Release Notes For GenBank Release 148

GBREL.TXT          Genetic Sequence Data Bank
                         June 15 2005

               NCBI-GenBank Flat File Release 148.0

                    Distribution Release Notes

 45236251 loci, 49398852122 bases, from 45236251 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 148.0
1.2 Cutoff Date
1.3 Important Changes in Release 148.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 148.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 148.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.

1.2 Cutoff Date

  This full release, 148.0, incorporates data available to the collaborating
databases as of June 14, 2005 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 148.0

1.3.1 Problems generating accession number and keyword indexes

  Continuing software problems again prevented the generation of
the gbacc.idx and gbkey.idx 'index' files which normally accompany
GenBank releases.

  A version of gbacc.idx was built manually. However, the first field
contains just an accession number rather than Accession.Version .

  The gbkey.idx index could not be created without substantial
additional delays in release processing, so it is completely absent
from 148.0 .

  Our apologies for any inconvenience that this may cause.

1.3.2 Organizational changes

  The total number of sequence data files increased by 17 with this release:

  - the EST division is now comprised of 397 files (+9)
  - the GSS division is now comprised of 144 files (+2)
  - the HTC division is now comprised of   7 files (+1)
  - the HTG division is now comprised of  65 files (+2)
  - the PAT division is now comprised of  18 files (+1)
  - the VRL division is now comprised of   5 files (+1)
  - the VRT division is now comprised of   9 files (+1)

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
twenty-six GSS flatfiles in Release 148.0. Consider gbgss119.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                            June 15 2005

                NCBI-GenBank Flat File Release 148.0

                           GSS Sequences (Part 1)

   87186 loci,    64735440 bases, from    87186 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "119" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

  Several changes related to the Feature Table were agreed to during the
May 2005 collaborative meeting among DDBJ, EMBL, and GenBank. The descriptions
of the changes provided below are preliminary; complete definitions will appear
in future release notes.

1.4.1 New qualifiers for the source feature

  A set of eight new source feature qualifiers will be legal as of the
October 2005 release.

    /lat_lon : GPS coordinates for the location at which a specimen,
               from which the sequence was obtained, was collected.
               Format: Decimal degrees (N/S, E/W). 

    /collected_by : Name of the person who collected the specimen.

    /collection_date : Date that the specimen was collected. 
               Format: DD-MMM-YYYY (two-digit month, three letter
               month abbreviation, 4-digit year)

    /identified_by : Name of the person who identified the specimen.

    /fwd_primer_seq : Forward PCR primer sequence used to amplify
               the sequence.

    /fwd_primer_name : Name of the forward PCR primer.

    /rev_primer_seq : Reverse PCR primer sequence used to amplify
               the sequence.

    /rev_primer_name : Name of the reverse PCR primer.

  These qualifiers will most likely see their first use in association
with environmental sampling projects and the BarCode project.

1.4.2 : /evidence qualifer to be replaced 

  Two new qualifiers designed to replace /evidence will be legal as
of the October 2005 GenBank release : /experiment and /inference .

  The current /evidence="not_experimental" qualifier will be replaced
by /inference . The /inference values will be from a controlled list
which is intended to capture several different classes of inferential
methods.

  The current /evidence="experimental" qualifier will be replaced
by /experiment. This will be a free-text qualifier in which a brief
description of the nature of the bench experiment which supports
the associated feature can be provided by the submittor.

1.4.3 New /organelle qualifier value

  As of the October 2005 GenBank release, a new value for the /organelle
qualifier will be legal : hydrogenosome 

  This will support the annotation of sequences from anaerobic protozoa
and fungi, for which the hydrogenosome has a role in anaerobic respiration. 

1.4.4 Two new CDS qualifiers

  As of the October 2005 GenBank release, two new CDS feature qualifiers
will be introduced:

	/trans_splicing
	/ribosomal_slippage

  Coding regions involved in such processes will be more easily identified
with the addition of these qualifiers.

1.4.5 New /exception qualifier value

  Coding regions for which the conceptual protein translation differs from
the supplied /translation qualifier are flagged with an /exception 
qualifier. The value :

	"rearrangement required for product"

will be legal for this qualifier as of the October 2005 GenBank release.

1.4.6 : /repeat_unit qualifer to be replaced 

  Two new qualifiers designed to replace /repeat_unit will be legal as
of the October 2005 GenBank release : /repeat_unit_seq and /repeat_unit_range .

  The current qualifier accomodates both integer ranges (eg: "10..20") and
characters that represent a repeat unit pattern (eg: (AT)2(AA)5 ). Introducing
a distinct qualifier for each of these representations will make it easier
to submit and validate them.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

  The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 785 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut28.idx - Index of the entries according to accession number, part 28.
23. gbaut29.idx - Index of the entries according to accession number, part 29.
24. gbaut3.idx - Index of the entries according to accession number, part 3.
25. gbaut4.idx - Index of the entries according to accession number, part 4.
26. gbaut5.idx - Index of the entries according to accession number, part 5.
27. gbaut6.idx - Index of the entries according to accession number, part 6.
28. gbaut7.idx - Index of the entries according to accession number, part 7.
29. gbaut8.idx - Index of the entries according to accession number, part 8.
30. gbaut9.idx - Index of the entries according to accession number, part 9.
31. gbbct1.seq - Bacterial sequence entries, part 1.
32. gbbct10.seq - Bacterial sequence entries, part 10.
33. gbbct11.seq - Bacterial sequence entries, part 11.
34. gbbct2.seq - Bacterial sequence entries, part 2.
35. gbbct3.seq - Bacterial sequence entries, part 3.
36. gbbct4.seq - Bacterial sequence entries, part 4.
37. gbbct5.seq - Bacterial sequence entries, part 5.
38. gbbct6.seq - Bacterial sequence entries, part 6.
39. gbbct7.seq - Bacterial sequence entries, part 7.
40. gbbct8.seq - Bacterial sequence entries, part 8.
41. gbbct9.seq - Bacterial sequence entries, part 9.
42. gbchg.txt - Accession numbers of entries updated since the previous release.
43. gbcon.seq - Constructed sequence entries.
44. gbdel.txt - Accession numbers of entries deleted since the previous release.
45. gbenv1.seq - Environmental sampling sequence entries, part 1.
46. gbenv2.seq - Environmental sampling sequence entries, part 2.
47. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
48. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
49. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
50. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
51. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
52. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
53. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
54. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
55. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
56. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
57. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
58. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
59. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
60. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
61. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
62. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
63. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
64. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
65. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
66. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
67. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
68. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
69. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
70. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
71. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
72. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
73. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
74. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
75. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
76. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
77. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
78. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
79. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
80. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
81. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
82. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
83. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
84. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
85. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
86. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
87. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
88. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
89. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
90. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
91. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
92. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
93. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
94. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
95. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
96. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
97. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
98. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
99. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
100. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
101. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
102. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
103. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
104. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
105. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
106. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
107. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
108. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
109. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
110. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
111. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
112. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
113. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
114. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
115. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
116. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
117. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
118. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
119. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
120. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
121. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
122. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
123. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
124. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
125. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
126. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
127. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
128. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
129. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
130. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
131. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
132. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
133. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
134. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
135. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
136. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
137. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
138. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
139. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
140. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
141. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
142. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
143. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
144. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
145. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
146. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
147. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
148. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
149. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
150. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
151. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
152. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
153. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
154. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
155. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
156. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
157. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
158. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
159. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
160. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
161. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
162. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
163. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
164. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
165. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
166. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
167. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
168. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
169. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
170. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
171. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
172. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
173. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
174. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
175. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
176. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
177. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
178. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
179. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
180. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
181. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
182. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
183. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
184. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
185. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
186. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
187. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
188. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
189. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
190. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
191. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
192. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
193. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
194. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
195. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
196. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
197. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
198. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
199. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
200. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
201. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
202. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
203. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
204. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
205. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
206. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
207. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
208. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
209. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
210. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
211. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
212. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
213. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
214. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
215. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
216. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
217. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
218. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
219. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
220. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
221. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
222. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
223. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
224. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
225. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
226. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
227. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
228. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
229. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
230. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
231. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
232. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
233. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
234. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
235. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
236. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
237. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
238. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
239. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
240. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
241. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
242. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
243. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
244. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
245. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
246. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
247. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
248. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
249. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
250. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
251. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
252. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
253. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
254. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
255. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
256. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
257. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
258. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
259. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
260. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
261. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
262. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
263. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
264. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
265. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
266. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
267. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
268. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
269. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
270. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
271. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
272. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
273. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
274. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
275. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
276. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
277. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
278. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
279. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
280. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
281. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
282. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
283. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
284. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
285. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
286. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
287. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
288. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
289. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
290. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
291. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
292. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
293. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
294. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
295. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
296. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
297. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
298. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
299. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
300. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
301. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
302. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
303. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
304. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
305. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
306. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
307. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
308. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
309. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
310. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
311. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
312. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
313. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
314. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
315. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
316. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
317. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
318. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
319. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
320. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
321. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
322. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
323. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
324. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
325. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
326. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
327. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
328. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
329. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
330. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
331. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
332. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
333. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
334. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
335. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
336. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
337. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
338. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
339. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
340. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
341. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
342. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
343. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
344. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
345. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
346. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
347. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
348. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
349. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
350. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
351. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
352. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
353. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
354. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
355. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
356. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
357. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
358. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
359. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
360. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
361. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
362. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
363. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
364. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
365. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
366. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
367. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
368. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
369. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
370. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
371. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
372. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
373. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
374. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
375. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
376. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
377. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
378. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
379. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
380. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
381. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
382. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
383. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
384. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
385. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
386. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
387. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
388. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
389. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
390. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
391. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
392. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
393. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
394. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
395. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
396. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
397. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
398. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
399. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
400. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
401. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
402. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
403. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
404. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
405. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
406. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
407. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
408. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
409. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
410. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
411. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
412. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
413. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
414. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
415. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
416. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
417. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
418. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
419. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
420. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
421. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
422. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
423. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
424. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
425. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
426. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
427. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
428. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
429. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
430. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
431. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
432. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
433. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
434. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
435. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
436. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
437. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
438. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
439. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
440. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
441. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
442. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
443. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
444. gbgen.idx - Index of the entries according to gene symbols.
445. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
446. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
447. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
448. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
449. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
450. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
451. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
452. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
453. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
454. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
455. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
456. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
457. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
458. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
459. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
460. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
461. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
462. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
463. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
464. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
465. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
466. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
467. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
468. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
469. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
470. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
471. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
472. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
473. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
474. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
475. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
476. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
477. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
478. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
479. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
480. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
481. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
482. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
483. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
484. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
485. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
486. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
487. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
488. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
489. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
490. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
491. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
492. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
493. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
494. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
495. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
496. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
497. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
498. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
499. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
500. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
501. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
502. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
503. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
504. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
505. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
506. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
507. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
508. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
509. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
510. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
511. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
512. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
513. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
514. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
515. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
516. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
517. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
518. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
519. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
520. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
521. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
522. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
523. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
524. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
525. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
526. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
527. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
528. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
529. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
530. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
531. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
532. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
533. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
534. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
535. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
536. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
537. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
538. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
539. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
540. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
541. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
542. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
543. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
544. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
545. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
546. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
547. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
548. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
549. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
550. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
551. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
552. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
553. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
554. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
555. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
556. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
557. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
558. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
559. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
560. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
561. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
562. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
563. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
564. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
565. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
566. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
567. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
568. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
569. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
570. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
571. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
572. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
573. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
574. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
575. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
576. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
577. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
578. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
579. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
580. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
581. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
582. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
583. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
584. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
585. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
586. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
587. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
588. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
589. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
590. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
591. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
592. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
593. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
594. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
595. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
596. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
597. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
598. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
599. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
600. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
601. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
602. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
603. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
604. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
605. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
606. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
607. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
608. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
609. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
610. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
611. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
612. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
613. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
614. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
615. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
616. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
617. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
618. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
619. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
620. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
621. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
622. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
623. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
624. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
625. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
626. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
627. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
628. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
629. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
630. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
631. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
632. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
633. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
634. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
635. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
636. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
637. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
638. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
639. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
640. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
641. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
642. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
643. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
644. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
645. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
646. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
647. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
648. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
649. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
650. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
651. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
652. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
653. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
654. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
655. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
656. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
657. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
658. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
659. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
660. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
661. gbinv1.seq - Invertebrate sequence entries, part 1.
662. gbinv2.seq - Invertebrate sequence entries, part 2.
663. gbinv3.seq - Invertebrate sequence entries, part 3.
664. gbinv4.seq - Invertebrate sequence entries, part 4.
665. gbinv5.seq - Invertebrate sequence entries, part 5.
666. gbinv6.seq - Invertebrate sequence entries, part 6.
667. gbinv7.seq - Invertebrate sequence entries, part 7.
668. gbjou.idx - Index of the entries according to journal citation.
669. gbmam1.seq - Other mammalian sequence entries, part 1.
670. gbmam2.seq - Other mammalian sequence entries, part 2.
671. gbnew.txt - Accession numbers of entries new since the previous release.
672. gbpat1.seq - Patent sequence entries, part 1.
673. gbpat10.seq - Patent sequence entries, part 10.
674. gbpat11.seq - Patent sequence entries, part 11.
675. gbpat12.seq - Patent sequence entries, part 12.
676. gbpat13.seq - Patent sequence entries, part 13.
677. gbpat14.seq - Patent sequence entries, part 14.
678. gbpat15.seq - Patent sequence entries, part 15.
679. gbpat16.seq - Patent sequence entries, part 16.
680. gbpat17.seq - Patent sequence entries, part 17.
681. gbpat18.seq - Patent sequence entries, part 18.
682. gbpat2.seq - Patent sequence entries, part 2.
683. gbpat3.seq - Patent sequence entries, part 3.
684. gbpat4.seq - Patent sequence entries, part 4.
685. gbpat5.seq - Patent sequence entries, part 5.
686. gbpat6.seq - Patent sequence entries, part 6.
687. gbpat7.seq - Patent sequence entries, part 7.
688. gbpat8.seq - Patent sequence entries, part 8.
689. gbpat9.seq - Patent sequence entries, part 9.
690. gbphg.seq - Phage sequence entries.
691. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
692. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
693. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
694. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
695. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
696. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
697. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
698. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
699. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
700. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
701. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
702. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
703. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
704. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
705. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
706. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
707. gbpri1.seq - Primate sequence entries, part 1.
708. gbpri10.seq - Primate sequence entries, part 10.
709. gbpri11.seq - Primate sequence entries, part 11.
710. gbpri12.seq - Primate sequence entries, part 12.
711. gbpri13.seq - Primate sequence entries, part 13.
712. gbpri14.seq - Primate sequence entries, part 14.
713. gbpri15.seq - Primate sequence entries, part 15.
714. gbpri16.seq - Primate sequence entries, part 16.
715. gbpri17.seq - Primate sequence entries, part 17.
716. gbpri18.seq - Primate sequence entries, part 18.
717. gbpri19.seq - Primate sequence entries, part 19.
718. gbpri2.seq - Primate sequence entries, part 2.
719. gbpri20.seq - Primate sequence entries, part 20.
720. gbpri21.seq - Primate sequence entries, part 21.
721. gbpri22.seq - Primate sequence entries, part 22.
722. gbpri23.seq - Primate sequence entries, part 23.
723. gbpri24.seq - Primate sequence entries, part 24.
724. gbpri25.seq - Primate sequence entries, part 25.
725. gbpri26.seq - Primate sequence entries, part 26.
726. gbpri27.seq - Primate sequence entries, part 27.
727. gbpri28.seq - Primate sequence entries, part 28.
728. gbpri3.seq - Primate sequence entries, part 3.
729. gbpri4.seq - Primate sequence entries, part 4.
730. gbpri5.seq - Primate sequence entries, part 5.
731. gbpri6.seq - Primate sequence entries, part 6.
732. gbpri7.seq - Primate sequence entries, part 7.
733. gbpri8.seq - Primate sequence entries, part 8.
734. gbpri9.seq - Primate sequence entries, part 9.
735. gbrel.txt - Release notes (this document).
736. gbrod1.seq - Rodent sequence entries, part 1.
737. gbrod10.seq - Rodent sequence entries, part 10.
738. gbrod11.seq - Rodent sequence entries, part 11.
739. gbrod12.seq - Rodent sequence entries, part 12.
740. gbrod13.seq - Rodent sequence entries, part 13.
741. gbrod14.seq - Rodent sequence entries, part 14.
742. gbrod15.seq - Rodent sequence entries, part 15.
743. gbrod16.seq - Rodent sequence entries, part 16.
744. gbrod17.seq - Rodent sequence entries, part 17.
745. gbrod18.seq - Rodent sequence entries, part 18.
746. gbrod2.seq - Rodent sequence entries, part 2.
747. gbrod3.seq - Rodent sequence entries, part 3.
748. gbrod4.seq - Rodent sequence entries, part 4.
749. gbrod5.seq - Rodent sequence entries, part 5.
750. gbrod6.seq - Rodent sequence entries, part 6.
751. gbrod7.seq - Rodent sequence entries, part 7.
752. gbrod8.seq - Rodent sequence entries, part 8.
753. gbrod9.seq - Rodent sequence entries, part 9.
754. gbsdr.txt - Short directory of the data bank.
755. gbsec.idx - Index of the entries according to secondary accession number.
756. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
757. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
758. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
759. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
760. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
761. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
762. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
763. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
764. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
765. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
766. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
767. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
768. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
769. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
770. gbsyn.seq - Synthetic and chimeric sequence entries.
771. gbuna.seq - Unannotated sequence entries.
772. gbvrl1.seq - Viral sequence entries, part 1.
773. gbvrl2.seq - Viral sequence entries, part 2.
774. gbvrl3.seq - Viral sequence entries, part 3.
775. gbvrl4.seq - Viral sequence entries, part 4.
776. gbvrl5.seq - Viral sequence entries, part 5.
777. gbvrt1.seq - Other vertebrate sequence entries, part 1.
778. gbvrt2.seq - Other vertebrate sequence entries, part 2.
779. gbvrt3.seq - Other vertebrate sequence entries, part 3.
780. gbvrt4.seq - Other vertebrate sequence entries, part 4.
781. gbvrt5.seq - Other vertebrate sequence entries, part 5.
782. gbvrt6.seq - Other vertebrate sequence entries, part 6.
783. gbvrt7.seq - Other vertebrate sequence entries, part 7.
784. gbvrt8.seq - Other vertebrate sequence entries, part 8.
785. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 148.0 flatfiles require roughly 172 GB (sequence
files only) or 189 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1394936206     gbacc.idx
 507277425     gbaut1.idx
 507694605     gbaut10.idx
 502675279     gbaut11.idx
 541301666     gbaut12.idx
 517534345     gbaut13.idx
 509130832     gbaut14.idx
 501363440     gbaut15.idx
 514414062     gbaut16.idx
 502305566     gbaut17.idx
 506141547     gbaut18.idx
 500038908     gbaut19.idx
 501754160     gbaut2.idx
 517210828     gbaut20.idx
 500515977     gbaut21.idx
 504051758     gbaut22.idx
 505632777     gbaut23.idx
 508174498     gbaut24.idx
 511244506     gbaut25.idx
 502375430     gbaut26.idx
 508672334     gbaut27.idx
 500219761     gbaut28.idx
 476004142     gbaut29.idx
 528821652     gbaut3.idx
 503350165     gbaut4.idx
 500069346     gbaut5.idx
 500403152     gbaut6.idx
 500137643     gbaut7.idx
 512811391     gbaut8.idx
 503117315     gbaut9.idx
 250018560     gbbct1.seq
 250000502     gbbct10.seq
  80155728     gbbct11.seq
 250020511     gbbct2.seq
 250234285     gbbct3.seq
 250002289     gbbct4.seq
 250002532     gbbct5.seq
 255149444     gbbct6.seq
 250275100     gbbct7.seq
 250005224     gbbct8.seq
 250003060     gbbct9.seq
   7707729     gbchg.txt
1169137252     gbcon.seq
     16778     gbdel.txt
 250001019     gbenv1.seq
 131514510     gbenv2.seq
 230687973     gbest1.seq
 230690225     gbest10.seq
 230687483     gbest100.seq
 230689762     gbest101.seq
 230689546     gbest102.seq
 230690286     gbest103.seq
 230689378     gbest104.seq
 230689259     gbest105.seq
 230689614     gbest106.seq
 230687833     gbest107.seq
 230689741     gbest108.seq
 230690259     gbest109.seq
 230690093     gbest11.seq
 230666954     gbest110.seq
 230689696     gbest111.seq
 230687646     gbest112.seq
 230688667     gbest113.seq
 230687973     gbest114.seq
 230687702     gbest115.seq
 230688229     gbest116.seq
 230687750     gbest117.seq
 230689806     gbest118.seq
 230689581     gbest119.seq
 230690176     gbest12.seq
 230689284     gbest120.seq
 230690383     gbest121.seq
 230689026     gbest122.seq
 230690364     gbest123.seq
 230689986     gbest124.seq
 230689168     gbest125.seq
 230688272     gbest126.seq
 230687691     gbest127.seq
 230688318     gbest128.seq
 230688223     gbest129.seq
 230689778     gbest13.seq
 230690238     gbest130.seq
 230691744     gbest131.seq
 230689485     gbest132.seq
 230690317     gbest133.seq
 230687468     gbest134.seq
 230689525     gbest135.seq
 230687917     gbest136.seq
 230688803     gbest137.seq
 230691324     gbest138.seq
 230688795     gbest139.seq
 230689531     gbest14.seq
 230688053     gbest140.seq
 230687762     gbest141.seq
 230688784     gbest142.seq
 230687912     gbest143.seq
 230687831     gbest144.seq
 230688489     gbest145.seq
 230689218     gbest146.seq
 230689658     gbest147.seq
 230687576     gbest148.seq
 230689086     gbest149.seq
 230688898     gbest15.seq
 230690315     gbest150.seq
 230690647     gbest151.seq
 230688187     gbest152.seq
 230688458     gbest153.seq
 230688925     gbest154.seq
 230688163     gbest155.seq
 230689493     gbest156.seq
 230687714     gbest157.seq
 230688621     gbest158.seq
 230690862     gbest159.seq
 230688202     gbest16.seq
 230690894     gbest160.seq
 230687486     gbest161.seq
 230689470     gbest162.seq
 230690580     gbest163.seq
 230689076     gbest164.seq
 230687466     gbest165.seq
 230688389     gbest166.seq
 230688041     gbest167.seq
 230689822     gbest168.seq
 230688247     gbest169.seq
 230688030     gbest17.seq
 230689296     gbest170.seq
 230689404     gbest171.seq
 230688442     gbest172.seq
 230691113     gbest173.seq
 230688209     gbest174.seq
 230688266     gbest175.seq
 230688979     gbest176.seq
 230688463     gbest177.seq
 228553702     gbest178.seq
 230689311     gbest179.seq
 230688207     gbest18.seq
 230688260     gbest180.seq
 230688638     gbest181.seq
 230687612     gbest182.seq
 230690038     gbest183.seq
 230688064     gbest184.seq
 230688823     gbest185.seq
 230689158     gbest186.seq
 230689895     gbest187.seq
 230690357     gbest188.seq
 230689664     gbest189.seq
 230688108     gbest19.seq
 230689913     gbest190.seq
 230689486     gbest191.seq
 230689146     gbest192.seq
 230688389     gbest193.seq
 230687871     gbest194.seq
 230689301     gbest195.seq
 230689166     gbest196.seq
 230688126     gbest197.seq
 230689264     gbest198.seq
 230689453     gbest199.seq
 230689444     gbest2.seq
 230687630     gbest20.seq
 230690565     gbest200.seq
 230688559     gbest201.seq
 230687859     gbest202.seq
 230689288     gbest203.seq
 230687646     gbest204.seq
 230688867     gbest205.seq
 230688655     gbest206.seq
 230689618     gbest207.seq
 230688156     gbest208.seq
 230688355     gbest209.seq
 230690274     gbest21.seq
 230688049     gbest210.seq
 230688462     gbest211.seq
 230689303     gbest212.seq
 230688628     gbest213.seq
 230688924     gbest214.seq
 230687702     gbest215.seq
 230689188     gbest216.seq
 230690288     gbest217.seq
 191310358     gbest218.seq
 162709328     gbest219.seq
 230689677     gbest22.seq
 163091807     gbest220.seq
 170943279     gbest221.seq
 169615103     gbest222.seq
 164377261     gbest223.seq
 165194000     gbest224.seq
 164761168     gbest225.seq
 163988985     gbest226.seq
 164607343     gbest227.seq
 164144907     gbest228.seq
 164160829     gbest229.seq
 230688136     gbest23.seq
 163045960     gbest230.seq
 168173205     gbest231.seq
 162626269     gbest232.seq
 162718008     gbest233.seq
 166747833     gbest234.seq
 168031029     gbest235.seq
 165913839     gbest236.seq
 165710270     gbest237.seq
 165395155     gbest238.seq
 165165380     gbest239.seq
 230689006     gbest24.seq
 164339397     gbest240.seq
 164188175     gbest241.seq
 164939479     gbest242.seq
 164657975     gbest243.seq
 179283300     gbest244.seq
 173315061     gbest245.seq
 180451588     gbest246.seq
 230688763     gbest247.seq
 230688210     gbest248.seq
 230688569     gbest249.seq
 230690305     gbest25.seq
 230687457     gbest250.seq
 230687688     gbest251.seq
 230687858     gbest252.seq
 230689323     gbest253.seq
 230690154     gbest254.seq
 230688510     gbest255.seq
 230687488     gbest256.seq
 230688296     gbest257.seq
 230688400     gbest258.seq
 230690128     gbest259.seq
 230687449     gbest26.seq
 230687858     gbest260.seq
 230689250     gbest261.seq
 230690257     gbest262.seq
 230689882     gbest263.seq
 230689730     gbest264.seq
 230689944     gbest265.seq
 230691339     gbest266.seq
 230688697     gbest267.seq
 230687937     gbest268.seq
 230687606     gbest269.seq
 230690270     gbest27.seq
 230688073     gbest270.seq
 230688602     gbest271.seq
 230688904     gbest272.seq
 230689036     gbest273.seq
 230688793     gbest274.seq
 225270512     gbest275.seq
 207005222     gbest276.seq
 230690417     gbest277.seq
 230689455     gbest278.seq
 230689003     gbest279.seq
 230687712     gbest28.seq
 230687796     gbest280.seq
 230688079     gbest281.seq
 230687821     gbest282.seq
 230688528     gbest283.seq
 230689396     gbest284.seq
 230687496     gbest285.seq
 230688884     gbest286.seq
 230690346     gbest287.seq
 230688992     gbest288.seq
 230689833     gbest289.seq
 230689357     gbest29.seq
 230687935     gbest290.seq
 230688263     gbest291.seq
 230688405     gbest292.seq
 230690491     gbest293.seq
 230689871     gbest294.seq
 230693097     gbest295.seq
 230689647     gbest296.seq
 230689690     gbest297.seq
 230687761     gbest298.seq
 230691783     gbest299.seq
 230687582     gbest3.seq
 230688009     gbest30.seq
 229916636     gbest300.seq
 230688243     gbest301.seq
 197088819     gbest302.seq
 230689927     gbest303.seq
 230690737     gbest304.seq
 230689254     gbest305.seq
 230688084     gbest306.seq
 230688574     gbest307.seq
 224159047     gbest308.seq
 143069612     gbest309.seq
 230689851     gbest31.seq
 211010411     gbest310.seq
 230690220     gbest311.seq
 230688453     gbest312.seq
 230688564     gbest313.seq
 230689499     gbest314.seq
 230690102     gbest315.seq
 230691827     gbest316.seq
 230689332     gbest317.seq
 230688445     gbest318.seq
 230687467     gbest319.seq
 230689822     gbest32.seq
 230688614     gbest320.seq
 230687634     gbest321.seq
 230692847     gbest322.seq
 230688961     gbest323.seq
 230690287     gbest324.seq
 230688824     gbest325.seq
 230689172     gbest326.seq
 230687477     gbest327.seq
 230688969     gbest328.seq
 230691134     gbest329.seq
 230689417     gbest33.seq
 230688540     gbest330.seq
 230690180     gbest331.seq
 230688112     gbest332.seq
 230689649     gbest333.seq
 230689616     gbest334.seq
 230689269     gbest335.seq
 230690125     gbest336.seq
 230689272     gbest337.seq
 230687612     gbest338.seq
 230688232     gbest339.seq
 230689604     gbest34.seq
 230690059     gbest340.seq
 230688703     gbest341.seq
 230691869     gbest342.seq
 230689879     gbest343.seq
 230688142     gbest344.seq
 230689317     gbest345.seq
 230688632     gbest346.seq
 230688957     gbest347.seq
 230692777     gbest348.seq
 230689160     gbest349.seq
 230688517     gbest35.seq
 230687447     gbest350.seq
 230688318     gbest351.seq
 222361875     gbest352.seq
 230689118     gbest353.seq
 230689564     gbest354.seq
 230689124     gbest355.seq
 230687838     gbest356.seq
 230690089     gbest357.seq
 230688931     gbest358.seq
 230689282     gbest359.seq
 230687733     gbest36.seq
 230692130     gbest360.seq
 230689894     gbest361.seq
 230688387     gbest362.seq
 230691300     gbest363.seq
 230691208     gbest364.seq
 230688128     gbest365.seq
 230691075     gbest366.seq
 230689158     gbest367.seq
 230692039     gbest368.seq
 230689882     gbest369.seq
 230687461     gbest37.seq
 230688530     gbest370.seq
 230688529     gbest371.seq
 230688414     gbest372.seq
 230690554     gbest373.seq
 230688297     gbest374.seq
 230690821     gbest375.seq
 230690985     gbest376.seq
 230688073     gbest377.seq
 230689932     gbest378.seq
 230689653     gbest379.seq
 230688017     gbest38.seq
 230687745     gbest380.seq
 230689758     gbest381.seq
 230690500     gbest382.seq
 230695311     gbest383.seq
 230689910     gbest384.seq
 230690622     gbest385.seq
 230697049     gbest386.seq
 230690783     gbest387.seq
 230689187     gbest388.seq
 230688966     gbest389.seq
 199328010     gbest39.seq
 230689500     gbest390.seq
 230689871     gbest391.seq
 230690844     gbest392.seq
 230690688     gbest393.seq
 230688522     gbest394.seq
 218289442     gbest395.seq
 230687793     gbest396.seq
 172618127     gbest397.seq
 230689771     gbest4.seq
 191753281     gbest40.seq
 202518090     gbest41.seq
 214681834     gbest42.seq
 216269223     gbest43.seq
 216190929     gbest44.seq
 216633861     gbest45.seq
 230688007     gbest46.seq
 230687762     gbest47.seq
 221621059     gbest48.seq
 230687934     gbest49.seq
 164512939     gbest5.seq
 230689000     gbest50.seq
 230689773     gbest51.seq
 230690649     gbest52.seq
 230689934     gbest53.seq
 230690612     gbest54.seq
 230688990     gbest55.seq
 230689848     gbest56.seq
 230688082     gbest57.seq
 230688272     gbest58.seq
 230689838     gbest59.seq
 177381218     gbest6.seq
 230688591     gbest60.seq
 230690624     gbest61.seq
 230690472     gbest62.seq
 230687879     gbest63.seq
 229553075     gbest64.seq
 209753634     gbest65.seq
 209190062     gbest66.seq
 208839723     gbest67.seq
 209097587     gbest68.seq
 210357949     gbest69.seq
 230689592     gbest7.seq
 209783445     gbest70.seq
 208630852     gbest71.seq
 209373022     gbest72.seq
 210508854     gbest73.seq
 206349334     gbest74.seq
 206706341     gbest75.seq
 208104789     gbest76.seq
 208557541     gbest77.seq
 215552257     gbest78.seq
 230692510     gbest79.seq
 230687624     gbest8.seq
 230690478     gbest80.seq
 230689918     gbest81.seq
 216529690     gbest82.seq
 214756165     gbest83.seq
 216948883     gbest84.seq
 230688414     gbest85.seq
 230687856     gbest86.seq
 230689925     gbest87.seq
 230688102     gbest88.seq
 230689510     gbest89.seq
 230689095     gbest9.seq
 230687836     gbest90.seq
 230688777     gbest91.seq
 230689813     gbest92.seq
 230690064     gbest93.seq
 230687504     gbest94.seq
 230688973     gbest95.seq
 230688052     gbest96.seq
 230691029     gbest97.seq
 230690587     gbest98.seq
 230689139     gbest99.seq
  46635954     gbgen.idx
 230688107     gbgss1.seq
 230687725     gbgss10.seq
 227235789     gbgss100.seq
 228620171     gbgss101.seq
 228716887     gbgss102.seq
 228639035     gbgss103.seq
 227787500     gbgss104.seq
 227476355     gbgss105.seq
 230688810     gbgss106.seq
 230687872     gbgss107.seq
 230688263     gbgss108.seq
 230687444     gbgss109.seq
 230688531     gbgss11.seq
 230689443     gbgss110.seq
 230689984     gbgss111.seq
 230687785     gbgss112.seq
 230688721     gbgss113.seq
 230689040     gbgss114.seq
 230687798     gbgss115.seq
 230689904     gbgss116.seq
 230689214     gbgss117.seq
  16727697     gbgss118.seq
 250000072     gbgss119.seq
 230689840     gbgss12.seq
 250000918     gbgss120.seq
 250002014     gbgss121.seq
 250001592     gbgss122.seq
 250001313     gbgss123.seq
 250000446     gbgss124.seq
 250000344     gbgss125.seq
 250002066     gbgss126.seq
 250003131     gbgss127.seq
 250003126     gbgss128.seq
 250003425     gbgss129.seq
 230688781     gbgss13.seq
 250000010     gbgss130.seq
 250000371     gbgss131.seq
 250001411     gbgss132.seq
 250000292     gbgss133.seq
 250001979     gbgss134.seq
 250000346     gbgss135.seq
 250002153     gbgss136.seq
 250000192     gbgss137.seq
 250000959     gbgss138.seq
 250001496     gbgss139.seq
 230689491     gbgss14.seq
 250002545     gbgss140.seq
 250002156     gbgss141.seq
 250001785     gbgss142.seq
 250000536     gbgss143.seq
 168081854     gbgss144.seq
 230689388     gbgss15.seq
 230690312     gbgss16.seq
 230689416     gbgss17.seq
 230688168     gbgss18.seq
 230691242     gbgss19.seq
 230689104     gbgss2.seq
 230687646     gbgss20.seq
 230688389     gbgss21.seq
 230688117     gbgss22.seq
 230689818     gbgss23.seq
 230688417     gbgss24.seq
 230690148     gbgss25.seq
 230688716     gbgss26.seq
 230689159     gbgss27.seq
 230690503     gbgss28.seq
 230688067     gbgss29.seq
 230688773     gbgss3.seq
 230689847     gbgss30.seq
 230689064     gbgss31.seq
 230688274     gbgss32.seq
 230690251     gbgss33.seq
 230688223     gbgss34.seq
 230689251     gbgss35.seq
 230689763     gbgss36.seq
 230689765     gbgss37.seq
 230689824     gbgss38.seq
 230687720     gbgss39.seq
 230688472     gbgss4.seq
 230687796     gbgss40.seq
 230689676     gbgss41.seq
 230688528     gbgss42.seq
 230687628     gbgss43.seq
 230689741     gbgss44.seq
 230689064     gbgss45.seq
 230690403     gbgss46.seq
 230688640     gbgss47.seq
 230687840     gbgss48.seq
 230688626     gbgss49.seq
 230689545     gbgss5.seq
 230688657     gbgss50.seq
 230687636     gbgss51.seq
 230690129     gbgss52.seq
 230688632     gbgss53.seq
 230689238     gbgss54.seq
 230689781     gbgss55.seq
 230689722     gbgss56.seq
 230688949     gbgss57.seq
 230689074     gbgss58.seq
 230688312     gbgss59.seq
 230688226     gbgss6.seq
 230689209     gbgss60.seq
 229550355     gbgss61.seq
 230687780     gbgss62.seq
 230688630     gbgss63.seq
 230688826     gbgss64.seq
 230688551     gbgss65.seq
 230687940     gbgss66.seq
 230689586     gbgss67.seq
 230689543     gbgss68.seq
 230688123     gbgss69.seq
 230690492     gbgss7.seq
 230688835     gbgss70.seq
 230688443     gbgss71.seq
 230687585     gbgss72.seq
 230688644     gbgss73.seq
 230687941     gbgss74.seq
 230688938     gbgss75.seq
 230688446     gbgss76.seq
 230689320     gbgss77.seq
 230688982     gbgss78.seq
 230689461     gbgss79.seq
 230690266     gbgss8.seq
 230687514     gbgss80.seq
 194290464     gbgss81.seq
 194642016     gbgss82.seq
 227293003     gbgss83.seq
 230688120     gbgss84.seq
 230687899     gbgss85.seq
 230687651     gbgss86.seq
 230688769     gbgss87.seq
 230688928     gbgss88.seq
 230688353     gbgss89.seq
 230689344     gbgss9.seq
 230687902     gbgss90.seq
 230688571     gbgss91.seq
 230687903     gbgss92.seq
 230687535     gbgss93.seq
 230687801     gbgss94.seq
 230689712     gbgss95.seq
 230689270     gbgss96.seq
 230688595     gbgss97.seq
 230687702     gbgss98.seq
 230687607     gbgss99.seq
 250000418     gbhtc1.seq
 250002703     gbhtc2.seq
 250003174     gbhtc3.seq
 250001551     gbhtc4.seq
 250002395     gbhtc5.seq
 250000290     gbhtc6.seq
  22663640     gbhtc7.seq
 250109557     gbhtg1.seq
 250131238     gbhtg10.seq
 250009200     gbhtg11.seq
 250008798     gbhtg12.seq
 250063546     gbhtg13.seq
 250280245     gbhtg14.seq
 250212351     gbhtg15.seq
 250041376     gbhtg16.seq
 250043860     gbhtg17.seq
 250106321     gbhtg18.seq
 250046945     gbhtg19.seq
 250059239     gbhtg2.seq
 250583467     gbhtg20.seq
 250267953     gbhtg21.seq
 250286406     gbhtg22.seq
 250197346     gbhtg23.seq
 250226398     gbhtg24.seq
 250247948     gbhtg25.seq
 250211770     gbhtg26.seq
 250093686     gbhtg27.seq
 250253958     gbhtg28.seq
 250241575     gbhtg29.seq
 250022419     gbhtg3.seq
 250011801     gbhtg30.seq
 250229465     gbhtg31.seq
 250075219     gbhtg32.seq
 250029593     gbhtg33.seq
 250286191     gbhtg34.seq
 250119281     gbhtg35.seq
 250180624     gbhtg36.seq
 250097627     gbhtg37.seq
 250179971     gbhtg38.seq
 250133143     gbhtg39.seq
 250167821     gbhtg4.seq
 250063417     gbhtg40.seq
 250280629     gbhtg41.seq
 250075696     gbhtg42.seq
 250238378     gbhtg43.seq
 250305179     gbhtg44.seq
 250045057     gbhtg45.seq
 250208484     gbhtg46.seq
 250247213     gbhtg47.seq
 250045357     gbhtg48.seq
 250045553     gbhtg49.seq
 250083826     gbhtg5.seq
 250055182     gbhtg50.seq
 250244779     gbhtg51.seq
 250004648     gbhtg52.seq
 250261280     gbhtg53.seq
 250211438     gbhtg54.seq
 250051223     gbhtg55.seq
 250124249     gbhtg56.seq
 250009898     gbhtg57.seq
 250205305     gbhtg58.seq
 250122401     gbhtg59.seq
 250210506     gbhtg6.seq
 250229317     gbhtg60.seq
 250059167     gbhtg61.seq
 250055857     gbhtg62.seq
 250124043     gbhtg63.seq
 250119013     gbhtg64.seq
  26125514     gbhtg65.seq
 250150190     gbhtg7.seq
 250072550     gbhtg8.seq
 250256560     gbhtg9.seq
 250079231     gbinv1.seq
 250346661     gbinv2.seq
 250001345     gbinv3.seq
 250007465     gbinv4.seq
 250002328     gbinv5.seq
 250002810     gbinv6.seq
 216977997     gbinv7.seq
1165360502     gbjou.idx
 250002495     gbmam1.seq
  71777791     gbmam2.seq
  16304530     gbnew.txt
 250000401     gbpat1.seq
 250002695     gbpat10.seq
 250002172     gbpat11.seq
 250000068     gbpat12.seq
 250000440     gbpat13.seq
 250000629     gbpat14.seq
 250004563     gbpat15.seq
 250002784     gbpat16.seq
 250000303     gbpat17.seq
  91995579     gbpat18.seq
 250000151     gbpat2.seq
 250001647     gbpat3.seq
 250000436     gbpat4.seq
 250005674     gbpat5.seq
 250020644     gbpat6.seq
 250000542     gbpat7.seq
 250001648     gbpat8.seq
 250000485     gbpat9.seq
  40415593     gbphg.seq
 250023914     gbpln1.seq
 250053436     gbpln10.seq
 250004369     gbpln11.seq
 250001548     gbpln12.seq
 250000273     gbpln13.seq
 250001795     gbpln14.seq
 250027589     gbpln15.seq
  98892021     gbpln16.seq
 250183998     gbpln2.seq
 250000487     gbpln3.seq
 250002217     gbpln4.seq
 250008704     gbpln5.seq
 250019283     gbpln6.seq
 250010566     gbpln7.seq
 286380636     gbpln8.seq
 269778888     gbpln9.seq
 250205471     gbpri1.seq
 250204151     gbpri10.seq
 250126277     gbpri11.seq
 250114686     gbpri12.seq
 250117529     gbpri13.seq
 250032315     gbpri14.seq
 250018695     gbpri15.seq
 250000136     gbpri16.seq
 250007265     gbpri17.seq
 250001943     gbpri18.seq
 250016132     gbpri19.seq
 250011821     gbpri2.seq
 250048265     gbpri20.seq
 250135243     gbpri21.seq
 250001177     gbpri22.seq
 250007584     gbpri23.seq
 250028748     gbpri24.seq
 250084573     gbpri25.seq
 250002128     gbpri26.seq
 250003120     gbpri27.seq
 212489426     gbpri28.seq
 250093884     gbpri3.seq
 250218049     gbpri4.seq
 250033374     gbpri5.seq
 250081125     gbpri6.seq
 250025514     gbpri7.seq
 250044103     gbpri8.seq
 250101424     gbpri9.seq
    188912     gbrel.txt
 250053858     gbrod1.seq
 250228075     gbrod10.seq
 250187986     gbrod11.seq
 250000096     gbrod12.seq
 250253800     gbrod13.seq
 250053618     gbrod14.seq
 250107656     gbrod15.seq
 250003294     gbrod16.seq
 250031602     gbrod17.seq
 226337322     gbrod18.seq
 250064338     gbrod2.seq
 250099600     gbrod3.seq
 250134909     gbrod4.seq
 250055076     gbrod5.seq
 250103400     gbrod6.seq
 250046964     gbrod7.seq
 250187068     gbrod8.seq
 250229255     gbrod9.seq
3618948876     gbsdr.txt
   1552108     gbsec.idx
 250000337     gbsts1.seq
 250002547     gbsts10.seq
 250000288     gbsts11.seq
 250000494     gbsts12.seq
 250001160     gbsts13.seq
   8757056     gbsts14.seq
 250000356     gbsts2.seq
 250000065     gbsts3.seq
 250002109     gbsts4.seq
 250001337     gbsts5.seq
 250003615     gbsts6.seq
 250001117     gbsts7.seq
 250003820     gbsts8.seq
 250001377     gbsts9.seq
 101203530     gbsyn.seq
    504040     gbuna.seq
 250001298     gbvrl1.seq
 250008632     gbvrl2.seq
 250001180     gbvrl3.seq
 250057230     gbvrl4.seq
  14445073     gbvrl5.seq
 250001471     gbvrt1.seq
 250080776     gbvrt2.seq
 250000015     gbvrt3.seq
 250044655     gbvrt4.seq
 250141537     gbvrt5.seq
 250012518     gbvrt6.seq
 250353261     gbvrt7.seq
 250001715     gbvrt8.seq
  80186922     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         26664      101088072
BCT10        38247      90955931
BCT11        14230      29324093
BCT2         7595       107027017
BCT3         463        114552258
BCT4         27625      103505191
BCT5         30148      96691977
BCT6         62752      88303007
BCT7         7037       113146296
BCT8         531        94066964
BCT9         3215       108245254
ENV1         97610      71522493
ENV2         49067      42111079
EST1         68120      26287999
EST10        76551      29777005
EST100       71659      47331703
EST101       70084      43424166
EST102       73328      44294259
EST103       71275      30869153
EST104       70621      30374209
EST105       65669      36911858
EST106       68035      37213126
EST107       69108      45257899
EST108       73983      31621346
EST109       75228      34976790
EST11        74768      28648170
EST110       74908      27372600
EST111       73963      35580028
EST112       71941      34855270
EST113       69180      40571008
EST114       80246      44367337
EST115       76544      46315848
EST116       68457      43140439
EST117       67250      43096940
EST118       74351      49790480
EST119       70080      42772975
EST12        77401      30639736
EST120       74787      43102987
EST121       74027      46560382
EST122       72002      47864574
EST123       73938      51665047
EST124       78950      39034837
EST125       76139      30886903
EST126       78932      41145531
EST127       78290      41902160
EST128       76338      47664125
EST129       60649      28317049
EST13        76282      29157393
EST130       72330      38372820
EST131       67385      39680315
EST132       67148      36168617
EST133       71399      43809033
EST134       72950      44499542
EST135       67491      39106708
EST136       72894      41541018
EST137       70301      43265540
EST138       62732      39011965
EST139       76902      41968874
EST14        78057      31443273
EST140       99570      54444351
EST141       67996      37823627
EST142       103656     54533546
EST143       110110     58793209
EST144       100927     56039347
EST145       82676      48700881
EST146       88951      49863743
EST147       95913      58956108
EST148       98490      59210065
EST149       76744      43791286
EST15        74364      31405618
EST150       69339      36738691
EST151       63717      28498782
EST152       56259      25905045
EST153       63408      30741788
EST154       59841      30760658
EST155       64601      34665469
EST156       76488      53176058
EST157       63968      43919986
EST158       80830      47405554
EST159       61581      31584579
EST16        75777      33355322
EST160       61699      31186472
EST161       66869      40928365
EST162       65638      32858736
EST163       63979      46615505
EST164       83148      43687889
EST165       94393      45232869
EST166       94115      55922526
EST167       102787     59610329
EST168       95781      53450750
EST169       95468      43077389
EST17        81616      33405778
EST170       91949      43886310
EST171       93779      45233231
EST172       90422      36522722
EST173       88680      42416368
EST174       64513      44572292
EST175       70692      37843147
EST176       57661      34250551
EST177       71534      43102812
EST178       72589      26536776
EST179       75654      45909732
EST18        80785      32719057
EST180       74985      37803874
EST181       68004      34403370
EST182       68374      40574003
EST183       70151      52942930
EST184       69208      38709017
EST185       67849      33755764
EST186       69791      55052830
EST187       68244      44517307
EST188       72769      37099635
EST189       68810      48653142
EST19        78746      31493979
EST190       70265      57308297
EST191       64585      47975102
EST192       64520      47059293
EST193       64998      47477601
EST194       65166      45865696
EST195       66432      50566351
EST196       62782      39457538
EST197       63972      35329937
EST198       63140      36282355
EST199       71366      40780171
EST2         74809      28707246
EST20        74116      30816830
EST200       92624      53520877
EST201       69021      47154755
EST202       94412      57003389
EST203       107186     66143325
EST204       108690     64389084
EST205       107353     65161998
EST206       103095     66959190
EST207       118523     55797106
EST208       101544     60749905
EST209       110794     49508984
EST21        74470      34190059
EST210       86529      47863972
EST211       69410      38647009
EST212       68997      58131988
EST213       68222      59211981
EST214       80115      40296905
EST215       81061      44781549
EST216       74649      52854332
EST217       72240      50290556
EST218       43072      21244291
EST219       27821      10564022
EST22        74009      29716264
EST220       27739      10242000
EST221       26390      9803971
EST222       26686      9006263
EST223       27546      9756124
EST224       27223      10084316
EST225       27206      9768481
EST226       27360      10244195
EST227       27141      12096192
EST228       27240      11299892
EST229       27352      10142795
EST23        77324      32932723
EST230       27636      9309562
EST231       26889      9197750
EST232       27809      11277776
EST233       27814      10812359
EST234       27128      11354017
EST235       26651      11932582
EST236       27094      11390571
EST237       27080      10908971
EST238       27051      11522721
EST239       27167      11556532
EST24        74246      32217079
EST240       27294      11182236
EST241       27297      10833837
EST242       27216      10575551
EST243       27274      10825698
EST244       24685      17278872
EST245       25631      17076348
EST246       40304      19121364
EST247       108862     40795248
EST248       72902      41165900
EST249       68673      44539809
EST25        74626      32505243
EST250       69358      44556131
EST251       69185      44320701
EST252       67002      39291741
EST253       74731      43463707
EST254       64637      48230306
EST255       65057      33874879
EST256       76481      38121742
EST257       102482     47331514
EST258       75165      42444419
EST259       67009      34235468
EST26        74312      30365381
EST260       67975      32841445
EST261       70463      42307044
EST262       73313      34520681
EST263       70908      35861893
EST264       73006      46620663
EST265       63125      33780886
EST266       67606      37349924
EST267       83637      44128312
EST268       75837      42341616
EST269       79735      52403175
EST27        74827      32506654
EST270       77692      53703767
EST271       112478     49433307
EST272       80895      42269720
EST273       73943      46360384
EST274       72747      39110002
EST275       72419      37585450
EST276       69871      27347444
EST277       68814      41445750
EST278       62730      35148067
EST279       64639      41486593
EST28        106860     50550021
EST280       70619      40588714
EST281       64241      44387262
EST282       63096      32230253
EST283       81427      43121616
EST284       83651      44328068
EST285       81580      50307999
EST286       109209     54368694
EST287       117138     48234593
EST288       73268      35611659
EST289       67670      36762048
EST29        97907      45907095
EST290       71396      46840628
EST291       81191      39714658
EST292       69967      41935409
EST293       71340      41523180
EST294       60262      34457835
EST295       52572      31529593
EST296       68876      43905776
EST297       69625      44629474
EST298       68369      42737030
EST299       70186      40681430
EST3         73670      29894145
EST30        98226      53437358
EST300       76760      38197244
EST301       73011      49675355
EST302       69672      36957539
EST303       71303      46814989
EST304       66968      53329090
EST305       62345      47581275
EST306       64917      38612463
EST307       67385      42551850
EST308       69911      44352200
EST309       47977      24017004
EST31        75718      38178867
EST310       61971      32925020
EST311       71191      37748175
EST312       57986      28777893
EST313       66907      41863439
EST314       70578      42273416
EST315       81086      41186454
EST316       63706      37595016
EST317       75703      45660026
EST318       67147      43098413
EST319       74686      46041315
EST32        66355      62892955
EST320       85082      49291083
EST321       91132      49876647
EST322       65479      34852856
EST323       60558      38536529
EST324       77374      37950497
EST325       52151      28826707
EST326       56804      31157689
EST327       70478      40367721
EST328       88588      47032083
EST329       86452      43677246
EST33        81235      47957211
EST330       69693      47115681
EST331       79160      53827224
EST332       65096      37083501
EST333       67723      34943453
EST334       85158      38991506
EST335       60699      39077291
EST336       50690      36550094
EST337       65701      36351700
EST338       86451      52789419
EST339       89930      49573623
EST34        91292      44786436
EST340       68587      39818582
EST341       80291      41124406
EST342       48248      30227726
EST343       44259      23141822
EST344       75765      48952119
EST345       80376      39707775
EST346       78172      47661634
EST347       74092      38903442
EST348       62679      41484625
EST349       71135      39348069
EST35        85056      45875728
EST350       59878      36274790
EST351       73732      31924537
EST352       79982      25696253
EST353       68381      40343183
EST354       68019      38361993
EST355       70797      37817138
EST356       79238      47347385
EST357       65046      45389086
EST358       73742      43853105
EST359       61591      34275805
EST36        99712      46048781
EST360       70399      42525122
EST361       77566      50081797
EST362       82971      48489230
EST363       70839      42262844
EST364       59410      42013294
EST365       57526      41659871
EST366       57574      41217907
EST367       64456      39915473
EST368       72313      43337281
EST369       57988      36245953
EST37        97572      50023360
EST370       57921      38482039
EST371       59311      40729773
EST372       60451      42008869
EST373       55508      41637832
EST374       46822      33411246
EST375       83375      39000226
EST376       52345      40722474
EST377       66517      46431422
EST378       67542      38032168
EST379       65253      40701780
EST38        103249     47219823
EST380       120346     60200595
EST381       77808      48412073
EST382       78281      57171018
EST383       38086      21279286
EST384       51684      56670468
EST385       48183      58044223
EST386       65339      45900951
EST387       72938      42635282
EST388       71021      43823654
EST389       66867      43565792
EST39        72890      22973757
EST390       77319      33387726
EST391       70059      25566021
EST392       73079      27282210
EST393       73957      26161094
EST394       76511      27326926
EST395       72352      24991487
EST396       71161      29317326
EST397       57194      21042344
EST4         74044      28188819
EST40        68914      18328634
EST41        78040      22664316
EST42        43618      12147690
EST43        43326      11779338
EST44        42992      12023052
EST45        43026      11258680
EST46        96445      42627733
EST47        94407      43779636
EST48        90848      47635534
EST49        86077      39424937
EST5         48459      15407185
EST50        106817     56705020
EST51        92485      44456592
EST52        74469      31439025
EST53        68534      30503510
EST54        71031      30757683
EST55        72830      30458823
EST56        82553      33072151
EST57        72971      28312140
EST58        63909      27930792
EST59        72180      31539734
EST6         55072      17488108
EST60        75558      35594373
EST61        73092      32008324
EST62        76076      27279410
EST63        79200      30811884
EST64        72808      31775916
EST65        40086      11445647
EST66        40088      11311395
EST67        40249      12626379
EST68        40521      12251779
EST69        40501      12464413
EST7         74129      29185232
EST70        40413      12897723
EST71        40422      12522630
EST72        40247      12081148
EST73        40269      12320636
EST74        41081      12227149
EST75        41201      12365223
EST76        41124      13072758
EST77        40924      12989600
EST78        43521      12465320
EST79        43488      20022563
EST8         75475      30478019
EST80        40732      24679120
EST81        42659      18431985
EST82        49826      21345614
EST83        50973      21395731
EST84        49875      21862936
EST85        72941      31972425
EST86        73954      28680340
EST87        72505      29735024
EST88        76838      43029179
EST89        77717      40885936
EST9         77491      29868758
EST90        75659      41897926
EST91        78092      34781473
EST92        71558      42693940
EST93        72244      36648250
EST94        75192      39042425
EST95        70642      37396263
EST96        76789      44753523
EST97        69736      39812153
EST98        69387      35250456
EST99        73463      34869799
GSS1         90830      38840325
GSS10        75206      43834733
GSS100       75212      41059945
GSS101       73602      45108630
GSS102       73487      45397443
GSS103       73577      45171185
GSS104       73248      44908249
GSS105       73550      44099486
GSS106       80755      53471685
GSS107       85945      58093475
GSS108       81303      53501293
GSS109       84497      53070253
GSS11        69996      35692760
GSS110       84988      50873645
GSS111       81004      65397777
GSS112       92395      43070580
GSS113       91919      54309323
GSS114       74137      48104664
GSS115       88263      64893392
GSS116       80050      51966745
GSS117       75406      49632912
GSS118       6725       3070419
GSS119       87186      64735440
GSS12        73602      38703339
GSS120       83935      63019590
GSS121       101315     46890949
GSS122       68987      58741465
GSS123       68486      58900409
GSS124       69543      56767222
GSS125       69807      56256256
GSS126       70545      55626531
GSS127       86106      73157964
GSS128       85147      41145094
GSS129       70900      47111306
GSS13        76603      38828632
GSS130       110664     72686395
GSS131       85620      36024855
GSS132       90317      68161536
GSS133       73102      60784188
GSS134       70488      59255772
GSS135       66160      63490090
GSS136       77503      57245413
GSS137       121253     73516762
GSS138       118587     76239211
GSS139       104445     58594833
GSS14        71650      32201312
GSS140       87258      55418188
GSS141       97210      56407517
GSS142       79406      44052823
GSS143       98949      64322550
GSS144       68495      31169400
GSS15        71086      35441254
GSS16        77507      45686526
GSS17        71228      33510360
GSS18        57979      27843556
GSS19        57001      28963862
GSS2         89386      39537365
GSS20        57915      26502413
GSS21        62239      31416422
GSS22        64364      36076679
GSS23        57734      26984473
GSS24        67882      43045055
GSS25        66749      27450949
GSS26        58232      25663358
GSS27        67954      32485197
GSS28        63014      32542480
GSS29        81089      40672773
GSS3         87699      41940140
GSS30        81280      39914030
GSS31        74482      40453148
GSS32        70617      48527552
GSS33        79978      37722016
GSS34        76202      40335393
GSS35        75284      40076535
GSS36        87594      58177141
GSS37        87583      58192851
GSS38        85714      44767061
GSS39        84741      48507593
GSS4         79302      41207098
GSS40        88426      37648164
GSS41        82336      36334432
GSS42        81277      56890790
GSS43        79117      57053348
GSS44        72241      47667100
GSS45        72251      47598633
GSS46        78280      44955865
GSS47        78172      40525870
GSS48        83990      58703719
GSS49        86274      67735239
GSS5         79041      40731400
GSS50        83779      51530385
GSS51        93222      60183869
GSS52        87653      57321998
GSS53        74724      39810038
GSS54        76088      44765936
GSS55        85984      45327428
GSS56        87644      57687353
GSS57        75738      69473941
GSS58        72279      78907099
GSS59        89418      68082593
GSS6         78254      38894764
GSS60        85002      56288785
GSS61        63608      45418536
GSS62        71007      49146092
GSS63        89658      67264637
GSS64        86292      56740883
GSS65        87515      54644266
GSS66        87448      56612904
GSS67        97902      58021877
GSS68        100639     54495632
GSS69        100833     54248472
GSS7         77539      39418763
GSS70        101256     53713400
GSS71        102445     52204338
GSS72        102244     52457905
GSS73        102706     51873146
GSS74        102120     52615559
GSS75        97729      57973249
GSS76        90121      70212028
GSS77        89836      70779239
GSS78        87901      69540084
GSS79        87819      69686487
GSS8         76331      38106216
GSS80        88911      61596013
GSS81        79916      21971523
GSS82        78051      24611364
GSS83        89843      37208310
GSS84        84388      51170737
GSS85        81031      51775476
GSS86        89748      64981511
GSS87        77441      62868973
GSS88        78840      79267400
GSS89        76917      55077765
GSS9         72576      37287310
GSS90        94598      49290186
GSS91        75069      40308494
GSS92        85911      52282976
GSS93        72008      59734425
GSS94        85704      53044600
GSS95        82838      60644850
GSS96        87219      57700740
GSS97        83897      56056740
GSS98        88543      58255806
GSS99        80577      63755679
HTC1         32150      55611252
HTC2         31636      66259760
HTC3         75197      40605663
HTC4         78495      71501582
HTC5         88003      82548838
HTC6         70897      96781356
HTC7         3773       9642788
HTG1         1317       188906440
HTG10        1240       186631208
HTG11        1429       184128870
HTG12        884        191847818
HTG13        751        192271968
HTG14        741        192392029
HTG15        776        192307789
HTG16        802        192004940
HTG17        766        192210840
HTG18        1991       172300389
HTG19        956        189542721
HTG2         2563       186021293
HTG20        1184       186796041
HTG21        785        192070821
HTG22        895        190715809
HTG23        892        191030479
HTG24        845        191105384
HTG25        768        192244591
HTG26        846        191572919
HTG27        862        191391532
HTG28        920        190587618
HTG29        935        190412440
HTG3         2449       185332304
HTG30        960        190293544
HTG31        871        191390266
HTG32        842        191698217
HTG33        983        189657813
HTG34        871        191443900
HTG35        864        191448401
HTG36        815        192050979
HTG37        957        189945146
HTG38        947        190884545
HTG39        941        190460140
HTG4         2529       188498207
HTG40        1040       189405878
HTG41        1204       187096880
HTG42        1265       188255216
HTG43        1161       188749165
HTG44        1167       187304832
HTG45        1091       191578721
HTG46        1217       191058998
HTG47        1241       191266172
HTG48        1176       191246655
HTG49        1156       190824262
HTG5         1281       185666662
HTG50        1106       190399028
HTG51        1146       189868996
HTG52        1438       188167836
HTG53        1505       187950158
HTG54        1270       189990080
HTG55        1393       189146518
HTG56        1498       187531290
HTG57        1400       188350863
HTG58        1136       192699435
HTG59        1191       191143480
HTG6         1274       185376276
HTG60        1460       188721861
HTG61        1054       193939310
HTG62        1024       193939416
HTG63        1039       193732937
HTG64        1021       190472340
HTG65        86         15436436
HTG7         1247       185590985
HTG8         1288       184967388
HTG9         1184       187271351
INV1         16025      164186392
INV2         1625       166905604
INV3         36770      113722932
INV4         74454      75366928
INV5         78995      73164596
INV6         41301      106055548
INV7         39867      88001603
MAM1         56018      110589561
MAM2         18859      25315921
PAT1         222992     70284635
PAT10        120456     49142420
PAT11        95772      59599231
PAT12        141786     56093795
PAT13        146764     60898774
PAT14        138575     94136863
PAT15        116090     112705379
PAT16        109755     112694745
PAT17        129180     84201697
PAT18        81670      23197205
PAT2         194348     84711886
PAT3         171908     95947517
PAT4         149245     105447674
PAT5         141910     87814164
PAT6         113021     112456929
PAT7         142254     93631405
PAT8         132678     95529170
PAT9         135112     83229998
PHG          2584       16172659
PLN1         33345      123907235
PLN10        19824      137911829
PLN11        63867      68572945
PLN12        78327      78010321
PLN13        67813      80854457
PLN14        25738      130160302
PLN15        41122      112835169
PLN16        16186      40219003
PLN2         1375       177015036
PLN3         13849      150837082
PLN4         77635      77706690
PLN5         64462      64712097
PLN6         30513      63443689
PLN7         1261       165354355
PLN8         1018       205657850
PLN9         7          212935788
PRI1         18634      149385103
PRI10        1414       180883745
PRI11        1294       178380473
PRI12        1562       179683036
PRI13        1628       178784975
PRI14        1429       187447022
PRI15        23855      151800300
PRI16        43658      94626270
PRI17        15591      144147638
PRI18        1602       184080977
PRI19        1749       183151062
PRI2         1448       174545815
PRI20        2097       181376655
PRI21        1618       185719152
PRI22        31680      137489468
PRI23        45028      78209667
PRI24        19361      129099550
PRI25        14944      166169746
PRI26        35823      137765011
PRI27        35128      133297064
PRI28        51101      83417564
PRI3         1277       185784885
PRI4         1338       184728398
PRI5         1183       180181225
PRI6         1226       180152200
PRI7         1220       179417165
PRI8         1372       175005827
PRI9         1257       178793503
ROD1         8638       170482033
ROD10        1029       185328237
ROD11        986        185138517
ROD12        11257      170902699
ROD13        17578      161164555
ROD14        1208       191541995
ROD15        1236       193985625
ROD16        30603      129212136
ROD17        22822      105143746
ROD18        45994      99144023
ROD2         922        174109587
ROD3         900        174295122
ROD4         914        174875480
ROD5         954        175675737
ROD6         964        180169922
ROD7         980        181034156
ROD8         1001       182095155
ROD9         990        182269276
STS1         82037      35577071
STS10        58200      44465512
STS11        57993      43684355
STS12        77653      37939409
STS13        88694      38900528
STS14        4211       2331244
STS2         83808      43759687
STS3         78693      32136181
STS4         64147      33083130
STS5         54894      31906223
STS6         54698      32307628
STS7         54687      32221872
STS8         56532      39200433
STS9         58082      44557841
SYN          23186      31916065
UNA          258        133962
VRL1         72482      65503098
VRL2         72073      66421912
VRL3         72197      68573507
VRL4         74381      65935823
VRL5         2904       5176705
VRT1         57543      106015479
VRT2         15694      167026053
VRT3         74364      79962371
VRT4         30044      89981467
VRT5         1211       193460577
VRT6         1275       193122912
VRT7         11851      176724512
VRT8         18697      167370893
VRT9         24005      24364266


2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 148.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries       Bases   Species

8537604 11153242715   Homo sapiens
6217008  7313249665   Mus musculus
1006680  5664433977   Rattus norvegicus
819469   2095578811   Danio rerio
2483113  1648296285   Zea mays
1106194  1217825580   Bos taurus
354166   1165697523   Oryza sativa (japonica cultivar-group)
1027667   834732630   Xenopus tropicalis
1407457   804586343   Canis familiaris
530176    780868928   Drosophila melanogaster
975659    643918429   Arabidopsis thaliana
728072    634736291   Gallus gallus
207582    521015600   Pan troglodytes
784408    462499524   Sorghum bicolor
693241    418469565   Ciona intestinalis
604016    404725937   Sus scrofa
596254    404126997   Brassica oleracea
387679    394376871   Medicago truncatula
58519     378392579   Macaca mulatta
598460    335827355   Triticum aestivum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 October 2005

                NCBI-GenBank Flat File Release 148.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 148.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
	Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
	Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
	Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
	Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Tony Stearman

User Support
	Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
	Renata Geer, Chuong Huynh, Scott McGinnis, Donna Messersmith, Rana Morris,
	Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center