GSS6         78215      38872615
GSS60        74600      47164031
GSS61        64261      45401505
GSS62        80033      58185415
GSS63        89751      66798254
GSS64        84255      50341600
GSS65        88510      56533963
GSS66        91534      62289941
GSS67        101437     53482573
GSS68        100391     54809947
GSS69        100993     54045835
GSS7         77498      39463494
GSS70        102273     52422567
GSS71        101874     52929505
GSS72        102730     51842371
GSS73        102760     51804622
GSS74        100890     54175743
GSS75        93808      63791428
GSS76        89872      70730129
GSS77        89089      70227513
GSS78        87876      69612165
GSS79        88987      65617823
GSS8         76456      38112473
GSS80        89931      48388651
GSS81        78978      23012019
GSS82        78579      24003955
GSS83        86369      47446573
GSS84        77495      47405112
GSS85        91741      57716721
GSS86        84859      59031635
GSS87        76542      77433607
GSS88        79400      72447656
GSS89        86507      48126844
GSS9         72655      37341553
GSS90        85763      49179733
GSS91        76241      42198173
GSS92        80056      60282091
GSS93        80098      54999379
GSS94        81179      55414604
GSS95        87817      58955288
GSS96        84875      57793437
GSS97        88427      52563572
GSS98        82321      70726267
GSS99        80321      47881548
HTC1         32058      55427883
HTC2         31311      66327861
HTC3         71322      42308266
HTC4         86144      77056088
HTC5         97225      85566547
HTC6         49778      84857258
HTG1         1318       188913628
HTG10        1238       186866133
HTG11        1426       184277921
HTG12        906        192064850
HTG13        751        192431886
HTG14        744        192254744
HTG15        774        192209055
HTG16        802        192205752
HTG17        768        192379157
HTG18        1956       172868961
HTG19        997        189377812
HTG2         2426       186092649
HTG20        1190       186782551
HTG21        808        191552631
HTG22        886        190744541
HTG23        876        191284403
HTG24        891        190628102
HTG25        781        191939488
HTG26        824        191792268
HTG27        845        191711504
HTG28        914        190720208
HTG29        948        190385907
HTG3         2526       185355565
HTG30        921        190897622
HTG31        937        190489228
HTG32        886        191447211
HTG33        897        190926664
HTG34        927        190524711
HTG35        902        190989014
HTG36        826        191852112
HTG37        868        191371193
HTG38        920        190733158
HTG39        950        190842372
HTG4         2582       188604506
HTG40        948        190414656
HTG41        1045       189522709
HTG42        1210       187046676
HTG43        1216       188986234
HTG44        1184       188583875
HTG45        1161       187091122
HTG46        1097       191298835
HTG47        1220       191011631
HTG48        1234       191249359
HTG49        1173       191614445
HTG5         1288       185690221
HTG50        1220       191238863
HTG51        1129       190645705
HTG52        1077       188904189
HTG53        997        192013312
HTG54        1330       189069677
HTG55        1521       187353300
HTG56        1171       192588472
HTG57        1197       190910182
HTG58        1463       188808649
HTG59        976        194150926
HTG6         1275       185330254
HTG60        1100       193431569
HTG61        1043       193753226
HTG62        1062       193428386
HTG63        657        113750703
HTG7         1243       185695093
HTG8         1289       184983538
HTG9         1189       187146580
INV1         14688      166458291
INV2         1522       168012538
INV3         47218      102194192
INV4         72279      76120367
INV5         81060      73770453
INV6         31345      115998984
INV7         20805      51663451
MAM1         58740      106764584
MAM2         11446      11672356
PAT1         223049     70322900
PAT10        103344     62799635
PAT11        113959     51806385
PAT12        151071     55874938
PAT13        157696     78034667
PAT14        105100     119845276
PAT15        144558     91874183
PAT16        110540     99228423
PAT17        80264      22721927
PAT2         199596     89436008
PAT3         180802     98886429
PAT4         147774     100223840
PAT5         146085     88487184
PAT6         112956     115426145
PAT7         136389     97002657
PAT8         132252     95027292
PAT9         141054     56903730
PHG          2893       14104224
PLN1         31413      126266339
PLN10        28041      124739025
PLN11        65593      67643235
PLN12        75890      80594651
PLN13        50571      105878243
PLN14        35595      114012323
PLN15        38732      109641264
PLN2         1390       181644675
PLN3         23985      136748759
PLN4         78524      76072697
PLN5         56153      60948365
PLN6         23960      85174220
PLN7         1263       166020802
PLN8         794        208173385
PLN9         7          199428952
PRI1         18246      151079293
PRI10        1410       176531490
PRI11        1267       175606184
PRI12        1499       175135043
PRI13        1595       178584996
PRI14        1522       184318040
PRI15        22027      155280843
PRI16        42975      98352856
PRI17        15409      143604578
PRI18        1605       184258867
PRI19        1752       183474573
PRI2         1425       172809320
PRI20        2105       181959490
PRI21        1611       185770752
PRI22        33672      132480208
PRI23        43317      76739844
PRI24        12750      152317468
PRI25        18092      159476804
PRI26        49123      121788208
PRI27        32919      135545879
PRI28        37416      59839534
PRI3         1255       182763769
PRI4         1296       178043212
PRI5         1145       173874105
PRI6         1193       178691360
PRI7         1215       177223446
PRI8         1329       169495429
PRI9         1224       177401310
ROD1         8892       170680557
ROD10        1020       185293671
ROD11        26934      145713127
ROD12        1183       191754021
ROD13        1250       193464533
ROD14        22781      157341942
ROD15        26572      90256299
ROD16        46313      117648036
ROD2         919        174394094
ROD3         889        174201377
ROD4         921        175193162
ROD5         980        178616478
ROD6         955        179590481
ROD7         994        181585305
ROD8         1009       182562421
ROD9         991        182988423
STS1         89273      48299744
STS2         75702      31837237
STS3         85627      37158362
STS4         54998      32328154
STS5         55264      32081319
STS6         55030      32473038
STS7         54834      32737860
STS8         86643      33713021
STS9         58921      27093025
SYN          16275      24564891
UNA          1734       790144
VRL1         72663      65439642
VRL2         73160      65516848
VRL3         71460      70581252
VRL4         57062      52527159
VRT1         62187      98889396
VRT2         9633       176357458
VRT3         72780      69196447
VRT4         15743      133315728
VRT5         1248       193203874
VRT6         1307       192888533
VRT7         28337      152161552
VRT8         22992      24961972

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 146.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries       Bases   Species

8435475 11032844920   Homo sapiens
6203790  6959285980   Mus musculus
996433   5652351332   Rattus norvegicus
778953   2073169626   Danio rerio
2298240  1509886463   Zea mays
352657   1163611693   Oryza sativa (japonica cultivar-group)
994193    956137062   Bos taurus
1026679   825588168   Xenopus tropicalis
499736    770996863   Drosophila melanogaster
1230325   709950181   Canis familiaris
923884    621715458   Arabidopsis thaliana
716057    613208621   Gallus gallus
784398    462478825   Sorghum bicolor
194013    454788588   Pan troglodytes
693181    418408085   Ciona intestinalis
596153    404042658   Brassica oleracea
597184    379878761   Sus scrofa
56716     377364740   Macaca mulatta
377465    363622217   Medicago truncatula
596448    334178050   Triticum aestivum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 October 2005

                NCBI-GenBank Flat File Release 146.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 146.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
	Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
	Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
	Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
	Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Tony Stearman

User Support
	Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
	Renata Geer, Scott McGinnis, Donna Messersmith, Rana Morris, Vyvy Pham,
	Monica Romiti, Eric Sayers, Tao Tao, David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center