Release Notes For GenBank Release 147

GBREL.TXT          Genetic Sequence Data Bank
                         April 15 2005

               NCBI-GenBank Flat File Release 147.0

                    Distribution Release Notes

 44202133 loci, 48235738567 bases, from 44202133 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 147.0
1.2 Cutoff Date
1.3 Important Changes in Release 147.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 147.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 147.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.

1.2 Cutoff Date

  This full release, 147.0, incorporates data available to the collaborating
databases as of April 20, 2005 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 147.0

1.3.1 ENV Division introduced with April 2005 release

  A new division for sequences obtained via environmental sampling methods
has been introduced with GenBank Release 147.0 . This new division segregates
128,571 sequences for which the source organism is unknown, or can only be
inferred by sequence comparison. The new sequence files are:

	gbenv1.seq
	gbenv2.seq

Records in the ENV division have these characteristics:

  1. ENV division code on the LOCUS line
  2. /environmental_sample qualifier for the source feature

And, as of Release 148.0 in June, these records will also have an ENV keyword.

  Note that sequences from WGS projects that involve environmental sampling
will *not* be distributed via this new division. All WGS projects continue
to be distributed using project-specific data files at the NCBI FTP site:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	ftp://ftp.ncbi.nih.gov/genbank/wgs

1.3.2 Removal of MEDLINE linetype as of April 2005 release

The PUBMED linetype was introduced in December of 1997, as a means of
linking references in sequence records to the PubMed biomedical literature
database, based on a PubMed ID (PMID) .

Since then, we have been displaying both the PMID and its predecessor
(Medline Unique ID / MUID) for all references. For example :

LOCUS       ECOGUABA                3531 bp    DNA     linear   BCT
09-FEB-2005
DEFINITION  Escherichia coli guaBA operon operon, complete sequence.
ACCESSION   M10101 M10102
VERSION     M10101.1  GI:146274
....
REFERENCE   1  (bases 1768 to 3531)
  AUTHORS   Tiedeman,A.A., Smith,J.M. and Zalkin,H.
  TITLE     Nucleotide sequence of the guaA gene encoding GMP synthetase of
            Escherichia coli K12
  JOURNAL   J. Biol. Chem. 260 (15), 8676-8679 (1985)
  MEDLINE   85261223
   PUBMED   3894345

Subsequent to 1997, PMID article identifiers subsumed MUIDs. Some background
information about that evolution can be found at:

  http://www.nlm.nih.gov/pubs/techbull/mj01/mj01_medline_ui.html

Starting with GenBank Release 147.0, the older MEDLINE linetype is displayed
in GenBank sequence records only for very rare articles that lack a PMID
identifier.

For the vast majority of articles, this means that only the PUBMED identifier
is now presented.

1.3.3 Problems generating accession number and keyword indexes

  Software problems during Release 147.0 prevented the generation of
the gbacc.idx and gbkey.idx 'index' files which normally accompany
GenBank releases.

  A version of gbacc.idx was built manually. However, the first field
contains just an accession number rather than Accession.Version .

  The gbkey.idx index could not be created without substantial
additional delays in release processing, so it is completely absent
from 147.0 .

  Our apologies for any inconvenience that this may cause.

1.3.4 Organizational changes

  The total number of sequence data files increased by 25 with this release:

  - the ENV division is now comprised of   2 files (+2)
  - the EST division is now comprised of 388 files (+11)
  - the GSS division is now comprised of 142 files (+4)
  - the PLN division is now comprised of  16 files (+1)
  - the ROD division is now comprised of  18 files (+2)
  - the STS division is now comprised of  14 files (+5)

1.3.5 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
twenty-five GSS flatfiles in Release 147.0. Consider gbgss117.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                           April 15 2005

                NCBI-GenBank Flat File Release 147.0

                           GSS Sequences (Part 1)

   87197 loci,    64745577 bases, from    87197 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "117" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

  No substantive changes are anticipated for GenBank Release 148.0 .

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

  The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 769 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut28.idx - Index of the entries according to accession number, part 28.
23. gbaut29.idx - Index of the entries according to accession number, part 29.
24. gbaut3.idx - Index of the entries according to accession number, part 3.
25. gbaut4.idx - Index of the entries according to accession number, part 4.
26. gbaut5.idx - Index of the entries according to accession number, part 5.
27. gbaut6.idx - Index of the entries according to accession number, part 6.
28. gbaut7.idx - Index of the entries according to accession number, part 7.
29. gbaut8.idx - Index of the entries according to accession number, part 8.
30. gbaut9.idx - Index of the entries according to accession number, part 9.
31. gbbct1.seq - Bacterial sequence entries, part 1.
32. gbbct10.seq - Bacterial sequence entries, part 10.
33. gbbct11.seq - Bacterial sequence entries, part 11.
34. gbbct2.seq - Bacterial sequence entries, part 2.
35. gbbct3.seq - Bacterial sequence entries, part 3.
36. gbbct4.seq - Bacterial sequence entries, part 4.
37. gbbct5.seq - Bacterial sequence entries, part 5.
38. gbbct6.seq - Bacterial sequence entries, part 6.
39. gbbct7.seq - Bacterial sequence entries, part 7.
40. gbbct8.seq - Bacterial sequence entries, part 8.
41. gbbct9.seq - Bacterial sequence entries, part 9.
42. gbchg.txt - Accession numbers of entries updated since the previous release.
43. gbcon.seq - Constructed sequence entries.
44. gbdel.txt - Accession numbers of entries deleted since the previous release.
45. gbenv1.seq - Environmental sampling sequence entries, part 1.
46. gbenv2.seq - Environmental sampling sequence entries, part 2.
47. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
48. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
49. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
50. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
51. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
52. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
53. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
54. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
55. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
56. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
57. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
58. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
59. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
60. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
61. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
62. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
63. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
64. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
65. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
66. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
67. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
68. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
69. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
70. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
71. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
72. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
73. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
74. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
75. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
76. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
77. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
78. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
79. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
80. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
81. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
82. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
83. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
84. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
85. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
86. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
87. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
88. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
89. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
90. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
91. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
92. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
93. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
94. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
95. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
96. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
97. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
98. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
99. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
100. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
101. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
102. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
103. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
104. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
105. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
106. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
107. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
108. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
109. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
110. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
111. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
112. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
113. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
114. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
115. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
116. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
117. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
118. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
119. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
120. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
121. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
122. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
123. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
124. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
125. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
126. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
127. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
128. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
129. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
130. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
131. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
132. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
133. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
134. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
135. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
136. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
137. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
138. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
139. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
140. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
141. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
142. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
143. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
144. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
145. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
146. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
147. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
148. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
149. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
150. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
151. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
152. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
153. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
154. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
155. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
156. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
157. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
158. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
159. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
160. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
161. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
162. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
163. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
164. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
165. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
166. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
167. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
168. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
169. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
170. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
171. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
172. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
173. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
174. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
175. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
176. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
177. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
178. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
179. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
180. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
181. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
182. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
183. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
184. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
185. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
186. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
187. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
188. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
189. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
190. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
191. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
192. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
193. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
194. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
195. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
196. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
197. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
198. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
199. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
200. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
201. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
202. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
203. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
204. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
205. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
206. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
207. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
208. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
209. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
210. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
211. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
212. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
213. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
214. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
215. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
216. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
217. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
218. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
219. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
220. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
221. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
222. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
223. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
224. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
225. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
226. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
227. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
228. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
229. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
230. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
231. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
232. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
233. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
234. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
235. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
236. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
237. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
238. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
239. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
240. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
241. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
242. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
243. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
244. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
245. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
246. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
247. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
248. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
249. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
250. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
251. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
252. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
253. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
254. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
255. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
256. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
257. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
258. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
259. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
260. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
261. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
262. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
263. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
264. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
265. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
266. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
267. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
268. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
269. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
270. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
271. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
272. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
273. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
274. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
275. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
276. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
277. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
278. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
279. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
280. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
281. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
282. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
283. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
284. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
285. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
286. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
287. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
288. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
289. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
290. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
291. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
292. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
293. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
294. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
295. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
296. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
297. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
298. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
299. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
300. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
301. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
302. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
303. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
304. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
305. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
306. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
307. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
308. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
309. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
310. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
311. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
312. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
313. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
314. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
315. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
316. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
317. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
318. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
319. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
320. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
321. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
322. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
323. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
324. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
325. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
326. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
327. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
328. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
329. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
330. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
331. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
332. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
333. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
334. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
335. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
336. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
337. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
338. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
339. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
340. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
341. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
342. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
343. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
344. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
345. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
346. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
347. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
348. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
349. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
350. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
351. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
352. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
353. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
354. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
355. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
356. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
357. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
358. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
359. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
360. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
361. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
362. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
363. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
364. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
365. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
366. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
367. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
368. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
369. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
370. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
371. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
372. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
373. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
374. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
375. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
376. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
377. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
378. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
379. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
380. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
381. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
382. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
383. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
384. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
385. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
386. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
387. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
388. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
389. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
390. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
391. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
392. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
393. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
394. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
395. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
396. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
397. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
398. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
399. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
400. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
401. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
402. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
403. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
404. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
405. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
406. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
407. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
408. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
409. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
410. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
411. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
412. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
413. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
414. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
415. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
416. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
417. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
418. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
419. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
420. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
421. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
422. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
423. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
424. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
425. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
426. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
427. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
428. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
429. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
430. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
431. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
432. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
433. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
434. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
435. gbgen.idx - Index of the entries according to gene symbols.
436. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
437. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
438. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
439. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
440. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
441. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
442. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
443. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
444. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
445. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
446. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
447. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
448. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
449. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
450. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
451. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
452. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
453. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
454. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
455. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
456. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
457. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
458. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
459. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
460. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
461. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
462. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
463. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
464. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
465. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
466. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
467. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
468. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
469. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
470. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
471. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
472. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
473. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
474. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
475. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
476. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
477. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
478. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
479. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
480. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
481. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
482. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
483. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
484. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
485. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
486. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
487. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
488. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
489. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
490. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
491. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
492. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
493. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
494. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
495. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
496. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
497. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
498. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
499. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
500. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
501. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
502. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
503. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
504. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
505. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
506. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
507. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
508. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
509. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
510. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
511. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
512. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
513. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
514. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
515. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
516. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
517. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
518. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
519. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
520. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
521. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
522. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
523. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
524. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
525. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
526. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
527. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
528. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
529. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
530. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
531. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
532. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
533. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
534. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
535. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
536. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
537. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
538. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
539. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
540. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
541. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
542. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
543. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
544. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
545. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
546. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
547. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
548. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
549. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
550. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
551. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
552. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
553. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
554. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
555. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
556. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
557. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
558. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
559. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
560. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
561. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
562. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
563. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
564. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
565. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
566. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
567. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
568. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
569. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
570. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
571. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
572. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
573. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
574. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
575. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
576. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
577. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
578. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
579. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
580. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
581. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
582. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
583. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
584. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
585. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
586. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
587. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
588. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
589. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
590. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
591. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
592. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
593. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
594. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
595. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
596. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
597. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
598. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
599. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
600. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
601. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
602. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
603. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
604. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
605. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
606. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
607. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
608. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
609. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
610. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
611. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
612. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
613. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
614. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
615. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
616. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
617. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
618. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
619. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
620. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
621. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
622. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
623. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
624. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
625. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
626. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
627. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
628. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
629. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
630. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
631. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
632. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
633. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
634. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
635. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
636. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
637. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
638. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
639. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
640. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
641. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
642. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
643. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
644. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
645. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
646. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
647. gbinv1.seq - Invertebrate sequence entries, part 1.
648. gbinv2.seq - Invertebrate sequence entries, part 2.
649. gbinv3.seq - Invertebrate sequence entries, part 3.
650. gbinv4.seq - Invertebrate sequence entries, part 4.
651. gbinv5.seq - Invertebrate sequence entries, part 5.
652. gbinv6.seq - Invertebrate sequence entries, part 6.
653. gbinv7.seq - Invertebrate sequence entries, part 7.
654. gbjou.idx - Index of the entries according to journal citation.
655. gbkey.idx - Index of the entries according to keyword phrase.
656. gbmam1.seq - Other mammalian sequence entries, part 1.
657. gbmam2.seq - Other mammalian sequence entries, part 2.
658. gbnew.txt - Accession numbers of entries new since the previous release.
659. gbpat1.seq - Patent sequence entries, part 1.
660. gbpat10.seq - Patent sequence entries, part 10.
661. gbpat11.seq - Patent sequence entries, part 11.
662. gbpat12.seq - Patent sequence entries, part 12.
663. gbpat13.seq - Patent sequence entries, part 13.
664. gbpat14.seq - Patent sequence entries, part 14.
665. gbpat15.seq - Patent sequence entries, part 15.
666. gbpat16.seq - Patent sequence entries, part 16.
667. gbpat17.seq - Patent sequence entries, part 17.
668. gbpat2.seq - Patent sequence entries, part 2.
669. gbpat3.seq - Patent sequence entries, part 3.
670. gbpat4.seq - Patent sequence entries, part 4.
671. gbpat5.seq - Patent sequence entries, part 5.
672. gbpat6.seq - Patent sequence entries, part 6.
673. gbpat7.seq - Patent sequence entries, part 7.
674. gbpat8.seq - Patent sequence entries, part 8.
675. gbpat9.seq - Patent sequence entries, part 9.
676. gbphg.seq - Phage sequence entries.
677. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
678. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
679. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
680. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
681. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
682. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
683. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
684. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
685. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
686. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
687. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
688. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
689. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
690. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
691. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
692. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
693. gbpri1.seq - Primate sequence entries, part 1.
694. gbpri10.seq - Primate sequence entries, part 10.
695. gbpri11.seq - Primate sequence entries, part 11.
696. gbpri12.seq - Primate sequence entries, part 12.
697. gbpri13.seq - Primate sequence entries, part 13.
698. gbpri14.seq - Primate sequence entries, part 14.
699. gbpri15.seq - Primate sequence entries, part 15.
700. gbpri16.seq - Primate sequence entries, part 16.
701. gbpri17.seq - Primate sequence entries, part 17.
702. gbpri18.seq - Primate sequence entries, part 18.
703. gbpri19.seq - Primate sequence entries, part 19.
704. gbpri2.seq - Primate sequence entries, part 2.
705. gbpri20.seq - Primate sequence entries, part 20.
706. gbpri21.seq - Primate sequence entries, part 21.
707. gbpri22.seq - Primate sequence entries, part 22.
708. gbpri23.seq - Primate sequence entries, part 23.
709. gbpri24.seq - Primate sequence entries, part 24.
710. gbpri25.seq - Primate sequence entries, part 25.
711. gbpri26.seq - Primate sequence entries, part 26.
712. gbpri27.seq - Primate sequence entries, part 27.
713. gbpri28.seq - Primate sequence entries, part 28.
714. gbpri3.seq - Primate sequence entries, part 3.
715. gbpri4.seq - Primate sequence entries, part 4.
716. gbpri5.seq - Primate sequence entries, part 5.
717. gbpri6.seq - Primate sequence entries, part 6.
718. gbpri7.seq - Primate sequence entries, part 7.
719. gbpri8.seq - Primate sequence entries, part 8.
720. gbpri9.seq - Primate sequence entries, part 9.
721. gbrel.txt - Release notes (this document).
722. gbrod1.seq - Rodent sequence entries, part 1.
723. gbrod10.seq - Rodent sequence entries, part 10.
724. gbrod11.seq - Rodent sequence entries, part 11.
725. gbrod12.seq - Rodent sequence entries, part 12.
726. gbrod13.seq - Rodent sequence entries, part 13.
727. gbrod14.seq - Rodent sequence entries, part 14.
728. gbrod15.seq - Rodent sequence entries, part 15.
729. gbrod16.seq - Rodent sequence entries, part 16.
730. gbrod17.seq - Rodent sequence entries, part 17.
731. gbrod18.seq - Rodent sequence entries, part 18.
732. gbrod2.seq - Rodent sequence entries, part 2.
733. gbrod3.seq - Rodent sequence entries, part 3.
734. gbrod4.seq - Rodent sequence entries, part 4.
735. gbrod5.seq - Rodent sequence entries, part 5.
736. gbrod6.seq - Rodent sequence entries, part 6.
737. gbrod7.seq - Rodent sequence entries, part 7.
738. gbrod8.seq - Rodent sequence entries, part 8.
739. gbrod9.seq - Rodent sequence entries, part 9.
740. gbsdr.txt - Short directory of the data bank.
741. gbsec.idx - Index of the entries according to secondary accession number.
742. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
743. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
744. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
745. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
746. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
747. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
748. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
749. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
750. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
751. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
752. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
753. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
754. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
755. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
756. gbsyn.seq - Synthetic and chimeric sequence entries.
757. gbuna.seq - Unannotated sequence entries.
758. gbvrl1.seq - Viral sequence entries, part 1.
759. gbvrl2.seq - Viral sequence entries, part 2.
760. gbvrl3.seq - Viral sequence entries, part 3.
761. gbvrl4.seq - Viral sequence entries, part 4.
762. gbvrt1.seq - Other vertebrate sequence entries, part 1.
763. gbvrt2.seq - Other vertebrate sequence entries, part 2.
764. gbvrt3.seq - Other vertebrate sequence entries, part 3.
765. gbvrt4.seq - Other vertebrate sequence entries, part 4.
766. gbvrt5.seq - Other vertebrate sequence entries, part 5.
767. gbvrt6.seq - Other vertebrate sequence entries, part 6.
768. gbvrt7.seq - Other vertebrate sequence entries, part 7.
769. gbvrt8.seq - Other vertebrate sequence entries, part 8.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 147.0 flatfiles require roughly 168 GB (sequence
files only) or 185 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1362872885     gbacc.idx
 500044306     gbaut1.idx
 513151904     gbaut10.idx
 500322600     gbaut11.idx
 513852887     gbaut12.idx
 502192746     gbaut13.idx
 553555654     gbaut14.idx
 500023012     gbaut15.idx
 500712798     gbaut16.idx
 508035734     gbaut17.idx
 514639658     gbaut18.idx
 500013929     gbaut19.idx
 534374721     gbaut2.idx
 516192826     gbaut20.idx
 509958965     gbaut21.idx
 500007767     gbaut22.idx
 509145333     gbaut23.idx
 502211769     gbaut24.idx
 507543431     gbaut25.idx
 515458640     gbaut26.idx
 503178597     gbaut27.idx
 527807875     gbaut28.idx
 123865396     gbaut29.idx
 518070976     gbaut3.idx
 500204324     gbaut4.idx
 504306810     gbaut5.idx
 517577836     gbaut6.idx
 500185182     gbaut7.idx
 542178019     gbaut8.idx
 500103716     gbaut9.idx
 250026957     gbbct1.seq
 250008592     gbbct10.seq
  31449371     gbbct11.seq
 250016610     gbbct2.seq
 250564828     gbbct3.seq
 250063358     gbbct4.seq
 250002482     gbbct5.seq
 253394169     gbbct6.seq
 250511671     gbbct7.seq
 250403005     gbbct8.seq
 250001885     gbbct9.seq
   5040894     gbchg.txt
1145341037     gbcon.seq
    458429     gbdel.txt
 250000178     gbenv1.seq
  77385237     gbenv2.seq
 230690163     gbest1.seq
 230687592     gbest10.seq
 230687971     gbest100.seq
 230690080     gbest101.seq
 230690419     gbest102.seq
 230688096     gbest103.seq
 230689730     gbest104.seq
 230690163     gbest105.seq
 230689201     gbest106.seq
 230688835     gbest107.seq
 230688702     gbest108.seq
 230688703     gbest109.seq
 230689908     gbest11.seq
 230027643     gbest110.seq
 230688195     gbest111.seq
 230689669     gbest112.seq
 230688768     gbest113.seq
 230689995     gbest114.seq
 230689983     gbest115.seq
 230690210     gbest116.seq
 230688896     gbest117.seq
 230688759     gbest118.seq
 230689437     gbest119.seq
 230689779     gbest12.seq
 230688370     gbest120.seq
 230689725     gbest121.seq
 230687813     gbest122.seq
 230689851     gbest123.seq
 230688586     gbest124.seq
 227219750     gbest125.seq
 230687891     gbest126.seq
 230688689     gbest127.seq
 230688641     gbest128.seq
 230689583     gbest129.seq
 230688912     gbest13.seq
 230689716     gbest130.seq
 230691514     gbest131.seq
 230687613     gbest132.seq
 230689807     gbest133.seq
 230690477     gbest134.seq
 230688554     gbest135.seq
 230688440     gbest136.seq
 230687905     gbest137.seq
 230689653     gbest138.seq
 230687893     gbest139.seq
 230688707     gbest14.seq
 230691411     gbest140.seq
 230688150     gbest141.seq
 230688875     gbest142.seq
 230689007     gbest143.seq
 230688214     gbest144.seq
 230688604     gbest145.seq
 230689573     gbest146.seq
 230690980     gbest147.seq
 230688979     gbest148.seq
 230688500     gbest149.seq
 230689239     gbest15.seq
 230689854     gbest150.seq
 230689784     gbest151.seq
 230691183     gbest152.seq
 230695843     gbest153.seq
 230688461     gbest154.seq
 230691432     gbest155.seq
 230689320     gbest156.seq
 230690750     gbest157.seq
 230688412     gbest158.seq
 230689529     gbest159.seq
 230688783     gbest16.seq
 230688126     gbest160.seq
 230687455     gbest161.seq
 230688163     gbest162.seq
 230689685     gbest163.seq
 230687943     gbest164.seq
 230688618     gbest165.seq
 230687969     gbest166.seq
 230687866     gbest167.seq
 221926185     gbest168.seq
 230688430     gbest169.seq
 230688955     gbest17.seq
 230689381     gbest170.seq
 230687984     gbest171.seq
 230689358     gbest172.seq
 230690498     gbest173.seq
 230690441     gbest174.seq
 230689441     gbest175.seq
 230690422     gbest176.seq
 230689238     gbest177.seq
 230688539     gbest178.seq
 230687711     gbest179.seq
 230689897     gbest18.seq
 230689657     gbest180.seq
 230688320     gbest181.seq
 230689103     gbest182.seq
 230690958     gbest183.seq
 230689053     gbest184.seq
 230689431     gbest185.seq
 230691274     gbest186.seq
 230689614     gbest187.seq
 230688589     gbest188.seq
 230689300     gbest189.seq
 230688246     gbest19.seq
 230688915     gbest190.seq
 230689220     gbest191.seq
 230688622     gbest192.seq
 230688946     gbest193.seq
 230691231     gbest194.seq
 230688703     gbest195.seq
 230690231     gbest196.seq
 230689846     gbest197.seq
 230688285     gbest198.seq
 230689831     gbest199.seq
 230689286     gbest2.seq
 230689324     gbest20.seq
 230689636     gbest200.seq
 230687804     gbest201.seq
 230688736     gbest202.seq
 230688013     gbest203.seq
 230687727     gbest204.seq
 230688397     gbest205.seq
 230688250     gbest206.seq
 230690336     gbest207.seq
 230689210     gbest208.seq
 230688184     gbest209.seq
 230689766     gbest21.seq
 230688533     gbest210.seq
 230689698     gbest211.seq
 230691065     gbest212.seq
 230688458     gbest213.seq
 175456413     gbest214.seq
 162537606     gbest215.seq
 164571082     gbest216.seq
 171041292     gbest217.seq
 169647373     gbest218.seq
 163464979     gbest219.seq
 230689982     gbest22.seq
 165054110     gbest220.seq
 164614711     gbest221.seq
 164085117     gbest222.seq
 164559459     gbest223.seq
 164075358     gbest224.seq
 164136304     gbest225.seq
 162914144     gbest226.seq
 168237046     gbest227.seq
 162311408     gbest228.seq
 163243874     gbest229.seq
 230688539     gbest23.seq
 167508714     gbest230.seq
 167534411     gbest231.seq
 165828352     gbest232.seq
 165684028     gbest233.seq
 165324256     gbest234.seq
 165136373     gbest235.seq
 164238411     gbest236.seq
 164197212     gbest237.seq
 165145130     gbest238.seq
 165401007     gbest239.seq
 230689923     gbest24.seq
 180728509     gbest240.seq
 171884761     gbest241.seq
 190084819     gbest242.seq
 230690272     gbest243.seq
 230690295     gbest244.seq
 230689673     gbest245.seq
 230689943     gbest246.seq
 230688791     gbest247.seq
 230689893     gbest248.seq
 230688151     gbest249.seq
 230690161     gbest25.seq
 230687952     gbest250.seq
 230688395     gbest251.seq
 230689511     gbest252.seq
 230690052     gbest253.seq
 230690210     gbest254.seq
 230689628     gbest255.seq
 230689095     gbest256.seq
 230689028     gbest257.seq
 230687480     gbest258.seq
 230689552     gbest259.seq
 230689887     gbest26.seq
 230690801     gbest260.seq
 230688503     gbest261.seq
 230687726     gbest262.seq
 230689931     gbest263.seq
 230688615     gbest264.seq
 230688689     gbest265.seq
 230688604     gbest266.seq
 230689129     gbest267.seq
 230687580     gbest268.seq
 230689104     gbest269.seq
 230690603     gbest27.seq
 230689535     gbest270.seq
 215745897     gbest271.seq
 208541692     gbest272.seq
 230689996     gbest273.seq
 230689397     gbest274.seq
 230688036     gbest275.seq
 230689077     gbest276.seq
 230690674     gbest277.seq
 230688401     gbest278.seq
 230688128     gbest279.seq
 230687535     gbest28.seq
 230690022     gbest280.seq
 230688961     gbest281.seq
 230687811     gbest282.seq
 230689461     gbest283.seq
 230691498     gbest284.seq
 230687601     gbest285.seq
 230687672     gbest286.seq
 230690208     gbest287.seq
 230687593     gbest288.seq
 230690463     gbest289.seq
 230688274     gbest29.seq
 230688684     gbest290.seq
 230689156     gbest291.seq
 230689175     gbest292.seq
 230688664     gbest293.seq
 230689660     gbest294.seq
 230688647     gbest295.seq
 228674381     gbest296.seq
 230689670     gbest297.seq
 193989631     gbest298.seq
 230688086     gbest299.seq
 230689139     gbest3.seq
 230689598     gbest30.seq
 230687788     gbest300.seq
 230689350     gbest301.seq
 230690960     gbest302.seq
 230690797     gbest303.seq
 209756930     gbest304.seq
 142757801     gbest305.seq
 229390461     gbest306.seq
 230688830     gbest307.seq
 230687452     gbest308.seq
 230688890     gbest309.seq
 230688320     gbest31.seq
 230689753     gbest310.seq
 230688898     gbest311.seq
 230687673     gbest312.seq
 230690194     gbest313.seq
 230689232     gbest314.seq
 230688652     gbest315.seq
 230689353     gbest316.seq
 230687690     gbest317.seq
 230687506     gbest318.seq
 230687702     gbest319.seq
 230689032     gbest32.seq
 230694528     gbest320.seq
 230687676     gbest321.seq
 230688302     gbest322.seq
 230689581     gbest323.seq
 230687931     gbest324.seq
 230688157     gbest325.seq
 230688629     gbest326.seq
 230688180     gbest327.seq
 230687618     gbest328.seq
 230689491     gbest329.seq
 230689944     gbest33.seq
 230691153     gbest330.seq
 230688995     gbest331.seq
 230690908     gbest332.seq
 230687918     gbest333.seq
 230688503     gbest334.seq
 230688674     gbest335.seq
 230688673     gbest336.seq
 230690275     gbest337.seq
 230687636     gbest338.seq
 230689472     gbest339.seq
 230688298     gbest34.seq
 230688537     gbest340.seq
 230689087     gbest341.seq
 230690847     gbest342.seq
 230688751     gbest343.seq
 230690666     gbest344.seq
 230689337     gbest345.seq
 230687780     gbest346.seq
 230690817     gbest347.seq
 230688236     gbest348.seq
 230692937     gbest349.seq
 230688951     gbest35.seq
 230689739     gbest350.seq
 230690220     gbest351.seq
 230687790     gbest352.seq
 216856515     gbest353.seq
 230689976     gbest354.seq
 230687527     gbest355.seq
 230690385     gbest356.seq
 230687979     gbest357.seq
 230688759     gbest358.seq
 230689566     gbest359.seq
 230688585     gbest36.seq
 230688130     gbest360.seq
 230688967     gbest361.seq
 230693762     gbest362.seq
 230689679     gbest363.seq
 230688799     gbest364.seq
 230688673     gbest365.seq
 230691052     gbest366.seq
 230690272     gbest367.seq
 230689180     gbest368.seq
 230688018     gbest369.seq
 230687996     gbest37.seq
 230691827     gbest370.seq
 230688970     gbest371.seq
 230688854     gbest372.seq
 230688505     gbest373.seq
 230688348     gbest374.seq
 230689898     gbest375.seq
 230689048     gbest376.seq
 230696607     gbest377.seq
 230688408     gbest378.seq
 230690283     gbest379.seq
 230687806     gbest38.seq
 230688840     gbest380.seq
 230688121     gbest381.seq
 230688489     gbest382.seq
 230689057     gbest383.seq
 230687860     gbest384.seq
 230688626     gbest385.seq
 216010821     gbest386.seq
 230688415     gbest387.seq
 156438857     gbest388.seq
 192409693     gbest39.seq
 230689160     gbest4.seq
 191419751     gbest40.seq
 209950313     gbest41.seq
 216311216     gbest42.seq
 215999021     gbest43.seq
 216805005     gbest44.seq
 230687723     gbest45.seq
 230688470     gbest46.seq
 230690021     gbest47.seq
 226847066     gbest48.seq
 230687774     gbest49.seq
 164511675     gbest5.seq
 230687513     gbest50.seq
 230688291     gbest51.seq
 230688338     gbest52.seq
 230690176     gbest53.seq
 230689217     gbest54.seq
 230687991     gbest55.seq
 230688348     gbest56.seq
 230689962     gbest57.seq
 230689857     gbest58.seq
 230688048     gbest59.seq
 177384218     gbest6.seq
 230688913     gbest60.seq
 230690522     gbest61.seq
 230687756     gbest62.seq
 230688379     gbest63.seq
 215828463     gbest64.seq
 209384182     gbest65.seq
 209003614     gbest66.seq
 209026803     gbest67.seq
 209374876     gbest68.seq
 210774505     gbest69.seq
 230690394     gbest7.seq
 209185827     gbest70.seq
 208802124     gbest71.seq
 210082180     gbest72.seq
 209886356     gbest73.seq
 205203129     gbest74.seq
 207661509     gbest75.seq
 207102910     gbest76.seq
 209468078     gbest77.seq
 220705645     gbest78.seq
 230689281     gbest79.seq
 230688585     gbest8.seq
 230692317     gbest80.seq
 225613357     gbest81.seq
 216508064     gbest82.seq
 213726819     gbest83.seq
 224497404     gbest84.seq
 230689317     gbest85.seq
 230688900     gbest86.seq
 230687895     gbest87.seq
 230690858     gbest88.seq
 230688547     gbest89.seq
 230688014     gbest9.seq
 230690490     gbest90.seq
 230689568     gbest91.seq
 230690081     gbest92.seq
 230688253     gbest93.seq
 230687512     gbest94.seq
 230690421     gbest95.seq
 230688675     gbest96.seq
 230690266     gbest97.seq
 230690008     gbest98.seq
 230688511     gbest99.seq
  45499850     gbgen.idx
 230689728     gbgss1.seq
 230687880     gbgss10.seq
 226503119     gbgss100.seq
 227941089     gbgss101.seq
 227870908     gbgss102.seq
 227819020     gbgss103.seq
 226941648     gbgss104.seq
 226665562     gbgss105.seq
 230689051     gbgss106.seq
 230688978     gbgss107.seq
 230689110     gbgss108.seq
 230688688     gbgss109.seq
 230691125     gbgss11.seq
 230689148     gbgss110.seq
 230689035     gbgss111.seq
 230687932     gbgss112.seq
 230687800     gbgss113.seq
 230688811     gbgss114.seq
 230688098     gbgss115.seq
 195934043     gbgss116.seq
 250001387     gbgss117.seq
 250001740     gbgss118.seq
 250002164     gbgss119.seq
 230687833     gbgss12.seq
 250002893     gbgss120.seq
 250000204     gbgss121.seq
 250000361     gbgss122.seq
 250000134     gbgss123.seq
 250000074     gbgss124.seq
 250002748     gbgss125.seq
 250001147     gbgss126.seq
 250002167     gbgss127.seq
 250000795     gbgss128.seq
 250001109     gbgss129.seq
 230689555     gbgss13.seq
 250002652     gbgss130.seq
 250003644     gbgss131.seq
 250002666     gbgss132.seq
 250000558     gbgss133.seq
 250000989     gbgss134.seq
 250001188     gbgss135.seq
 250000344     gbgss136.seq
 250000301     gbgss137.seq
 250000175     gbgss138.seq
 250000713     gbgss139.seq
 230689439     gbgss14.seq
 250001215     gbgss140.seq
 243287235     gbgss141.seq
    339891     gbgss142.seq
 230688179     gbgss15.seq
 230688209     gbgss16.seq
 230690591     gbgss17.seq
 230689322     gbgss18.seq
 230690372     gbgss19.seq
 230688297     gbgss2.seq
 230691457     gbgss20.seq
 230689146     gbgss21.seq
 230688504     gbgss22.seq
 230688493     gbgss23.seq
 230688260     gbgss24.seq
 230688273     gbgss25.seq
 230688031     gbgss26.seq
 230689830     gbgss27.seq
 230689546     gbgss28.seq
 230689684     gbgss29.seq
 230689252     gbgss3.seq
 230690900     gbgss30.seq
 230688530     gbgss31.seq
 230688558     gbgss32.seq
 230690139     gbgss33.seq
 230688465     gbgss34.seq
 230689384     gbgss35.seq
 230687650     gbgss36.seq
 230689567     gbgss37.seq
 230688351     gbgss38.seq
 230688204     gbgss39.seq
 230689122     gbgss4.seq
 230689054     gbgss40.seq
 230689985     gbgss41.seq
 230688842     gbgss42.seq
 230690571     gbgss43.seq
 230687483     gbgss44.seq
 230689765     gbgss45.seq
 230687558     gbgss46.seq
 230687859     gbgss47.seq
 230690084     gbgss48.seq
 230688063     gbgss49.seq
 230688899     gbgss5.seq
 230689023     gbgss50.seq
 230688788     gbgss51.seq
 230690064     gbgss52.seq
 230690123     gbgss53.seq
 230688547     gbgss54.seq
 230689015     gbgss55.seq
 230688317     gbgss56.seq
 230689474     gbgss57.seq
 230688004     gbgss58.seq
 230690160     gbgss59.seq
 230687669     gbgss6.seq
 230690696     gbgss60.seq
 229603545     gbgss61.seq
 230688449     gbgss62.seq
 230688944     gbgss63.seq
 230687741     gbgss64.seq
 230688295     gbgss65.seq
 230687634     gbgss66.seq
 230689678     gbgss67.seq
 230688130     gbgss68.seq
 230687607     gbgss69.seq
 230688480     gbgss7.seq
 230688326     gbgss70.seq
 230689419     gbgss71.seq
 230689222     gbgss72.seq
 230689072     gbgss73.seq
 230687838     gbgss74.seq
 230687460     gbgss75.seq
 230688542     gbgss76.seq
 230687933     gbgss77.seq
 230688403     gbgss78.seq
 230688339     gbgss79.seq
 230687496     gbgss8.seq
 230688965     gbgss80.seq
 191963727     gbgss81.seq
 193709429     gbgss82.seq
 230043712     gbgss83.seq
 230689279     gbgss84.seq
 230687802     gbgss85.seq
 230689788     gbgss86.seq
 230687717     gbgss87.seq
 230689196     gbgss88.seq
 230687737     gbgss89.seq
 230687997     gbgss9.seq
 230690130     gbgss90.seq
 230689549     gbgss91.seq
 230690184     gbgss92.seq
 230687930     gbgss93.seq
 230687676     gbgss94.seq
 230689763     gbgss95.seq
 230688664     gbgss96.seq
 230689217     gbgss97.seq
 230688221     gbgss98.seq
 230689668     gbgss99.seq
 250000406     gbhtc1.seq
 250002703     gbhtc2.seq
 250000822     gbhtc3.seq
 250003189     gbhtc4.seq
 250000997     gbhtc5.seq
 245923765     gbhtc6.seq
 250109543     gbhtg1.seq
 250193136     gbhtg10.seq
 250014188     gbhtg11.seq
 250123369     gbhtg12.seq
 250220884     gbhtg13.seq
 250299169     gbhtg14.seq
 250198982     gbhtg15.seq
 250008215     gbhtg16.seq
 250249893     gbhtg17.seq
 250180580     gbhtg18.seq
 250276531     gbhtg19.seq
 250059233     gbhtg2.seq
 250049009     gbhtg20.seq
 250044682     gbhtg21.seq
 250087479     gbhtg22.seq
 250075064     gbhtg23.seq
 250127499     gbhtg24.seq
 250096281     gbhtg25.seq
 250105369     gbhtg26.seq
 250228726     gbhtg27.seq
 250012735     gbhtg28.seq
 250007509     gbhtg29.seq
 250022413     gbhtg3.seq
 250147758     gbhtg30.seq
 250253008     gbhtg31.seq
 250099589     gbhtg32.seq
 250038191     gbhtg33.seq
 250200656     gbhtg34.seq
 250236019     gbhtg35.seq
 250167227     gbhtg36.seq
 250006814     gbhtg37.seq
 250070829     gbhtg38.seq
 250284353     gbhtg39.seq
 250167821     gbhtg4.seq
 250096765     gbhtg40.seq
 250026994     gbhtg41.seq
 250006065     gbhtg42.seq
 250220374     gbhtg43.seq
 250021617     gbhtg44.seq
 250151600     gbhtg45.seq
 250189774     gbhtg46.seq
 250110841     gbhtg47.seq
 250258270     gbhtg48.seq
 250167064     gbhtg49.seq
 250083826     gbhtg5.seq
 250166121     gbhtg50.seq
 250086455     gbhtg51.seq
 250018551     gbhtg52.seq
 250064622     gbhtg53.seq
 250214084     gbhtg54.seq
 250099929     gbhtg55.seq
 250121359     gbhtg56.seq
 250113233     gbhtg57.seq
 250040532     gbhtg58.seq
 250100504     gbhtg59.seq
 250210488     gbhtg6.seq
 250278731     gbhtg60.seq
 250121981     gbhtg61.seq
 250004454     gbhtg62.seq
 195071375     gbhtg63.seq
 250139724     gbhtg7.seq
 250223803     gbhtg8.seq
 250036109     gbhtg9.seq
 250179134     gbinv1.seq
 250112803     gbinv2.seq
 250002599     gbinv3.seq
 250001058     gbinv4.seq
 250002221     gbinv5.seq
 250000091     gbinv6.seq
 180683601     gbinv7.seq
1137225281     gbjou.idx
 250001922     gbmam1.seq
  59713783     gbmam2.seq
  23319553     gbnew.txt
 250001085     gbpat1.seq
 250000759     gbpat10.seq
 250000604     gbpat11.seq
 250000028     gbpat12.seq
 250001082     gbpat13.seq
 250000737     gbpat14.seq
 250001548     gbpat15.seq
 250000001     gbpat16.seq
 231762097     gbpat17.seq
 250002153     gbpat2.seq
 250001511     gbpat3.seq
 250004561     gbpat4.seq
 250000798     gbpat5.seq
 250000524     gbpat6.seq
 250005228     gbpat7.seq
 250001968     gbpat8.seq
 250000416     gbpat9.seq
  40186746     gbphg.seq
 250185858     gbpln1.seq
 250145052     gbpln10.seq
 250001598     gbpln11.seq
 250002329     gbpln12.seq
 250073125     gbpln13.seq
 250353084     gbpln14.seq
 250002916     gbpln15.seq
  63209364     gbpln16.seq
 250106731     gbpln2.seq
 250000113     gbpln3.seq
 250001765     gbpln4.seq
 250002444     gbpln5.seq
 250200668     gbpln6.seq
 250125988     gbpln7.seq
 266300621     gbpln8.seq
 269778888     gbpln9.seq
 250016439     gbpri1.seq
 250032161     gbpri10.seq
 250032279     gbpri11.seq
 250006374     gbpri12.seq
 250128590     gbpri13.seq
 250075089     gbpri14.seq
 250017409     gbpri15.seq
 250001290     gbpri16.seq
 250015934     gbpri17.seq
 250061470     gbpri18.seq
 250021379     gbpri19.seq
 250119317     gbpri2.seq
 250080435     gbpri20.seq
 250360932     gbpri21.seq
 250000738     gbpri22.seq
 250002592     gbpri23.seq
 250113195     gbpri24.seq
 250063547     gbpri25.seq
 250000781     gbpri26.seq
 250000473     gbpri27.seq
 206590654     gbpri28.seq
 250016211     gbpri3.seq
 250005525     gbpri4.seq
 250102194     gbpri5.seq
 250043431     gbpri6.seq
 250241312     gbpri7.seq
 250050508     gbpri8.seq
 250014879     gbpri9.seq
    185492     gbrel.txt
 250092007     gbrod1.seq
 250223937     gbrod10.seq
 250003246     gbrod11.seq
 250118147     gbrod12.seq
 250149284     gbrod13.seq
 250253334     gbrod14.seq
 250003516     gbrod15.seq
 250004450     gbrod16.seq
 250000317     gbrod17.seq
   3990399     gbrod18.seq
 250132263     gbrod2.seq
 250149685     gbrod3.seq
 250049419     gbrod4.seq
 250026940     gbrod5.seq
 250121171     gbrod6.seq
 250208297     gbrod7.seq
 250182946     gbrod8.seq
 250143576     gbrod9.seq
3536218301     gbsdr.txt
   1548959     gbsec.idx
 250000925     gbsts1.seq
 250001992     gbsts10.seq
 250002781     gbsts11.seq
 250001200     gbsts12.seq
 250000787     gbsts13.seq
   4159524     gbsts14.seq
 250001788     gbsts2.seq
 250001417     gbsts3.seq
 250002402     gbsts4.seq
 250002499     gbsts5.seq
 250002209     gbsts6.seq
 250001258     gbsts7.seq
 250000160     gbsts8.seq
 250000113     gbsts9.seq
 100029396     gbsyn.seq
    507187     gbuna.seq
 250002718     gbvrl1.seq
 250002970     gbvrl2.seq
 250013898     gbvrl3.seq
 221043189     gbvrl4.seq
 250002129     gbvrt1.seq
 250133371     gbvrt2.seq
 250006672     gbvrt3.seq
 250120709     gbvrt4.seq
 250105497     gbvrt5.seq
 250140225     gbvrt6.seq
 250001753     gbvrt7.seq
 216492863     gbvrt8.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         26586      100958657
BCT10        35264      91579583
BCT11        8838       10463929
BCT2         7778       106921993
BCT3         428        114741631
BCT4         27961      103371455
BCT5         29858      96932966
BCT6         59058      88886833
BCT7         7049       111569550
BCT8         2230       94981242
BCT9         8338       106095793
ENV1         97804      71419088
ENV2         30767      21207544
EST1         68123      26288742
EST10        76553      29777600
EST100       72337      43069156
EST101       70577      42096846
EST102       74118      40287178
EST103       69471      30344703
EST104       68482      32397546
EST105       64501      36249872
EST106       69697      39023388
EST107       70491      45437999
EST108       75895      35660044
EST109       74537      27616457
EST11        74773      28650551
EST110       75696      25952699
EST111       73515      36633820
EST112       63260      33757047
EST113       79410      44848114
EST114       79242      44915550
EST115       72837      45851293
EST116       68463      43315059
EST117       73005      47821459
EST118       67975      44723489
EST119       73478      44348505
EST12        77403      30640591
EST120       75263      44778617
EST121       73553      47495661
EST122       74550      49284048
EST123       73363      45888367
EST124       78259      40344378
EST125       74724      24175002
EST126       83008      47914589
EST127       75102      44220459
EST128       69444      40203721
EST129       68298      33496236
EST13        76282      29157878
EST130       67497      38327458
EST131       67521      36817690
EST132       68569      41552215
EST133       72306      41145697
EST134       70272      44498475
EST135       69266      41993250
EST136       72785      40007248
EST137       68383      42565248
EST138       59147      34154861
EST139       93904      50851709
EST14        78045      31441135
EST140       92354      52748181
EST141       74965      38836669
EST142       107464     57341202
EST143       108830     59030045
EST144       98233      54312815
EST145       73982      44923743
EST146       94701      54817499
EST147       97235      58800302
EST148       70814      41555222
EST149       65929      31557411
EST15        74367      31408613
EST150       62658      28464186
EST151       55591      26391305
EST152       64970      32019382
EST153       55647      28134204
EST154       76389      47789756
EST155       68270      41455450
EST156       71452      51075107
EST157       75013      42966508
EST158       59937      30400124
EST159       64527      35150201
EST16        75774      33353552
EST160       66054      36414182
EST161       64044      45617871
EST162       62691      36050104
EST163       101575     45496582
EST164       86436      50800819
EST165       102202     58700290
EST166       104243     58995847
EST167       90115      48166737
EST168       90532      36949278
EST169       94972      49460785
EST17        81663      33430377
EST170       89895      38884947
EST171       95816      40331905
EST172       67636      40693229
EST173       68883      41874032
EST174       63694      36932663
EST175       65755      42718735
EST176       69775      30321260
EST177       77290      34100735
EST178       68499      42600351
EST179       81757      40454454
EST18        80744      32692054
EST180       63369      32881764
EST181       68726      49375875
EST182       69343      45789259
EST183       68211      36268231
EST184       69615      44775885
EST185       69208      53301724
EST186       70409      35788602
EST187       70617      41930529
EST188       70503      60772634
EST189       65825      48372474
EST19        78742      31494918
EST190       64572      47107083
EST191       64107      47573881
EST192       66119      45893866
EST193       66526      50089952
EST194       62593      42463073
EST195       63270      37838233
EST196       62840      34711937
EST197       68313      39295636
EST198       81920      48038507
EST199       82908      53981387
EST2         74809      28707014
EST20        74149      30833193
EST200       78521      45829196
EST201       106539     66125687
EST202       108949     65299984
EST203       108598     64505728
EST204       103298     66782833
EST205       115406     59744732
EST206       82748      45038875
EST207       69965      41829228
EST208       68549      59112310
EST209       71108      56276898
EST21        74502      34224300
EST210       78890      39717199
EST211       80743      46966788
EST212       74375      52866681
EST213       72397      48948883
EST214       34399      14894204
EST215       27827      10632679
EST216       27490      10150265
EST217       26373      9682241
EST218       26696      8978299
EST219       27666      10069561
EST22        74003      29690275
EST220       27237      9855907
EST221       27227      9832509
EST222       27330      10522117
EST223       27151      12013746
EST224       27256      11173805
EST225       27384      10013849
EST226       27654      9272071
EST227       26911      9393682
EST228       27845      11311657
EST229       27733      10885610
EST23        77321      32941343
EST230       26992      11349624
EST231       26713      12023341
EST232       27111      11258600
EST233       27068      10895245
EST234       27061      11694202
EST235       27187      11569847
EST236       27301      10961187
EST237       27293      10864181
EST238       27192      10474696
EST239       27135      11752286
EST24        74289      32233256
EST240       24439      17185984
EST241       25850      17292144
EST242       52111      21419062
EST243       104483     41761779
EST244       71954      42086544
EST245       68656      44606556
EST246       69404      44494375
EST247       69508      43900663
EST248       68937      40364308
EST249       71233      41130633
EST25        74607      32476955
EST250       65225      49407539
EST251       63698      31675206
EST252       83893      41367616
EST253       99919      46313524
EST254       71826      41293885
EST255       65502      33125256
EST256       69309      33455464
EST257       70559      42873863
EST258       74446      34505080
EST259       71056      37467123
EST26        74390      30421570
EST260       72261      46034241
EST261       63275      35479777
EST262       68770      34970284
EST263       85542      45676449
EST264       73669      40907614
EST265       80394      56045892
EST266       87890      53461456
EST267       105943     48047962
EST268       79323      45307133
EST269       72648      42830568
EST27        74794      32497756
EST270       73939      40184430
EST271       69443      33515154
EST272       70089      27720800
EST273       66253      40265726
EST274       62823      36100371
EST275       66323      42235308
EST276       69569      40073540
EST277       63859      44119087
EST278       68403      34337163
EST279       82088      44327212
EST28        107010     50649156
EST280       79581      43305748
EST281       87740      52176464
EST282       113924     51792559
EST283       107748     47869050
EST284       71321      37184282
EST285       68244      38488412
EST286       73498      45751330
EST287       79172      38575450
EST288       71470      43875439
EST289       69865      38881173
EST29        97904      45918912
EST290       60106      37300028
EST291       52811      27902113
EST292       71386      49310296
EST293       65335      40234529
EST294       75466      44113199
EST295       65623      39560074
EST296       76104      39626130
EST297       73087      49641263
EST298       72063      35097164
EST299       67685      50194997
EST3         73671      29895129
EST30        98728      52004367
EST300       66346      50406137
EST301       61529      47190245
EST302       63832      37945575
EST303       69191      42353524
EST304       67080      42881223
EST305       48073      23725168
EST306       68356      35792360
EST307       67509      36648148
EST308       60088      29333555
EST309       65814      42034565
EST31        70222      43462920
EST310       76623      44597299
EST311       76904      40856307
EST312       64781      37921909
EST313       74401      43596777
EST314       64976      44106712
EST315       80063      46991011
EST316       85096      49707245
EST317       81807      45062567
EST318       63251      35542620
EST319       67772      37153628
EST32        71299      57718278
EST320       72704      39832021
EST321       48119      24864511
EST322       62208      34097369
EST323       74650      42895977
EST324       98102      46185631
EST325       72812      50187904
EST326       74884      48079948
EST327       70789      43667215
EST328       61164      34098268
EST329       88460      38249210
EST33        85263      48763203
EST330       68277      40639532
EST331       63816      39384862
EST332       62490      38021300
EST333       93578      54428044
EST334       83915      44436285
EST335       75904      43140276
EST336       67486      35187707
EST337       41702      25598069
EST338       52183      29467819
EST339       82366      52048453
EST34        86421      43469494
EST340       81641      43883851
EST341       76484      42536024
EST342       67096      38505891
EST343       61634      40573764
EST344       76040      40189870
EST345       56455      35941105
EST346       82102      28186871
EST347       77557      30699446
EST348       69634      41759028
EST349       68952      34422894
EST35        90972      45146882
EST350       75565      46303691
EST351       72369      47900708
EST352       64902      39743515
EST353       77087      45373430
EST354       59212      33181504
EST355       67894      43493388
EST356       81701      49929251
EST357       79345      46624368
EST358       59427      41967721
EST359       57426      41711235
EST36        101241     46720481
EST360       57665      41187523
EST361       64427      39833249
EST362       73873      44789920
EST363       55045      34637427
EST364       59468      38699537
EST365       58536      40656880
EST366       61344      42157813
EST367       55535      41653738
EST368       46882      33546466
EST369       83581      38965007
EST37        98163      52081014
EST370       52306      40669813
EST371       65277      46529716
EST372       68794      38488626
EST373       63269      39238849
EST374       118520     59800613
EST375       79752      48734479
EST376       79662      58135443
EST377       40066      22729494
EST378       50337      54320132
EST379       46558      58478725
EST38        98205      40951835
EST380       68176      48033065
EST381       76586      30691889
EST382       69784      25348964
EST383       73277      27448707
EST384       73923      25995289
EST385       77987      27541221
EST386       70311      24453665
EST387       70777      29532934
EST388       52455      19072633
EST39        68700      18453238
EST4         74043      28188390
EST40        68923      18398902
EST41        69046      20790854
EST42        43271      11834059
EST43        43197      12061088
EST44        42939      11573217
EST45        64172      24513228
EST46        98398      43441383
EST47        94646      45354537
EST48        90511      45783961
EST49        96641      47071458
EST5         48459      15406932
EST50        107457     56026114
EST51        75936      33356067
EST52        67187      28573711
EST53        72011      32123087
EST54        74313      32018880
EST55        75392      31082737
EST56        80633      31784154
EST57        69527      27710606
EST58        63749      28673127
EST59        72218      32317396
EST6         55076      17490023
EST60        80043      36246569
EST61        74088      29257406
EST62        74182      26232952
EST63        86868      41040548
EST64        48175      15337759
EST65        40088      11045623
EST66        40111      12016391
EST67        40415      12495767
EST68        40506      12159991
EST69        40424      12998703
EST7         74129      29185758
EST70        40478      12654405
EST71        40339      12284396
EST72        40053      12045751
EST73        40525      12660291
EST74        41387      11781676
EST75        41151      13059163
EST76        41015      12643650
EST77        40907      13478752
EST78        45607      11867664
EST79        40405      24881301
EST8         75477      30478673
EST80        41989      22060512
EST81        45747      18769473
EST82        49768      22825618
EST83        51508      21409877
EST84        56331      22904355
EST85        75890      31694060
EST86        74529      28897729
EST87        72909      33436625
EST88        77593      46537129
EST89        76414      41408241
EST9         77494      29868977
EST90        77587      38697948
EST91        75737      40524724
EST92        71900      39418596
EST93        73484      31847365
EST94        75244      43423894
EST95        70254      32866867
EST96        77217      49610090
EST97        64151      34385768
EST98        71401      36705011
EST99        74155      44608131
GSS1         90836      38842477
GSS10        75208      43836508
GSS100       75331      41509710
GSS101       73676      45657770
GSS102       73754      45461499
GSS103       73774      45377670
GSS104       73464      45052718
GSS105       73772      44273843
GSS106       81846      54449635
GSS107       85938      57876411
GSS108       80574      53685947
GSS109       85259      51405622
GSS11        70000      35699178
GSS110       84958      54894149
GSS111       80689      62623214
GSS112       93581      43005298
GSS113       91389      53736441
GSS114       73240      48875140
GSS115       88709      66047215
GSS116       69202      45677353
GSS117       87197      64745577
GSS118       83935      63019860
GSS119       101811     47223456
GSS12        73608      38702548
GSS120       68848      58673824
GSS121       68481      58909359
GSS122       69546      56761282
GSS123       69798      56274167
GSS124       70631      55730776
GSS125       86085      72995386
GSS126       85119      41400077
GSS127       70382      46472750
GSS128       110762     72822195
GSS129       84859      35553941
GSS13        76643      38844833
GSS130       90240      68149845
GSS131       72904      60663505
GSS132       70477      59277363
GSS133       66035      63424612
GSS134       78169      57435686
GSS135       121264     73506249
GSS136       118538     76288833
GSS137       104388     58421857
GSS138       87067      55375134
GSS139       97819      55487686
GSS14        71653      32200787
GSS140       90435      47882037
GSS141       98386      45817181
GSS142       114        86870
GSS15        71100      35448621
GSS16        77492      45681031
GSS17        71232      33509805
GSS18        57963      27843054
GSS19        57000      28965854
GSS2         89386      39537704
GSS20        57919      26494676
GSS21        62283      31416561
GSS22        64355      36094912
GSS23        57735      26980718
GSS24        67913      43061535
GSS25        66718      27435176
GSS26        58232      25662727
GSS27        67992      32487290
GSS28        62972      32554914
GSS29        81188      40721148
GSS3         87707      41943972
GSS30        81324      39942710
GSS31        74483      40451723
GSS32        70651      48514417
GSS33        80030      37771909
GSS34        76197      40343980
GSS35        75356      40149745
GSS36        87784      58322137
GSS37        87789      58316593
GSS38        85868      44842527
GSS39        84733      48447833
GSS4         79301      41207693
GSS40        88804      37368497
GSS41        82279      36963706
GSS42        81457      57001778
GSS43        79091      56972488
GSS44        72222      47691847
GSS45        72274      47557004
GSS46        78311      44914325
GSS47        78387      40833740
GSS48        84148      58850382
GSS49        86253      68388474
GSS5         79043      40732356
GSS50        84163      50897980
GSS51        93160      60265320
GSS52        87265      56829775
GSS53        74532      39722874
GSS54        76717      45526094
GSS55        86016      45249706
GSS56        87216      57244393
GSS57        75637      70333120
GSS58        72485      78627825
GSS59        89751      68029017
GSS6         78252      38893868
GSS60        84322      55767764
GSS61        63647      45424944
GSS62        71610      49673077
GSS63        89651      67273610
GSS64        86227      55651049
GSS65        87535      54836387
GSS66        87595      57562331
GSS67        98136      57721043
GSS68        100635     54499365
GSS69        100877     54192340
GSS7         77536      39418685
GSS70        101235     53739885
GSS71        102491     52146637
GSS72        102253     52447668
GSS73        102632     51967344
GSS74        102121     52614356
GSS75        97487      58141291
GSS76        90102      70455196
GSS77        89838      70776651
GSS78        87860      69499273
GSS79        87814      69692490
GSS8         76334      38105756
GSS80        89104      61075860
GSS81        79707      21224547
GSS82        78275      24800233
GSS83        90782      37616668
GSS84        84345      51246290
GSS85        81580      52968907
GSS86        89030      64285859
GSS87        77532      64601964
GSS88        79203      79157977
GSS89        77846      53370041
GSS9         72576      37287448
GSS90        94172      50620212
GSS91        74390      39304371
GSS92        85698      53653909
GSS93        73069      59222734
GSS94        85880      52865787
GSS95        83073      61065858
GSS96        86876      57778156
GSS97        84731      55145889
GSS98        87397      60371400
GSS99        81038      61432651
HTC1         32150      55611252
HTC2         31636      66259760
HTC3         75093      40628412
HTC4         84085      78220313
HTC5         93333      82579504
HTC6         62853      98845849
HTG1         1317       188906440
HTG10        1239       186683604
HTG11        1426       184144548
HTG12        888        191933080
HTG13        751        192396407
HTG14        742        192402878
HTG15        776        192297612
HTG16        802        191977482
HTG17        766        192372264
HTG18        1987       172458347
HTG19        951        189891941
HTG2         2563       186021293
HTG20        1209       186038477
HTG21        778        191945541
HTG22        905        190501564
HTG23        868        191330741
HTG24        870        190655619
HTG25        774        192120022
HTG26        835        191502226
HTG27        870        191475339
HTG28        927        190367253
HTG29        923        190355673
HTG3         2449       185332304
HTG30        928        190735662
HTG31        908        191051335
HTG32        861        191589246
HTG33        978        189710060
HTG34        879        191300076
HTG35        858        191628224
HTG36        824        191928089
HTG37        932        190200320
HTG38        932        190954718
HTG39        939        190608976
HTG4         2529       188498207
HTG40        1003       190072838
HTG41        1155       187606002
HTG42        1178       187696091
HTG43        1273       188375955
HTG44        1152       188273475
HTG45        1106       189758123
HTG46        1176       191384535
HTG47        1267       190942925
HTG48        1169       191639097
HTG49        1213       191264409
HTG5         1281       185666662
HTG50        1135       190975010
HTG51        1087       188826217
HTG52        1145       190519252
HTG53        1418       188373898
HTG54        1424       188604537
HTG55        1197       190539217
HTG56        1317       190207419
HTG57        1121       191938364
HTG58        1402       190257936
HTG59        1176       190929014
HTG6         1274       185376276
HTG60        1084       193876193
HTG61        1038       193820133
HTG62        1043       193449516
HTG63        860        147194259
HTG7         1246       185596893
HTG8         1288       185096451
HTG9         1185       187067144
INV1         15015      165948540
INV2         1609       166279366
INV3         38404      111838431
INV4         73667      75364900
INV5         79075      73729487
INV6         38596      109764377
INV7         31783      73915055
MAM1         56526      108700891
MAM2         16354      20921439
PAT1         222997     70290345
PAT10        106497     60501319
PAT11        104254     49775791
PAT12        145667     58531456
PAT13        157035     64895647
PAT14        107629     116116106
PAT15        141920     93397065
PAT16        108939     111161543
PAT17        146679     71460688
PAT2         194349     84712749
PAT3         171910     95946236
PAT4         146893     101792246
PAT5         151668     82659422
PAT6         105935     118830630
PAT7         143962     90302289
PAT8         127616     99286405
PAT9         142512     64816727
PHG          2547       16072018
PLN1         32575      124993092
PLN10        19811      137996008
PLN11        63897      68632446
PLN12        77695      79054042
PLN13        65301      86381379
PLN14        29241      122666882
PLN15        33448      116892555
PLN16        13517      24919003
PLN2         1371       177338516
PLN3         17158      145730551
PLN4         77477      77321436
PLN5         61083      63199088
PLN6         28325      71905866
PLN7         1258       165650330
PLN8         930        192375334
PLN9         7          212935788
PRI1         18303      149715653
PRI10        1423       177872727
PRI11        1279       176268873
PRI12        1501       175688597
PRI13        1590       178926376
PRI14        1518       184903394
PRI15        20885      157557015
PRI16        42792      100877321
PRI17        16896      137736774
PRI18        1606       183879489
PRI19        1727       183469198
PRI2         1438       173189596
PRI20        2107       181871130
PRI21        1657       185390402
PRI22        27436      143351116
PRI23        46826      78331411
PRI24        19467      128887025
PRI25        15065      166566381
PRI26        37965      135691672
PRI27        33640      134493687
PRI28        50177      80438425
PRI3         1264       183872781
PRI4         1307       180202583
PRI5         1160       175578585
PRI6         1193       178834555
PRI7         1221       178223519
PRI8         1346       171774397
PRI9         1221       177462382
ROD1         8408       170890618
ROD10        1027       186206121
ROD11        2435       183268479
ROD12        26217      146262569
ROD13        1186       191534612
ROD14        1248       193831118
ROD15        25221      150519261
ROD16        26561      89664696
ROD17        44778      119255560
ROD18        1340       1142471
ROD2         919        174192739
ROD3         897        174288482
ROD4         913        174829940
ROD5         958        176564993
ROD6         974        180015970
ROD7         976        181345619
ROD8         1005       182200210
ROD9         985        181913369
STS1         81967      35402865
STS10        58199      44464833
STS11        57993      43685996
STS12        77473      38095654
STS13        89549      39277791
STS14        1941       1151510
STS2         83773      43698902
STS3         78819      32192711
STS4         63998      33049577
STS5         54895      31904461
STS6         54697      32308890
STS7         54684      32231985
STS8         56543      39216118
STS9         58081      44559351
SYN          22992      31396122
UNA          259        135466
VRL1         72961      65687246
VRL2         72677      66529403
VRL3         72187      69403184
VRL4         64207      60903632
VRT1         59781      102690036
VRT2         12818      171430305
VRT3         76250      75077664
VRT4         21178      110367601
VRT5         1227       193316431
VRT6         1295       193101006
VRT7         14648      172194206
VRT8         37915      110428845

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 147.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries       Bases   Species

8479400 11096908301   Homo sapiens
6214089  7112181496   Mus musculus
997087   5656261578   Rattus norvegicus
798764   2081895252   Danio rerio
2450906  1623715561   Zea mays
353603   1163554675   Oryza sativa (japonica cultivar-group)
1103208  1081651181   Bos taurus
1027563   833436299   Xenopus tropicalis
1381233   787975168   Canis familiaris
502530    773403017   Drosophila melanogaster
974522    642974899   Arabidopsis thaliana
724319    623861517   Gallus gallus
194912    479865917   Pan troglodytes
784402    462484333   Sorghum bicolor
693197    418419967   Ciona intestinalis
596152    404044922   Brassica oleracea
599903    382736619   Sus scrofa
58430     378166251   Macaca mulatta
377638    376759242   Medicago truncatula
597832    335406151   Triticum aestivum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 October 2005

                NCBI-GenBank Flat File Release 147.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 147.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
	Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
	Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
	Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
	Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Tony Stearman

User Support
	Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
	Renata Geer, Scott McGinnis, Donna Messersmith, Rana Morris, Vyvy Pham,
	Monica Romiti, Eric Sayers, Tao Tao, David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center