Release Notes For GenBank Release 149

GBREL.TXT          Genetic Sequence Data Bank
                         August 15 2005

               NCBI-GenBank Flat File Release 149.0

                    Distribution Release Notes

 46947388 loci, 51674486881 bases, from 46947388 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 149.0
1.2 Cutoff Date
1.3 Important Changes in Release 149.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 149.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 149.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.

1.2 Cutoff Date

  This full release, 149.0, incorporates data available to the collaborating
databases as of August 15, 2005 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 149.0

1.3.0 GenBank Exceeds 100 Gigabases!

  GenBank reaches a milestone with 149.0, exceeding 100 gigabases of sequence
data. It is interesting to note that the Whole Genome Shotgun (WGS) portion
of the database has grown to exceed the non-WGS portion in just 3.5 years.

1.3.1 Problems generating accession number and keyword indexes

  Continuing software problems again prevented the generation of
the gbacc.idx and gbkey.idx 'index' files which normally accompany
GenBank releases.

  A version of gbacc.idx was built manually. However, the first field
contains just an accession number rather than Accession.Version .

  The gbkey.idx index could not be created without substantial
additional delays in release processing, so it is completely absent
from 149.0 .

  Our apologies for any inconvenience that this may cause.

1.3.2 Organizational changes

  The total number of sequence data files increased by 25 with this release:

  - the EST division is now comprised of 413 files (+16)
  - the GSS division is now comprised of 151 files (+7)
  - the HTG division is now comprised of  68 files (+3)
  - the PRI division is now comprised of  29 files (+1)
  - the ROD division is now comprised of  20 files (+2)

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
twenty-seven of the GSS flatfiles in Release 149.0. Consider gbgss125.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                           August 15 2005

                NCBI-GenBank Flat File Release 149.0

                           GSS Sequences (Part 1)

   87189 loci,    64730609 bases, from    87189 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "125" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

  Several changes related to the Feature Table were agreed to during the
May 2005 collaborative meeting among DDBJ, EMBL, and GenBank. The descriptions
of the changes provided below are preliminary; complete definitions will appear
in future release notes.

1.4.1 New qualifiers for the source feature

  A set of five new source feature qualifiers will be legal as of the
October 2005 release.

    /lat_lon : GPS coordinates for the location at which a specimen,
               from which the sequence was obtained, was collected.
               Format: Decimal degrees (N/S, E/W). 

    /collected_by : Name of the person who collected the specimen.

    /collection_date : Date that the specimen was collected. 
               Format: DD-MMM-YYYY (two-digit month, three letter
               month abbreviation, 4-digit year)

    /identified_by : Name of the person who identified the specimen.

    /PCR_primers="fwd_name: XXX, fwd_seq: aaatttgggccc"
                  rev_name: YYY, rev_seq: gggcccaaattt"

Four separate primer-related qualifiers were initially proposed
(and announced), but in subsequent discussion it was decided to
combine them into a single structured /PCR_primers qualifier.

fwd_seq and rev_seq are mandatory, and their values must be from
the IUPAC nucleotide alphabet. fwd_name and rev_name are both
optional. The primer names (if present) must be a single token,
without whitespace.

The order of the elements within the /PCR_primers must always be
as shown above. Multiple /PCR_primers qualifiers may exist on a
source feature.

  These qualifiers will most likely see their first use in association
with environmental sampling projects and the BarCode project.

1.4.2 : /evidence qualifer to be replaced 

  Two new qualifiers designed to replace /evidence will be legal as
of the October 2005 GenBank release : /experiment and /inference .

  The current /evidence="not_experimental" qualifier will be replaced
by /inference . The /inference values will be from a controlled list
which is intended to capture several different classes of inferential
methods.

  The current /evidence="experimental" qualifier will be replaced
by /experiment. This will be a free-text qualifier in which a brief
description of the nature of the bench experiment which supports
the associated feature can be provided by the submittor.

1.4.3 New /organelle qualifier value

  As of the October 2005 GenBank release, a new value for the /organelle
qualifier will be legal : hydrogenosome 

  This will support the annotation of sequences from anaerobic protozoa
and fungi, for which the hydrogenosome has a role in anaerobic respiration. 

1.4.4 Two new CDS qualifiers

  As of the October 2005 GenBank release, two new CDS feature qualifiers
will be introduced:

	/trans_splicing
	/ribosomal_slippage

  Coding regions involved in such processes will be more easily identified
with the addition of these qualifiers.

1.4.5 New /exception qualifier value

  Coding regions for which the conceptual protein translation differs from
the supplied /translation qualifier are flagged with an /exception 
qualifier. The value :

	"rearrangement required for product"

will be legal for this qualifier as of the October 2005 GenBank release.

1.4.6 : /repeat_unit qualifer to be replaced 

  Two new qualifiers designed to replace /repeat_unit will be legal as
of the October 2005 GenBank release : /repeat_unit_seq and /repeat_unit_range .

  The current qualifier accomodates both integer ranges (eg: "10..20") and
characters that represent a repeat unit pattern (eg: (AT)2(AA)5 ). Introducing
a distinct qualifier for each of these representations will make it easier
to submit and validate them.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

  The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 816 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut28.idx - Index of the entries according to accession number, part 28.
23. gbaut29.idx - Index of the entries according to accession number, part 29.
24. gbaut3.idx - Index of the entries according to accession number, part 3.
25. gbaut30.idx - Index of the entries according to accession number, part 30.
26. gbaut31.idx - Index of the entries according to accession number, part 31.
27. gbaut4.idx - Index of the entries according to accession number, part 4.
28. gbaut5.idx - Index of the entries according to accession number, part 5.
29. gbaut6.idx - Index of the entries according to accession number, part 6.
30. gbaut7.idx - Index of the entries according to accession number, part 7.
31. gbaut8.idx - Index of the entries according to accession number, part 8.
32. gbaut9.idx - Index of the entries according to accession number, part 9.
33. gbbct1.seq - Bacterial sequence entries, part 1.
34. gbbct10.seq - Bacterial sequence entries, part 10.
35. gbbct11.seq - Bacterial sequence entries, part 11.
36. gbbct2.seq - Bacterial sequence entries, part 2.
37. gbbct3.seq - Bacterial sequence entries, part 3.
38. gbbct4.seq - Bacterial sequence entries, part 4.
39. gbbct5.seq - Bacterial sequence entries, part 5.
40. gbbct6.seq - Bacterial sequence entries, part 6.
41. gbbct7.seq - Bacterial sequence entries, part 7.
42. gbbct8.seq - Bacterial sequence entries, part 8.
43. gbbct9.seq - Bacterial sequence entries, part 9.
44. gbchg.txt - Accession numbers of entries updated since the previous release.
45. gbcon.seq - Constructed sequence entries.
46. gbdel.txt - Accession numbers of entries deleted since the previous release.
47. gbenv1.seq - Environmental sampling sequence entries, part 1.
48. gbenv2.seq - Environmental sampling sequence entries, part 2.
49. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
50. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
51. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
52. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
53. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
54. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
55. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
56. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
57. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
58. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
59. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
60. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
61. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
62. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
63. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
64. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
65. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
66. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
67. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
68. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
69. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
70. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
71. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
72. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
73. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
74. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
75. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
76. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
77. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
78. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
79. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
80. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
81. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
82. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
83. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
84. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
85. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
86. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
87. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
88. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
89. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
90. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
91. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
92. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
93. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
94. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
95. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
96. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
97. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
98. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
99. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
100. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
101. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
102. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
103. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
104. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
105. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
106. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
107. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
108. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
109. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
110. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
111. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
112. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
113. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
114. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
115. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
116. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
117. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
118. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
119. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
120. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
121. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
122. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
123. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
124. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
125. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
126. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
127. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
128. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
129. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
130. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
131. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
132. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
133. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
134. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
135. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
136. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
137. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
138. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
139. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
140. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
141. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
142. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
143. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
144. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
145. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
146. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
147. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
148. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
149. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
150. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
151. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
152. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
153. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
154. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
155. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
156. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
157. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
158. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
159. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
160. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
161. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
162. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
163. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
164. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
165. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
166. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
167. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
168. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
169. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
170. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
171. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
172. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
173. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
174. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
175. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
176. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
177. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
178. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
179. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
180. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
181. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
182. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
183. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
184. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
185. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
186. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
187. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
188. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
189. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
190. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
191. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
192. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
193. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
194. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
195. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
196. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
197. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
198. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
199. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
200. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
201. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
202. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
203. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
204. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
205. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
206. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
207. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
208. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
209. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
210. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
211. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
212. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
213. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
214. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
215. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
216. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
217. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
218. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
219. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
220. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
221. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
222. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
223. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
224. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
225. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
226. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
227. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
228. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
229. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
230. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
231. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
232. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
233. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
234. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
235. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
236. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
237. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
238. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
239. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
240. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
241. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
242. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
243. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
244. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
245. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
246. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
247. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
248. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
249. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
250. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
251. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
252. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
253. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
254. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
255. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
256. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
257. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
258. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
259. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
260. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
261. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
262. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
263. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
264. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
265. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
266. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
267. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
268. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
269. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
270. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
271. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
272. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
273. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
274. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
275. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
276. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
277. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
278. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
279. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
280. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
281. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
282. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
283. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
284. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
285. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
286. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
287. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
288. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
289. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
290. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
291. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
292. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
293. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
294. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
295. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
296. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
297. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
298. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
299. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
300. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
301. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
302. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
303. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
304. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
305. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
306. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
307. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
308. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
309. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
310. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
311. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
312. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
313. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
314. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
315. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
316. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
317. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
318. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
319. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
320. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
321. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
322. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
323. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
324. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
325. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
326. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
327. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
328. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
329. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
330. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
331. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
332. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
333. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
334. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
335. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
336. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
337. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
338. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
339. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
340. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
341. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
342. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
343. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
344. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
345. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
346. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
347. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
348. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
349. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
350. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
351. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
352. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
353. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
354. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
355. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
356. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
357. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
358. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
359. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
360. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
361. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
362. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
363. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
364. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
365. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
366. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
367. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
368. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
369. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
370. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
371. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
372. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
373. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
374. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
375. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
376. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
377. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
378. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
379. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
380. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
381. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
382. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
383. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
384. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
385. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
386. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
387. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
388. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
389. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
390. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
391. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
392. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
393. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
394. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
395. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
396. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
397. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
398. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
399. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
400. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
401. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
402. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
403. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
404. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
405. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
406. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
407. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
408. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
409. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
410. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
411. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
412. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
413. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
414. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
415. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
416. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
417. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
418. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
419. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
420. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
421. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
422. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
423. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
424. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
425. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
426. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
427. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
428. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
429. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
430. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
431. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
432. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
433. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
434. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
435. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
436. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
437. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
438. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
439. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
440. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
441. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
442. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
443. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
444. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
445. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
446. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
447. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
448. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
449. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
450. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
451. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
452. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
453. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
454. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
455. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
456. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
457. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
458. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
459. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
460. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
461. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
462. gbgen.idx - Index of the entries according to gene symbols.
463. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
464. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
465. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
466. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
467. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
468. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
469. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
470. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
471. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
472. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
473. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
474. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
475. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
476. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
477. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
478. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
479. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
480. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
481. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
482. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
483. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
484. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
485. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
486. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
487. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
488. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
489. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
490. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
491. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
492. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
493. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
494. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
495. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
496. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
497. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
498. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
499. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
500. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
501. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
502. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
503. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
504. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
505. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
506. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
507. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
508. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
509. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
510. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
511. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
512. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
513. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
514. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
515. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
516. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
517. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
518. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
519. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
520. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
521. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
522. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
523. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
524. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
525. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
526. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
527. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
528. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
529. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
530. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
531. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
532. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
533. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
534. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
535. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
536. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
537. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
538. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
539. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
540. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
541. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
542. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
543. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
544. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
545. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
546. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
547. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
548. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
549. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
550. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
551. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
552. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
553. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
554. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
555. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
556. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
557. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
558. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
559. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
560. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
561. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
562. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
563. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
564. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
565. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
566. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
567. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
568. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
569. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
570. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
571. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
572. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
573. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
574. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
575. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
576. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
577. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
578. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
579. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
580. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
581. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
582. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
583. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
584. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
585. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
586. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
587. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
588. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
589. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
590. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
591. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
592. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
593. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
594. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
595. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
596. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
597. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
598. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
599. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
600. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
601. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
602. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
603. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
604. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
605. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
606. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
607. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
608. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
609. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
610. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
611. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
612. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
613. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
614. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
615. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
616. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
617. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
618. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
619. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
620. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
621. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
622. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
623. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
624. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
625. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
626. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
627. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
628. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
629. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
630. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
631. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
632. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
633. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
634. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
635. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
636. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
637. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
638. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
639. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
640. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
641. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
642. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
643. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
644. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
645. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
646. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
647. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
648. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
649. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
650. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
651. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
652. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
653. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
654. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
655. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
656. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
657. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
658. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
659. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
660. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
661. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
662. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
663. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
664. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
665. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
666. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
667. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
668. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
669. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
670. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
671. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
672. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
673. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
674. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
675. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
676. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
677. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
678. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
679. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
680. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
681. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
682. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
683. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
684. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
685. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
686. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
687. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
688. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
689. gbinv1.seq - Invertebrate sequence entries, part 1.
690. gbinv2.seq - Invertebrate sequence entries, part 2.
691. gbinv3.seq - Invertebrate sequence entries, part 3.
692. gbinv4.seq - Invertebrate sequence entries, part 4.
693. gbinv5.seq - Invertebrate sequence entries, part 5.
694. gbinv6.seq - Invertebrate sequence entries, part 6.
695. gbinv7.seq - Invertebrate sequence entries, part 7.
696. gbjou.idx - Index of the entries according to journal citation.
697. gbmam1.seq - Other mammalian sequence entries, part 1.
698. gbmam2.seq - Other mammalian sequence entries, part 2.
699. gbnew.txt - Accession numbers of entries new since the previous release.
700. gbpat1.seq - Patent sequence entries, part 1.
701. gbpat10.seq - Patent sequence entries, part 10.
702. gbpat11.seq - Patent sequence entries, part 11.
703. gbpat12.seq - Patent sequence entries, part 12.
704. gbpat13.seq - Patent sequence entries, part 13.
705. gbpat14.seq - Patent sequence entries, part 14.
706. gbpat15.seq - Patent sequence entries, part 15.
707. gbpat16.seq - Patent sequence entries, part 16.
708. gbpat17.seq - Patent sequence entries, part 17.
709. gbpat18.seq - Patent sequence entries, part 18.
710. gbpat2.seq - Patent sequence entries, part 2.
711. gbpat3.seq - Patent sequence entries, part 3.
712. gbpat4.seq - Patent sequence entries, part 4.
713. gbpat5.seq - Patent sequence entries, part 5.
714. gbpat6.seq - Patent sequence entries, part 6.
715. gbpat7.seq - Patent sequence entries, part 7.
716. gbpat8.seq - Patent sequence entries, part 8.
717. gbpat9.seq - Patent sequence entries, part 9.
718. gbphg.seq - Phage sequence entries.
719. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
720. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
721. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
722. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
723. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
724. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
725. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
726. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
727. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
728. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
729. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
730. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
731. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
732. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
733. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
734. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
735. gbpri1.seq - Primate sequence entries, part 1.
736. gbpri10.seq - Primate sequence entries, part 10.
737. gbpri11.seq - Primate sequence entries, part 11.
738. gbpri12.seq - Primate sequence entries, part 12.
739. gbpri13.seq - Primate sequence entries, part 13.
740. gbpri14.seq - Primate sequence entries, part 14.
741. gbpri15.seq - Primate sequence entries, part 15.
742. gbpri16.seq - Primate sequence entries, part 16.
743. gbpri17.seq - Primate sequence entries, part 17.
744. gbpri18.seq - Primate sequence entries, part 18.
745. gbpri19.seq - Primate sequence entries, part 19.
746. gbpri2.seq - Primate sequence entries, part 2.
747. gbpri20.seq - Primate sequence entries, part 20.
748. gbpri21.seq - Primate sequence entries, part 21.
749. gbpri22.seq - Primate sequence entries, part 22.
750. gbpri23.seq - Primate sequence entries, part 23.
751. gbpri24.seq - Primate sequence entries, part 24.
752. gbpri25.seq - Primate sequence entries, part 25.
753. gbpri26.seq - Primate sequence entries, part 26.
754. gbpri27.seq - Primate sequence entries, part 27.
755. gbpri28.seq - Primate sequence entries, part 28.
756. gbpri29.seq - Primate sequence entries, part 29.
757. gbpri3.seq - Primate sequence entries, part 3.
758. gbpri4.seq - Primate sequence entries, part 4.
759. gbpri5.seq - Primate sequence entries, part 5.
760. gbpri6.seq - Primate sequence entries, part 6.
761. gbpri7.seq - Primate sequence entries, part 7.
762. gbpri8.seq - Primate sequence entries, part 8.
763. gbpri9.seq - Primate sequence entries, part 9.
764. gbrel.txt - Release notes (this document).
765. gbrod1.seq - Rodent sequence entries, part 1.
766. gbrod10.seq - Rodent sequence entries, part 10.
767. gbrod11.seq - Rodent sequence entries, part 11.
768. gbrod12.seq - Rodent sequence entries, part 12.
769. gbrod13.seq - Rodent sequence entries, part 13.
770. gbrod14.seq - Rodent sequence entries, part 14.
771. gbrod15.seq - Rodent sequence entries, part 15.
772. gbrod16.seq - Rodent sequence entries, part 16.
773. gbrod17.seq - Rodent sequence entries, part 17.
774. gbrod18.seq - Rodent sequence entries, part 18.
775. gbrod19.seq - Rodent sequence entries, part 19.
776. gbrod2.seq - Rodent sequence entries, part 2.
777. gbrod20.seq - Rodent sequence entries, part 20.
778. gbrod3.seq - Rodent sequence entries, part 3.
779. gbrod4.seq - Rodent sequence entries, part 4.
780. gbrod5.seq - Rodent sequence entries, part 5.
781. gbrod6.seq - Rodent sequence entries, part 6.
782. gbrod7.seq - Rodent sequence entries, part 7.
783. gbrod8.seq - Rodent sequence entries, part 8.
784. gbrod9.seq - Rodent sequence entries, part 9.
785. gbsdr.txt - Short directory of the data bank.
786. gbsec.idx - Index of the entries according to secondary accession number.
787. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
788. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
789. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
790. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
791. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
792. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
793. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
794. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
795. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
796. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
797. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
798. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
799. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
800. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
801. gbsyn.seq - Synthetic and chimeric sequence entries.
802. gbuna.seq - Unannotated sequence entries.
803. gbvrl1.seq - Viral sequence entries, part 1.
804. gbvrl2.seq - Viral sequence entries, part 2.
805. gbvrl3.seq - Viral sequence entries, part 3.
806. gbvrl4.seq - Viral sequence entries, part 4.
807. gbvrl5.seq - Viral sequence entries, part 5.
808. gbvrt1.seq - Other vertebrate sequence entries, part 1.
809. gbvrt2.seq - Other vertebrate sequence entries, part 2.
810. gbvrt3.seq - Other vertebrate sequence entries, part 3.
811. gbvrt4.seq - Other vertebrate sequence entries, part 4.
812. gbvrt5.seq - Other vertebrate sequence entries, part 5.
813. gbvrt6.seq - Other vertebrate sequence entries, part 6.
814. gbvrt7.seq - Other vertebrate sequence entries, part 7.
815. gbvrt8.seq - Other vertebrate sequence entries, part 8.
816. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 149.0 flatfiles require roughly 179 GB (sequence
files only) or 195 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1447983457     gbacc.idx
 500613038     gbaut1.idx
 512854608     gbaut10.idx
 512814334     gbaut11.idx
 500643770     gbaut12.idx
 500023244     gbaut13.idx
 502522192     gbaut14.idx
 500371670     gbaut15.idx
 501686283     gbaut16.idx
 504030549     gbaut17.idx
 540236765     gbaut18.idx
 503209163     gbaut19.idx
 509020875     gbaut2.idx
 511749291     gbaut20.idx
 503033675     gbaut21.idx
 502990526     gbaut22.idx
 519443346     gbaut23.idx
 501292529     gbaut24.idx
 502375153     gbaut25.idx
 503181942     gbaut26.idx
 500575922     gbaut27.idx
 500708255     gbaut28.idx
 514131475     gbaut29.idx
 501506608     gbaut3.idx
 501241517     gbaut30.idx
 128949038     gbaut31.idx
 500897443     gbaut4.idx
 505416878     gbaut5.idx
 517402667     gbaut6.idx
 506948872     gbaut7.idx
 500143531     gbaut8.idx
 501445577     gbaut9.idx
 250904878     gbbct1.seq
 250003322     gbbct10.seq
 199646399     gbbct11.seq
 250200479     gbbct2.seq
 250166514     gbbct3.seq
 250000501     gbbct4.seq
 252863805     gbbct5.seq
 250000698     gbbct6.seq
 250430152     gbbct7.seq
 262535345     gbbct8.seq
 258107798     gbbct9.seq
   7313576     gbchg.txt
 837534463     gbcon.seq
    175139     gbdel.txt
 250000698     gbenv1.seq
 208465584     gbenv2.seq
 230688425     gbest1.seq
 230687597     gbest10.seq
 230689431     gbest100.seq
 230690088     gbest101.seq
 230690607     gbest102.seq
 230688508     gbest103.seq
 230688706     gbest104.seq
 230691285     gbest105.seq
 230689341     gbest106.seq
 230687853     gbest107.seq
 230689166     gbest108.seq
 230690242     gbest109.seq
 230687816     gbest11.seq
 230689405     gbest110.seq
 230038277     gbest111.seq
 230688011     gbest112.seq
 230689781     gbest113.seq
 230687553     gbest114.seq
 230688637     gbest115.seq
 230689180     gbest116.seq
 230690357     gbest117.seq
 230688459     gbest118.seq
 230690404     gbest119.seq
 230687685     gbest12.seq
 230690980     gbest120.seq
 230689361     gbest121.seq
 230688118     gbest122.seq
 230690592     gbest123.seq
 230688807     gbest124.seq
 230688699     gbest125.seq
 229578878     gbest126.seq
 230688031     gbest127.seq
 230688176     gbest128.seq
 230690909     gbest129.seq
 230688069     gbest13.seq
 230688698     gbest130.seq
 230687841     gbest131.seq
 230687460     gbest132.seq
 230690356     gbest133.seq
 230690185     gbest134.seq
 230691130     gbest135.seq
 230687926     gbest136.seq
 230688100     gbest137.seq
 230688622     gbest138.seq
 230687858     gbest139.seq
 230689004     gbest14.seq
 230689410     gbest140.seq
 230688972     gbest141.seq
 230689580     gbest142.seq
 230689035     gbest143.seq
 230688346     gbest144.seq
 230689115     gbest145.seq
 230689479     gbest146.seq
 230689744     gbest147.seq
 230688095     gbest148.seq
 230689412     gbest149.seq
 230688790     gbest15.seq
 230689427     gbest150.seq
 230687731     gbest151.seq
 230687873     gbest152.seq
 230688866     gbest153.seq
 230688285     gbest154.seq
 230688017     gbest155.seq
 230688436     gbest156.seq
 230689555     gbest157.seq
 230690116     gbest158.seq
 230687867     gbest159.seq
 230690286     gbest16.seq
 230687688     gbest160.seq
 230687522     gbest161.seq
 230689477     gbest162.seq
 230687633     gbest163.seq
 230690466     gbest164.seq
 230687827     gbest165.seq
 230689151     gbest166.seq
 230689188     gbest167.seq
 230688217     gbest168.seq
 230687871     gbest169.seq
 230689264     gbest17.seq
 230689583     gbest170.seq
 230688299     gbest171.seq
 230688881     gbest172.seq
 230689569     gbest173.seq
 230688576     gbest174.seq
 230688967     gbest175.seq
 230687593     gbest176.seq
 230688761     gbest177.seq
 230688865     gbest178.seq
 227848744     gbest179.seq
 230690149     gbest18.seq
 230690343     gbest180.seq
 230689884     gbest181.seq
 230688141     gbest182.seq
 230687883     gbest183.seq
 230689263     gbest184.seq
 230688335     gbest185.seq
 230690076     gbest186.seq
 230688654     gbest187.seq
 230688088     gbest188.seq
 230690167     gbest189.seq
 230689659     gbest19.seq
 230688179     gbest190.seq
 230689860     gbest191.seq
 230688331     gbest192.seq
 230688431     gbest193.seq
 230690542     gbest194.seq
 230690361     gbest195.seq
 230689948     gbest196.seq
 230689443     gbest197.seq
 230689673     gbest198.seq
 230687740     gbest199.seq
 230689482     gbest2.seq
 230689537     gbest20.seq
 230687600     gbest200.seq
 230688032     gbest201.seq
 230687539     gbest202.seq
 230689504     gbest203.seq
 230687641     gbest204.seq
 230688464     gbest205.seq
 230688250     gbest206.seq
 230687962     gbest207.seq
 230689626     gbest208.seq
 230687506     gbest209.seq
 230689303     gbest21.seq
 230688191     gbest210.seq
 230689703     gbest211.seq
 230689751     gbest212.seq
 230690508     gbest213.seq
 230689714     gbest214.seq
 230689197     gbest215.seq
 230690172     gbest216.seq
 230688792     gbest217.seq
 230688894     gbest218.seq
 225709343     gbest219.seq
 230688100     gbest22.seq
 163048051     gbest220.seq
 162117314     gbest221.seq
 168883587     gbest222.seq
 168115990     gbest223.seq
 167914583     gbest224.seq
 165340119     gbest225.seq
 164904270     gbest226.seq
 164506162     gbest227.seq
 164344405     gbest228.seq
 164313641     gbest229.seq
 230690317     gbest23.seq
 164442025     gbest230.seq
 163438216     gbest231.seq
 167035062     gbest232.seq
 164200632     gbest233.seq
 162064704     gbest234.seq
 164941687     gbest235.seq
 168693038     gbest236.seq
 166759995     gbest237.seq
 165586124     gbest238.seq
 165878491     gbest239.seq
 230689028     gbest24.seq
 165187409     gbest240.seq
 164736380     gbest241.seq
 164239725     gbest242.seq
 164516702     gbest243.seq
 165189851     gbest244.seq
 173115083     gbest245.seq
 177059916     gbest246.seq
 172875640     gbest247.seq
 230422257     gbest248.seq
 230689563     gbest249.seq
 230689106     gbest25.seq
 230689477     gbest250.seq
 230690167     gbest251.seq
 230690230     gbest252.seq
 230689421     gbest253.seq
 230691486     gbest254.seq
 230689851     gbest255.seq
 230690356     gbest256.seq
 230689150     gbest257.seq
 230688627     gbest258.seq
 230690206     gbest259.seq
 230689379     gbest26.seq
 230687600     gbest260.seq
 230688263     gbest261.seq
 230689293     gbest262.seq
 230688933     gbest263.seq
 230688693     gbest264.seq
 230688927     gbest265.seq
 230689864     gbest266.seq
 230690447     gbest267.seq
 230687805     gbest268.seq
 230689774     gbest269.seq
 230688361     gbest27.seq
 230690015     gbest270.seq
 230689754     gbest271.seq
 230687807     gbest272.seq
 230688397     gbest273.seq
 230689701     gbest274.seq
 230691142     gbest275.seq
 230689578     gbest276.seq
 213043079     gbest277.seq
 230689419     gbest278.seq
 230688018     gbest279.seq
 230689525     gbest28.seq
 230687860     gbest280.seq
 230689012     gbest281.seq
 230688451     gbest282.seq
 230690433     gbest283.seq
 230689145     gbest284.seq
 230690339     gbest285.seq
 230689141     gbest286.seq
 230689019     gbest287.seq
 230688837     gbest288.seq
 230687752     gbest289.seq
 230688677     gbest29.seq
 230689813     gbest290.seq
 230689916     gbest291.seq
 230688295     gbest292.seq
 230688440     gbest293.seq
 230687531     gbest294.seq
 230687481     gbest295.seq
 230693073     gbest296.seq
 230689800     gbest297.seq
 230689399     gbest298.seq
 230690426     gbest299.seq
 230687569     gbest3.seq
 230690414     gbest30.seq
 230689857     gbest300.seq
 230688982     gbest301.seq
 230689744     gbest302.seq
 230688674     gbest303.seq
 212985883     gbest304.seq
 230690276     gbest305.seq
 230691988     gbest306.seq
 230689945     gbest307.seq
 230689291     gbest308.seq
 230688343     gbest309.seq
 230687782     gbest31.seq
 230690498     gbest310.seq
 153058802     gbest311.seq
 167292541     gbest312.seq
 230688152     gbest313.seq
 230689854     gbest314.seq
 230690198     gbest315.seq
 230688257     gbest316.seq
 230690606     gbest317.seq
 230690356     gbest318.seq
 230690910     gbest319.seq
 230690273     gbest32.seq
 230688776     gbest320.seq
 230690152     gbest321.seq
 230688023     gbest322.seq
 230688407     gbest323.seq
 230689647     gbest324.seq
 230690516     gbest325.seq
 230688626     gbest326.seq
 230690135     gbest327.seq
 230689600     gbest328.seq
 230690003     gbest329.seq
 230688642     gbest33.seq
 230687752     gbest330.seq
 230688623     gbest331.seq
 230688592     gbest332.seq
 230687627     gbest333.seq
 230688563     gbest334.seq
 230690110     gbest335.seq
 230689613     gbest336.seq
 230689156     gbest337.seq
 230691729     gbest338.seq
 230687491     gbest339.seq
 230688067     gbest34.seq
 230687521     gbest340.seq
 230688330     gbest341.seq
 230689156     gbest342.seq
 230688630     gbest343.seq
 230689621     gbest344.seq
 230687499     gbest345.seq
 230687970     gbest346.seq
 230688007     gbest347.seq
 230688481     gbest348.seq
 230687615     gbest349.seq
 230690075     gbest35.seq
 230687871     gbest350.seq
 230691451     gbest351.seq
 230688333     gbest352.seq
 230689282     gbest353.seq
 230689713     gbest354.seq
 223853357     gbest355.seq
 230690103     gbest356.seq
 230688533     gbest357.seq
 230689814     gbest358.seq
 230691209     gbest359.seq
 230688742     gbest36.seq
 230688790     gbest360.seq
 230479386     gbest361.seq
 230687466     gbest362.seq
 230691939     gbest363.seq
 230689064     gbest364.seq
 230687857     gbest365.seq
 230688846     gbest366.seq
 230688190     gbest367.seq
 230690437     gbest368.seq
 230690271     gbest369.seq
 230688756     gbest37.seq
 230689096     gbest370.seq
 230693369     gbest371.seq
 230689983     gbest372.seq
 230688453     gbest373.seq
 230689506     gbest374.seq
 230687924     gbest375.seq
 230689036     gbest376.seq
 230691685     gbest377.seq
 230691163     gbest378.seq
 230689935     gbest379.seq
 230688606     gbest38.seq
 230689750     gbest380.seq
 230687599     gbest381.seq
 230687984     gbest382.seq
 230688546     gbest383.seq
 230688181     gbest384.seq
 230689504     gbest385.seq
 230691744     gbest386.seq
 230689401     gbest387.seq
 230689236     gbest388.seq
 230694065     gbest389.seq
 224237215     gbest39.seq
 230689345     gbest390.seq
 230688744     gbest391.seq
 230691756     gbest392.seq
 230687822     gbest393.seq
 230691168     gbest394.seq
 230690607     gbest395.seq
 230690223     gbest396.seq
 230688406     gbest397.seq
 230689537     gbest398.seq
 230689679     gbest399.seq
 230687828     gbest4.seq
 192376921     gbest40.seq
 230689688     gbest400.seq
 230690286     gbest401.seq
 230689343     gbest402.seq
 230688927     gbest403.seq
 230688328     gbest404.seq
 230690623     gbest405.seq
 230690720     gbest406.seq
 230688570     gbest407.seq
 230689512     gbest408.seq
 230688730     gbest409.seq
 191780848     gbest41.seq
 230689595     gbest410.seq
 217255265     gbest411.seq
 230689613     gbest412.seq
 165099141     gbest413.seq
 214826010     gbest42.seq
 216207178     gbest43.seq
 215842026     gbest44.seq
 216969187     gbest45.seq
 230688216     gbest46.seq
 230688030     gbest47.seq
 226202383     gbest48.seq
 230689055     gbest49.seq
 164950269     gbest5.seq
 230687756     gbest50.seq
 230688728     gbest51.seq
 230689672     gbest52.seq
 230688253     gbest53.seq
 230691005     gbest54.seq
 230687969     gbest55.seq
 230688333     gbest56.seq
 230690776     gbest57.seq
 230690553     gbest58.seq
 230688372     gbest59.seq
 177138923     gbest6.seq
 230689460     gbest60.seq
 230690188     gbest61.seq
 230691214     gbest62.seq
 230688880     gbest63.seq
 230689138     gbest64.seq
 209877969     gbest65.seq
 209438885     gbest66.seq
 208755262     gbest67.seq
 209111908     gbest68.seq
 209544758     gbest69.seq
 230689868     gbest7.seq
 210716530     gbest70.seq
 209572983     gbest71.seq
 208452746     gbest72.seq
 210239815     gbest73.seq
 209303316     gbest74.seq
 205126453     gbest75.seq
 208215758     gbest76.seq
 207426498     gbest77.seq
 210022451     gbest78.seq
 222451254     gbest79.seq
 230690240     gbest8.seq
 230690513     gbest80.seq
 230692454     gbest81.seq
 224145001     gbest82.seq
 215852406     gbest83.seq
 213771000     gbest84.seq
 227292664     gbest85.seq
 230688823     gbest86.seq
 230690359     gbest87.seq
 230688275     gbest88.seq
 230688026     gbest89.seq
 230689340     gbest9.seq
 230687766     gbest90.seq
 230690136     gbest91.seq
 230687990     gbest92.seq
 230689512     gbest93.seq
 230689142     gbest94.seq
 230687888     gbest95.seq
 230690179     gbest96.seq
 230690708     gbest97.seq
 230689653     gbest98.seq
 230689496     gbest99.seq
  48222731     gbgen.idx
 230689539     gbgss1.seq
 230687499     gbgss10.seq
 227152373     gbgss100.seq
 228508251     gbgss101.seq
 228733056     gbgss102.seq
 228616567     gbgss103.seq
 227899677     gbgss104.seq
 227421937     gbgss105.seq
 230688530     gbgss106.seq
 230688097     gbgss107.seq
 230688308     gbgss108.seq
 230690167     gbgss109.seq
 230691316     gbgss11.seq
 230688976     gbgss110.seq
 230687567     gbgss111.seq
 230689704     gbgss112.seq
 230688743     gbgss113.seq
 230687767     gbgss114.seq
 230688844     gbgss115.seq
 230689836     gbgss116.seq
 230688014     gbgss117.seq
 230688965     gbgss118.seq
 230687876     gbgss119.seq
 230688172     gbgss12.seq
 230688703     gbgss120.seq
 230688308     gbgss121.seq
 230688898     gbgss122.seq
 230688365     gbgss123.seq
 113228653     gbgss124.seq
 250001108     gbgss125.seq
 250000539     gbgss126.seq
 250002531     gbgss127.seq
 250001647     gbgss128.seq
 250003748     gbgss129.seq
 230688583     gbgss13.seq
 250001626     gbgss130.seq
 250000398     gbgss131.seq
 250000981     gbgss132.seq
 250000560     gbgss133.seq
 250000466     gbgss134.seq
 250001745     gbgss135.seq
 250000977     gbgss136.seq
 250001470     gbgss137.seq
 250002479     gbgss138.seq
 250003175     gbgss139.seq
 230689806     gbgss14.seq
 250001657     gbgss140.seq
 250004137     gbgss141.seq
 250000539     gbgss142.seq
 250000004     gbgss143.seq
 250000816     gbgss144.seq
 250002150     gbgss145.seq
 250000950     gbgss146.seq
 250000365     gbgss147.seq
 250001441     gbgss148.seq
 250000359     gbgss149.seq
 230687747     gbgss15.seq
 250002344     gbgss150.seq
  93172196     gbgss151.seq
 230688886     gbgss16.seq
 230689013     gbgss17.seq
 230690153     gbgss18.seq
 230687966     gbgss19.seq
 230689883     gbgss2.seq
 230689352     gbgss20.seq
 230688687     gbgss21.seq
 230689885     gbgss22.seq
 230689578     gbgss23.seq
 230688192     gbgss24.seq
 230689705     gbgss25.seq
 230689250     gbgss26.seq
 230687894     gbgss27.seq
 230690186     gbgss28.seq
 230689619     gbgss29.seq
 230688931     gbgss3.seq
 230687910     gbgss30.seq
 230689592     gbgss31.seq
 230689547     gbgss32.seq
 230689976     gbgss33.seq
 230689284     gbgss34.seq
 230688552     gbgss35.seq
 230689696     gbgss36.seq
 230689247     gbgss37.seq
 230688531     gbgss38.seq
 230687465     gbgss39.seq
 230689635     gbgss4.seq
 230688188     gbgss40.seq
 230687849     gbgss41.seq
 230689966     gbgss42.seq
 230688523     gbgss43.seq
 230688935     gbgss44.seq
 230690360     gbgss45.seq
 230689807     gbgss46.seq
 230690232     gbgss47.seq
 230688899     gbgss48.seq
 230690507     gbgss49.seq
 230689060     gbgss5.seq
 230688252     gbgss50.seq
 230687651     gbgss51.seq
 230690526     gbgss52.seq
 230689363     gbgss53.seq
 230689525     gbgss54.seq
 230689516     gbgss55.seq
 230688846     gbgss56.seq
 230687892     gbgss57.seq
 230690101     gbgss58.seq
 230689534     gbgss59.seq
 230690103     gbgss6.seq
 230690641     gbgss60.seq
 229393941     gbgss61.seq
 230688508     gbgss62.seq
 230687757     gbgss63.seq
 230687737     gbgss64.seq
 230689108     gbgss65.seq
 230687463     gbgss66.seq
 230688698     gbgss67.seq
 230689392     gbgss68.seq
 230688119     gbgss69.seq
 230688253     gbgss7.seq
 230689096     gbgss70.seq
 230688451     gbgss71.seq
 230689398     gbgss72.seq
 230688133     gbgss73.seq
 230687770     gbgss74.seq
 230687476     gbgss75.seq
 230687704     gbgss76.seq
 230689609     gbgss77.seq
 230689327     gbgss78.seq
 230689218     gbgss79.seq
 230688823     gbgss8.seq
 230688320     gbgss80.seq
 197964465     gbgss81.seq
 194762549     gbgss82.seq
 221685584     gbgss83.seq
 230688320     gbgss84.seq
 230689904     gbgss85.seq
 230687591     gbgss86.seq
 230689970     gbgss87.seq
 230688660     gbgss88.seq
 230689589     gbgss89.seq
 230690336     gbgss9.seq
 230689791     gbgss90.seq
 230689802     gbgss91.seq
 230687510     gbgss92.seq
 230688176     gbgss93.seq
 230687595     gbgss94.seq
 230687975     gbgss95.seq
 230689668     gbgss96.seq
 230688138     gbgss97.seq
 230688229     gbgss98.seq
 230689837     gbgss99.seq
 250005376     gbhtc1.seq
 250000866     gbhtc2.seq
 250003853     gbhtc3.seq
 250002695     gbhtc4.seq
 250003329     gbhtc5.seq
 250001858     gbhtc6.seq
 133348561     gbhtc7.seq
 250063914     gbhtg1.seq
 250019536     gbhtg10.seq
 250024110     gbhtg11.seq
 250012719     gbhtg12.seq
 250041897     gbhtg13.seq
 250299934     gbhtg14.seq
 250314905     gbhtg15.seq
 250267778     gbhtg16.seq
 250045541     gbhtg17.seq
 250138830     gbhtg18.seq
 250002541     gbhtg19.seq
 250005030     gbhtg2.seq
 250016110     gbhtg20.seq
 250273887     gbhtg21.seq
 250283293     gbhtg22.seq
 250086593     gbhtg23.seq
 250041270     gbhtg24.seq
 250096183     gbhtg25.seq
 250148018     gbhtg26.seq
 250186228     gbhtg27.seq
 250168277     gbhtg28.seq
 250158229     gbhtg29.seq
 250071408     gbhtg3.seq
 250014134     gbhtg30.seq
 250312562     gbhtg31.seq
 250080558     gbhtg32.seq
 250151230     gbhtg33.seq
 250036885     gbhtg34.seq
 250223822     gbhtg35.seq
 250241528     gbhtg36.seq
 250156045     gbhtg37.seq
 250096076     gbhtg38.seq
 250201712     gbhtg39.seq
 250077931     gbhtg4.seq
 250141386     gbhtg40.seq
 250056907     gbhtg41.seq
 250021086     gbhtg42.seq
 250102786     gbhtg43.seq
 250352212     gbhtg44.seq
 250216325     gbhtg45.seq
 250035703     gbhtg46.seq
 250156340     gbhtg47.seq
 250143222     gbhtg48.seq
 250050358     gbhtg49.seq
 250084487     gbhtg5.seq
 250003229     gbhtg50.seq
 250617941     gbhtg51.seq
 250125926     gbhtg52.seq
 250052516     gbhtg53.seq
 250231599     gbhtg54.seq
 250163142     gbhtg55.seq
 250022983     gbhtg56.seq
 250105117     gbhtg57.seq
 250292331     gbhtg58.seq
 250083887     gbhtg59.seq
 250211487     gbhtg6.seq
 250056908     gbhtg60.seq
 250043757     gbhtg61.seq
 250006494     gbhtg62.seq
 250391528     gbhtg63.seq
 250260684     gbhtg64.seq
 250141488     gbhtg65.seq
 250022760     gbhtg66.seq
 250084325     gbhtg67.seq
 118259505     gbhtg68.seq
 250150851     gbhtg7.seq
 250119872     gbhtg8.seq
 250038777     gbhtg9.seq
 250048074     gbinv1.seq
 250313705     gbinv2.seq
 250007633     gbinv3.seq
 250005261     gbinv4.seq
 250018063     gbinv5.seq
 250228201     gbinv6.seq
 244683053     gbinv7.seq
1206882022     gbjou.idx
 250000575     gbmam1.seq
  94040508     gbmam2.seq
  27343273     gbnew.txt
 250000603     gbpat1.seq
 250002509     gbpat10.seq
 250001599     gbpat11.seq
 250000866     gbpat12.seq
 250000791     gbpat13.seq
 250003365     gbpat14.seq
 250001184     gbpat15.seq
 250001623     gbpat16.seq
 250000785     gbpat17.seq
 133968349     gbpat18.seq
 250000020     gbpat2.seq
 250000343     gbpat3.seq
 250010087     gbpat4.seq
 250000523     gbpat5.seq
 250000863     gbpat6.seq
 250000787     gbpat7.seq
 250005046     gbpat8.seq
 250001321     gbpat9.seq
  40991080     gbphg.seq
 250127424     gbpln1.seq
 250001065     gbpln10.seq
 250004402     gbpln11.seq
 250000216     gbpln12.seq
 250002252     gbpln13.seq
 250011138     gbpln14.seq
 250000421     gbpln15.seq
 203552675     gbpln16.seq
 250058361     gbpln2.seq
 250000536     gbpln3.seq
 250001904     gbpln4.seq
 250003459     gbpln5.seq
 250037141     gbpln6.seq
 250095747     gbpln7.seq
 258565371     gbpln8.seq
 250570165     gbpln9.seq
 250082933     gbpri1.seq
 250272893     gbpri10.seq
 250244127     gbpri11.seq
 250023879     gbpri12.seq
 250086229     gbpri13.seq
 250064540     gbpri14.seq
 250103447     gbpri15.seq
 250004989     gbpri16.seq
 250062970     gbpri17.seq
 250145477     gbpri18.seq
 250149724     gbpri19.seq
 250127198     gbpri2.seq
 250098641     gbpri20.seq
 250119728     gbpri21.seq
 250027726     gbpri22.seq
 250000893     gbpri23.seq
 250151467     gbpri24.seq
 250001206     gbpri25.seq
 250005684     gbpri26.seq
 250084717     gbpri27.seq
 250000242     gbpri28.seq
  40439311     gbpri29.seq
 250043993     gbpri3.seq
 250012952     gbpri4.seq
 250151866     gbpri5.seq
 250200111     gbpri6.seq
 250062749     gbpri7.seq
 250086546     gbpri8.seq
 250167634     gbpri9.seq
    196340     gbrel.txt
 250021812     gbrod1.seq
 250011379     gbrod10.seq
 250062136     gbrod11.seq
 250106566     gbrod12.seq
 250164476     gbrod13.seq
 250047578     gbrod14.seq
 250105598     gbrod15.seq
 250090172     gbrod16.seq
 250001064     gbrod17.seq
 250000803     gbrod18.seq
 250066893     gbrod19.seq
 250209318     gbrod2.seq
 119688237     gbrod20.seq
 250155610     gbrod3.seq
 250164443     gbrod4.seq
 250009999     gbrod5.seq
 250186151     gbrod6.seq
 250134519     gbrod7.seq
 250083875     gbrod8.seq
 250252884     gbrod9.seq
3755841797     gbsdr.txt
   1563739     gbsec.idx
 250002224     gbsts1.seq
 250000488     gbsts10.seq
 250004141     gbsts11.seq
 250002207     gbsts12.seq
 250001763     gbsts13.seq
  14123992     gbsts14.seq
 250000838     gbsts2.seq
 250000517     gbsts3.seq
 250000048     gbsts4.seq
 250001168     gbsts5.seq
 250000738     gbsts6.seq
 250002573     gbsts7.seq
 250001086     gbsts8.seq
 250002868     gbsts9.seq
 102451677     gbsyn.seq
    416265     gbuna.seq
 250002795     gbvrl1.seq
 250001686     gbvrl2.seq
 250000995     gbvrl3.seq
 250002744     gbvrl4.seq
  60232698     gbvrl5.seq
 250000875     gbvrt1.seq
 250237833     gbvrt2.seq
 250000215     gbvrt3.seq
 250053723     gbvrt4.seq
 250024974     gbvrt5.seq
 250144183     gbvrt6.seq
 250000802     gbvrt7.seq
 250043627     gbvrt8.seq
 194018932     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         24178      102385489
BCT10        24732      99733479
BCT11        25846      72882800
BCT2         7477       107448276
BCT3         297        114527223
BCT4         28078      103290660
BCT5         29125      98262105
BCT6         64424      85233641
BCT7         6321       114735921
BCT8         664        98640047
BCT9         2194       115416062
ENV1         96941      71366664
ENV2         77937      66628936
EST1         68034      26258363
EST10        76493      29723216
EST100       73824      44049389
EST101       71798      43057367
EST102       70073      44735908
EST103       74383      36698498
EST104       69852      31133723
EST105       65196      31111523
EST106       66871      40104586
EST107       70422      36527708
EST108       69801      45534787
EST109       75910      34468867
EST11        74698      28608637
EST110       74488      27738339
EST111       75675      25952974
EST112       73420      40107286
EST113       63837      31083361
EST114       78570      47302196
EST115       79182      44966931
EST116       72496      45237784
EST117       68421      43364912
EST118       73106      47053943
EST119       67665      44923009
EST12        77211      30612340
EST120       73830      43811396
EST121       75342      44907957
EST122       73000      48061879
EST123       75391      48431121
EST124       72962      46772737
EST125       78255      37666394
EST126       78089      26440409
EST127       80296      48717674
EST128       74799      43674319
EST129       66653      37413205
EST13        76235      29134866
EST130       70869      35181357
EST131       67170      37819020
EST132       66640      36214297
EST133       69543      42578969
EST134       72971      41824812
EST135       68583      43021823
EST136       69196      41625596
EST137       73928      42504761
EST138       68500      41647351
EST139       58516      33402747
EST14        77983      31413784
EST140       96311      52226110
EST141       88941      51170012
EST142       78986      40667090
EST143       107359     58031849
EST144       108294     57938594
EST145       98546      54331141
EST146       73480      45116763
EST147       94382      55478877
EST148       99608      59590670
EST149       90515      51954405
EST15        74272      31341755
EST150       72154      43593260
EST151       68336      33788088
EST152       64120      29275779
EST153       54776      24940338
EST154       64461      31275788
EST155       61640      31276270
EST156       66627      35767588
EST157       72583      51625277
EST158       64936      44365065
EST159       82703      48868456
EST16        75803      33403926
EST160       58287      29715231
EST161       62402      31767812
EST162       67093      40383354
EST163       65263      37445491
EST164       63096      42549470
EST165       88313      44511613
EST166       91978      45616284
EST167       96762      57348837
EST168       102616     59531905
EST169       95617      53123833
EST17        80848      33051568
EST170       94510      40936127
EST171       92439      45441241
EST172       93315      43575347
EST173       90270      37114505
EST174       85641      41299562
EST175       65195      44632407
EST176       70698      38417501
EST177       57987      37457677
EST178       70100      38595514
EST179       73980      26349464
EST18        81510      32879782
EST180       74071      47067228
EST181       76814      38733829
EST182       66987      33263412
EST183       69106      40880062
EST184       69450      54419961
EST185       67604      36830218
EST186       68895      34681246
EST187       70102      57138611
EST188       67883      41914996
EST189       72328      36311227
EST19        78262      31520557
EST190       69757      52026485
EST191       69604      55699263
EST192       64621      47731024
EST193       64481      47103364
EST194       65110      47645777
EST195       64926      45573255
EST196       64145      48298596
EST197       64501      41127279
EST198       63717      34665249
EST199       63415      36681500
EST2         74718      28667916
EST20        74204      30887609
EST200       76928      41948302
EST201       88270      54794572
EST202       69369      44549117
EST203       97606      59861190
EST204       107335     66515004
EST205       109001     64122456
EST206       106255     65470202
EST207       103390     66486829
EST208       110756     50996925
EST209       90969      54906334
EST21        74911      34225358
EST210       109888     49020731
EST211       91917      52711377
EST212       67881      37173118
EST213       69906      52415454
EST214       68675      58767931
EST215       76132      48360786
EST216       80986      40180554
EST217       76420      51905039
EST218       71480      50881710
EST219       62411      36740306
EST22        73177      29510851
EST220       27793      10457982
EST221       27863      10451790
EST222       26737      9811173
EST223       26892      9455364
EST224       26972      9223617
EST225       27225      10198511
EST226       27181      9688414
EST227       27227      10157218
EST228       27213      11539959
EST229       27189      11441373
EST23        77453      32919525
EST230       27236      10552452
EST231       27538      9538875
EST232       26999      8860128
EST233       27550      11198465
EST234       27880      10750305
EST235       27440      11063389
EST236       26629      11740960
EST237       26869      11778906
EST238       27118      10575470
EST239       26961      11486940
EST24        74075      31991301
EST240       27097      11758417
EST241       27239      11301811
EST242       27270      10779993
EST243       27236      10765352
EST244       27172      10545170
EST245       25749      15488933
EST246       25051      16641646
EST247       28671      18091177
EST248       101145     34542629
EST249       80668      41232413
EST25        75075      32928853
EST250       68808      44316226
EST251       69183      44957002
EST252       69099      44312476
EST253       64471      40028417
EST254       80494      44600995
EST255       62166      43168916
EST256       68625      42422626
EST257       61613      30941824
EST258       102723     48009091
EST259       84086      44535073
EST26        73678      29979037
EST260       72188      38281534
EST261       65216      31383595
EST262       67197      40330310
EST263       72141      34903678
EST264       71003      33500930
EST265       75171      46187587
EST266       64172      36067021
EST267       67876      39318249
EST268       76779      37711417
EST269       82139      45491356
EST27        75034      32413096
EST270       73970      49243351
EST271       78099      53679016
EST272       101033     49725627
EST273       93634      45156776
EST274       76909      43836067
EST275       70342      46344210
EST276       75648      33520853
EST277       69912      30485034
EST278       72177      37621364
EST279       64245      37628657
EST28        106370     50117310
EST280       60125      38717914
EST281       73655      43147910
EST282       62448      43290519
EST283       61400      33791025
EST284       84476      44106316
EST285       83632      40778711
EST286       71967      46503943
EST287       104006     58580132
EST288       121550     47797797
EST289       83266      38744849
EST29        97903      45867154
EST290       65894      35397962
EST291       71631      45887358
EST292       80879      41111842
EST293       71229      42051174
EST294       70563      40686705
EST295       63114      35348347
EST296       61305      37305320
EST297       54171      30868846
EST298       72005      51794159
EST299       73676      43971191
EST3         73590      29860872
EST30        99107      53271438
EST300       71149      41650632
EST301       69143      36211301
EST302       77724      48089524
EST303       94110      61600526
EST304       71144      40917019
EST305       77967      43665829
EST306       64156      55609759
EST307       64244      46665835
EST308       65231      41968418
EST309       62038      35147744
EST31        75765      39042340
EST310       73114      50974876
EST311       49968      26991508
EST312       52959      26284652
EST313       71859      39120346
EST314       60343      32458681
EST315       62212      31548596
EST316       64864      41760286
EST317       85764      43581198
EST318       71791      42391644
EST319       67949      43629244
EST32        66727      61911354
EST320       66252      37697379
EST321       67696      44255276
EST322       88762      49992996
EST323       84867      50644508
EST324       75469      41681079
EST325       63213      36591335
EST326       67843      34930725
EST327       69311      38636066
EST328       47238      24161605
EST329       68791      39800853
EST33        80323      48570533
EST330       74554      42465092
EST331       98572      46385232
EST332       72653      50118178
EST333       74589      47944011
EST334       70738      43650584
EST335       61204      34114280
EST336       88433      38243011
EST337       68433      40720794
EST338       51682      36585688
EST339       63159      37139945
EST34        91639      44852446
EST340       68989      44731836
EST341       100942     55384274
EST342       72388      37226232
EST343       80438      44419304
EST344       61013      37843415
EST345       42469      22577388
EST346       57000      34279942
EST347       85207      46155861
EST348       77522      46219157
EST349       72637      44964250
EST35        85023      46131514
EST350       72941      39319921
EST351       61362      39810035
EST352       72996      40263199
EST353       57392      35339695
EST354       75958      31429946
EST355       80049      26432341
EST356       70047      41447550
EST357       66539      36989028
EST358       69924      38836351
EST359       81270      48917671
EST36        99045      51467534
EST360       63342      43601708
EST361       74188      43907342
EST362       60684      34253635
EST363       67564      41098021
EST364       79934      51321725
EST365       82790      48715038
EST366       69327      41343734
EST367       59416      42013020
EST368       57540      41432257
EST369       57330      41014166
EST37        97977      49109135
EST370       66849      40561438
EST371       68445      41342564
EST372       58969      37142827
EST373       58301      38889661
EST374       59277      40737662
EST375       60567      41736246
EST376       56043      42106401
EST377       46205      33080514
EST378       83310      38976556
EST379       52349      40858478
EST38        100289     48671542
EST380       67511      45522344
EST381       66275      37751607
EST382       69162      40531867
EST383       121392     60834961
EST384       74872      46669728
EST385       79278      57895929
EST386       39326      21790726
EST387       50800      55023208
EST388       46852      58191065
EST389       67291      46518190
EST39        92829      35930195
EST390       71712      42112449
EST391       69976      44346343
EST392       66817      43893566
EST393       66858      42853831
EST394       58801      49362214
EST395       60483      39730897
EST396       56137      40840614
EST397       55766      37974688
EST398       66450      47739547
EST399       67367      47534339
EST4         73953      28155396
EST40        68625      18213698
EST400       60772      44978818
EST401       52124      37716642
EST402       52693      38639486
EST403       59742      42606740
EST404       61134      36465591
EST405       68030      44290464
EST406       71100      30863255
EST407       69738      25503185
EST408       73127      27355610
EST409       73953      26008459
EST41        68571      18332216
EST410       77446      27363749
EST411       71114      24840435
EST412       70857      29369982
EST413       55018      20110904
EST42        63818      19559428
EST43        43335      11801739
EST44        43053      11912554
EST45        42854      11374871
EST46        74517      29590770
EST47        96513      44266651
EST48        92531      46180172
EST49        89529      42636250
EST5         48552      15462195
EST50        102012     51711431
EST51        101988     52118113
EST52        75825      32673831
EST53        66286      28740252
EST54        73246      32539213
EST55        70612      29761701
EST56        80145      32673221
EST57        75426      29674971
EST58        70847      28606339
EST59        64970      29785511
EST6         55001      17440741
EST60        73504      32964443
EST61        78668      35010515
EST62        73533      29364583
EST63        75184      25456996
EST64        87102      42165342
EST65        41338      11596994
EST66        40036      11015959
EST67        40050      12274199
EST68        40384      12475751
EST69        40447      12063051
EST7         74090      29152490
EST70        40341      13083220
EST71        40307      12594129
EST72        40316      12297306
EST73        39953      11871555
EST74        40661      12779122
EST75        41341      11642291
EST76        41024      13175949
EST77        40897      12680974
EST78        41474      13259494
EST79        45327      12970218
EST8         75313      30469369
EST80        39759      25208291
EST81        42040      21413185
EST82        46384      18746216
EST83        50008      22810516
EST84        51384      21339916
EST85        58216      23996625
EST86        75973      31735272
EST87        75430      28517845
EST88        72942      36011126
EST89        77071      44840196
EST9         77448      29829010
EST90        77267      42899903
EST91        76078      36758282
EST92        76024      43097547
EST93        72725      38088939
EST94        73141      29999448
EST95        74774      46931078
EST96        70192      30012833
EST97        77232      49090218
EST98        64797      35332837
EST99        71811      36873360
GSS1         90825      38838374
GSS10        75205      43833923
GSS100       75306      40823369
GSS101       73732      44781763
GSS102       73471      45439590
GSS103       73601      45109294
GSS104       73207      45084917
GSS105       73612      43942445
GSS106       79969      52598358
GSS107       85771      58476444
GSS108       81501      53730881
GSS109       84481      52656059
GSS11        69998      35693198
GSS110       84194      49571606
GSS111       81202      66229335
GSS112       88144      46327712
GSS113       92496      55610317
GSS114       74642      48789051
GSS115       87689      62378256
GSS116       82530      61393627
GSS117       78321      44275723
GSS118       86221      51035778
GSS119       92119      54251476
GSS12        73548      38676139
GSS120       85323      54951919
GSS121       84677      56154774
GSS122       77201      64532837
GSS123       76624      68996277
GSS124       38201      32283960
GSS125       87189      64730609
GSS126       83935      63019542
GSS127       101312     46889474
GSS128       68991      58743647
GSS129       68487      58900293
GSS13        76489      38776094
GSS130       69543      56768164
GSS131       69807      56256304
GSS132       70565      55587938
GSS133       86110      73189295
GSS134       85143      41078693
GSS135       70890      47208187
GSS136       110589     72587266
GSS137       85505      35974685
GSS138       90317      68090200
GSS139       72983      60685566
GSS14        71399      32053200
GSS140       70268      59091050
GSS141       66045      63246089
GSS142       76546      56958716
GSS143       120678     73151584
GSS144       118120     75833491
GSS145       104470     58807190
GSS146       87785      55611458
GSS147       93584      57308817
GSS148       84855      45789306
GSS149       89457      61585540
GSS15        70902      35386698
GSS150       107826     53936602
GSS151       36002      16069131
GSS16        77588      45718653
GSS17        70917      33380301
GSS18        58098      27809721
GSS19        56846      28928903
GSS2         89386      39537205
GSS20        57739      26520778
GSS21        61874      30956779
GSS22        64594      36359309
GSS23        57554      27013298
GSS24        67323      42717207
GSS25        67065      27611124
GSS26        58099      25563057
GSS27        66921      32502872
GSS28        63807      32259711
GSS29        79745      40297235
GSS3         87699      41940144
GSS30        81858      39884690
GSS31        74231      40338257
GSS32        70483      48496351
GSS33        80018      37638203
GSS34        75905      40292108
GSS35        74680      39228957
GSS36        87602      58164580
GSS37        87588      58187598
GSS38        85666      44866144
GSS39        85576      49293006
GSS4         79303      41207047
GSS40        87563      38537051
GSS41        82644      34586485
GSS42        81262      56910251
GSS43        79484      57507202
GSS44        72038      47481719
GSS45        72039      47425921
GSS46        77903      45328444
GSS47        78067      39654289
GSS48        83666      58381510
GSS49        86562      66336101
GSS5         79041      40731282
GSS50        82870      53037723
GSS51        93465      59769305
GSS52        88505      58833581
GSS53        75140      39946971
GSS54        74721      43056824
GSS55        86001      45533102
GSS56        88387      58835734
GSS57        76126      67457297
GSS58        72027      79237914
GSS59        88526      68371381
GSS6         78255      38895462
GSS60        86528      57613619
GSS61        63554      45301219
GSS62        69612      47963729
GSS63        89663      67257209
GSS64        86239      57970521
GSS65        87443      53960643
GSS66        87639      56716628
GSS67        97285      57999342
GSS68        100603     54541239
GSS69        100689     54430819
GSS7         77539      39418357
GSS70        101342     53604611
GSS71        102376     52291710
GSS72        102372     52297240
GSS73        102698     51883085
GSS74        102115     52621929
GSS75        98275      57526639
GSS76        90158      69774444
GSS77        89834      70780761
GSS78        88016      69598605
GSS79        87824      69678345
GSS8         76330      38105833
GSS80        88777      62604882
GSS81        80874      23716207
GSS82        77788      24527825
GSS83        88355      36460139
GSS84        84331      50966209
GSS85        80712      49105320
GSS86        89514      64699622
GSS87        78425      62241475
GSS88        78225      79463030
GSS89        76581      56011726
GSS9         72576      37287728
GSS90        94927      50984059
GSS91        75757      40496969
GSS92        85431      50782635
GSS93        70486      60652216
GSS94        85643      52902404
GSS95        82610      61003156
GSS96        87349      57520670
GSS97        83304      57006537
GSS98        89868      55793604
GSS99        80412      66365103
HTC1         32151      55611690
HTC2         31639      66256003
HTC3         75274      40529673
HTC4         78751      70885966
HTC5         65519      62777201
HTC6         67755      70959762
HTC7         29110      54604072
HTG1         1315       188873586
HTG10        1239       186540769
HTG11        1427       184142515
HTG12        880        191849995
HTG13        751        192251270
HTG14        741        192399127
HTG15        776        192381500
HTG16        803        192172812
HTG17        764        192209605
HTG18        2009       171976103
HTG19        1030       188145586
HTG2         2562       185987793
HTG20        1070       188102921
HTG21        778        192106674
HTG22        925        190500494
HTG23        880        190905963
HTG24        830        191140525
HTG25        772        192114442
HTG26        843        191432407
HTG27        851        191581690
HTG28        964        189868196
HTG29        919        190713006
HTG3         2450       185370355
HTG30        943        190424142
HTG31        867        191521230
HTG32        957        189832466
HTG33        898        190949533
HTG34        845        191596013
HTG35        833        191899949
HTG36        864        191353870
HTG37        929        190544493
HTG38        968        190396243
HTG39        932        190741139
HTG4         2527       188428356
HTG40        1115       188374887
HTG41        1112       188261954
HTG42        1380       186505114
HTG43        1139       188941560
HTG44        1131       188742320
HTG45        1144       191560408
HTG46        1275       190671410
HTG47        1181       191521698
HTG48        1167       191358793
HTG49        1075       191138880
HTG5         1281       185666662
HTG50        937        189485804
HTG51        997        190703476
HTG52        1026       189987121
HTG53        989        189943966
HTG54        1038       190573242
HTG55        945        190180674
HTG56        1021       190606797
HTG57        968        189447378
HTG58        956        189876028
HTG59        1267       188754233
HTG6         1274       185376276
HTG60        1715       185821991
HTG61        1184       192127291
HTG62        1172       190720629
HTG63        1487       189008132
HTG64        1040       194127227
HTG65        1030       194041439
HTG66        1039       193769647
HTG67        831        182248760
HTG68        472        83647771
HTG7         1247       185590985
HTG8         1288       185020375
HTG9         1183       187103109
INV1         16967      162393862
INV2         1581       165923317
INV3         36312      113475369
INV4         74536      75532490
INV5         78385      73625712
INV6         43999      103961193
INV7         46323      99864729
MAM1         54570      112505471
MAM2         22989      36403099
PAT1         222684     70173292
PAT10        120554     49027493
PAT11        95749      59861177
PAT12        140683     55749253
PAT13        145625     60098102
PAT14        140442     92611565
PAT15        115549     113135050
PAT16        109093     113203901
PAT17        133099     89625935
PAT18        101340     32714762
PAT2         194376     84713809
PAT3         172017     95883630
PAT4         149101     105539595
PAT5         142101     87656121
PAT6         113035     112366763
PAT7         142044     93702514
PAT8         132580     95531649
PAT9         135150     83335936
PHG          2671       16358873
PLN1         34379      122796967
PLN10        3442       173930019
PLN11        60873      63498301
PLN12        77379      78475276
PLN13        72843      77438163
PLN14        27465      125853960
PLN15        45143      113259657
PLN16        38333      79422393
PLN2         1373       176711614
PLN3         10555      155914143
PLN4         77563      77933470
PLN5         66824      65852757
PLN6         32157      57531572
PLN7         1276       164417819
PLN8         1407       182032896
PLN9         6          197759100
PRI1         21107      141783161
PRI10        1438       181584991
PRI11        1297       179103986
PRI12        1540       178279456
PRI13        1604       179607466
PRI14        1483       186451691
PRI15        20624      157857392
PRI16        43770      101131296
PRI17        18746      132623458
PRI18        1608       183755654
PRI19        1721       183432183
PRI2         1461       173265669
PRI20        2086       181633278
PRI21        1993       183846481
PRI22        22439      146214995
PRI23        49662      81060983
PRI24        25590      103496042
PRI25        9551       171193402
PRI26        20712      154881998
PRI27        51453      116005781
PRI28        48816      112932240
PRI29        10661      15212562
PRI3         1278       186100680
PRI4         1330       184316729
PRI5         1193       181067963
PRI6         1204       179442596
PRI7         1233       180072893
PRI8         1370       174608747
PRI9         1232       177946047
ROD1         8865       170006573
ROD10        1004       183299455
ROD11        964        183756659
ROD12        1040       187391858
ROD13        970        181926136
ROD14        27773      143100191
ROD15        1159       190071161
ROD16        1212       193286217
ROD17        4088       189208228
ROD18        42985      72767659
ROD19        24552      131618989
ROD2         925        174159213
ROD20        31558      41816586
ROD3         902        174453768
ROD4         908        174104148
ROD5         930        175114001
ROD6         980        180477162
ROD7         979        180572821
ROD8         991        181593783
ROD9         1012       183609098
STS1         82071      35434098
STS10        58209      44439069
STS11        57991      43708087
STS12        77107      37977210
STS13        88391      38933928
STS14        6303       3090630
STS2         83575      43817876
STS3         78138      31777979
STS4         64795      33318894
STS5         54886      31928904
STS6         54705      32286995
STS7         54689      32212962
STS8         56491      39089600
STS9         58083      44556609
SYN          23702      32276700
UNA          213        114659
VRL1         72431      65643269
VRL2         72034      65678979
VRL3         71763      68845127
VRL4         75546      63646019
VRL5         14009      20511323
VRT1         55730      108726857
VRT2         18203      163184657
VRT3         71269      83953381
VRT4         38173      76225145
VRT5         1187       193516089
VRT6         1283       193176113
VRT7         8196       182306744
VRT8         16951      169328344
VRT9         32905      100281003


2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 149.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries       Bases   Species

8589480 11201918270   Homo sapiens
6217605  7490526361   Mus musculus
1015248  5668751953   Rattus norvegicus
840452   2101785993   Danio rerio
1129487  1947985221   Bos taurus
2565244  1703766839   Zea mays
354924   1166526669   Oryza sativa (japonica cultivar-group)
1102903   891062906   Xenopus tropicalis
1407513   805167252   Canis familiaris
530740    782116888   Drosophila melanogaster
752090    650155377   Gallus gallus
979323    647137057   Arabidopsis thaliana
207699    527756706   Pan troglodytes
784574    462578028   Sorghum bicolor
627530    423993557   Sus scrofa
693814    419652405   Ciona intestinalis
596261    404130458   Brassica oleracea
387807    403249617   Medicago truncatula
65232     383498886   Macaca mulatta
609078    346620305   Triticum aestivum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 August 2005

                NCBI-GenBank Flat File Release 149.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

	NOTE: Obsolete as of release ????

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 149.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
	Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
	Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
	Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
	Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Tony Stearman

User Support
	Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
	Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
	Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
	David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center