Release Notes For GenBank Release 150
GBREL.TXT Genetic Sequence Data Bank
October 15 2005
NCBI-GenBank Flat File Release 150.0
Distribution Release Notes
49152445 loci, 53655236500 bases, from 49152445 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 150.0
1.2 Cutoff Date
1.3 Important Changes in Release 150.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 150.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
E-MAIL: update@ncbi.nlm.nih.gov
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 150.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.
1.2 Cutoff Date
This full release, 150.0, incorporates data available to the collaborating
databases as of October 8, 2005 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 150.0
1.3.1 Problems generating accession number and keyword indexes
Continuing software problems again prevented the generation of
the gbacc.idx and gbkey.idx 'index' files which normally accompany
GenBank releases.
A version of gbacc.idx was built manually. However, the first field
contains just an accession number rather than Accession.Version .
The gbkey.idx index could not be created without substantial
additional delays in release processing, so it is completely absent
from 150.0 .
Our apologies for any inconvenience that this ongoing problem
may cause.
1.3.2 Organizational changes
The total number of sequence data files increased by 37 with this release:
- the BCT division is now comprised of 12 files (+1)
- the EST division is now comprised of 436 files (+23)
- the GSS division is now comprised of 158 files (+7)
- the HTC division is now comprised of 10 files (+3)
- the INV division is now comprised of 8 files (+1)
- the ROD division is now comprised of 21 files (+1)
- the VRT division is now comprised of 10 files (+1)
1.3.3 New qualifiers for the source feature
A set of five new source feature qualifiers are now legal as of this
October 2005 release.
Qualifier /lat_lon
Definition geographical coordinates of the location where
the specimen was collected
Value format "text"
Example /lat_lon="47.94 N 28.12 W"
Comment decimal degrees latitude [N/S] decimal degrees longitude [E/W]
Qualifier /collected_by
Definition name of the person who collected the specimen
Value format "text"
Example /collected_by="Dan Janzen"
Qualifier /collection_date
Definition date that the specimen was collected
Value format "DD-MMM-YYYY", "MMM-YYYY" or "YYYY"
Example /collection_date="21-OCT-1952"
/collection_date="OCT-1952"
/collection_date="1952"
Comment full date format DD-MMM-YYYY is preferred;
where day and/or month of collection is not known either "MMM-YYYY" or "YYYY"
can be used; three-letter month abbreviation can be one of the following:
JAN, FEB, MAR, APR, MAY, JUN, JUL, AUG, SEP, OCT, NOV, DEC.
Qualifier /identified_by
Definition name of the taxonomist who identified the specimen
Value format "text"
Example /identified_by="John Burns"
Qualifier /PCR_primers
Definition PCR primers that were used to amplify the sequence.
Value format /PCR_primers="fwd_name:XXX, fwd_seq:xxxxx,
rev_name:YYY, rev_seq:yyyyy"
Example /PCR_primers="fwd_name:CO1P1, fwd_seq:ttgattttttggtcayccwgaagt,
rev_name:CO1R4, rev_seq:ccwvytardcctarraartgttg"
Comment fwd_seq and rev_seq are both required.
fwd_name and rev_name are both optional.
Both sequences should be presented in 5'>3' order.
The sequences should utilize the IUPAC degenerate-base alphabet.
For the /PCR_primers qualifier, the order of the elements within the
qualifier value must always be as shown above. Multiple /PCR_primers
qualifiers may exist on a source feature.
These qualifiers will most likely see their first use in association
with environmental sampling projects and the BarCode project.
1.3.4 : /evidence qualifer replaced
Two new qualifiers which replace /evidence are legal as of the
October 2005 GenBank release :
/experiment
/inference
Existing /evidence="not_experimental" qualifiers have been replaced by:
/inference="non-experimental evidence, no additional details recorded"
While existing /evidence="experimental" qualifiers are now:
/experiment="experimental evidence, no additional details recorded"
The complete definitions of these two new qualifiers are as follows:
Qualifier /experiment
Definition a brief description of the nature of the experimental
evidence that supports the feature identification
or assignment.
Value format "text"
Example /experiment="Northern blot"
Comment detailed experimental details should not be included,
and would normally be found in the cited publications.
/experiment="experimental evidence, no additional details recorded"
is for use purely to replace existing instances of
/evidence=EXPERIMENTAL
Qualifier /inference
Definition a structured description of non-experimental evidence
that supports the feature identification or assignment.
Value format "TYPE[ (same species)][:EVIDENCE_BASIS]"
where TYPE is one of the following:
"non-experimental evidence, no additional details recorded"
"similar to sequence"
"similar to AA sequence"
"similar to DNA sequence"
"similar to RNA sequence"
"similar to RNA sequence, mRNA"
"similar to RNA sequence, EST"
"similar to RNA sequence, other RNA"
"profile"
"nucleotide motif"
"protein motif"
"ab initio prediction"
where the optional text " (same species)" is included when the inference
comes from the same species as the entry.
where the optional "EVIDENCE_BASIS" is either a reference to a database
entry (including accession and version) or an algorithm (including version),
eg 'INSD:AACN010222672.1', 'InterPro:IPR001900', 'ProDom:PD000600',
'Genscan:2.0', etc.
Example /inference="similar to DNA sequence:INSD:AY411252.1"
/inference="similar to RNA, mRNA sequence:RefSeq:NM_000041.2"
/inference="similar to DNA sequence (same species):INSD:AACN010222672.1"
/inference="profile:tRNAscan:2.1"
/inference="protein motif:InterPro:IPR001900"
/inference="ab initio prediction:Genscan:2.0"
Comment /inference="non-experimental evidence, no additional details recorded"
is for use purely to replace existing instances of
/evidence=NOT_EXPERIMENTAL
1.3.5 New /organelle qualifier value
As of the October 2005 GenBank release, a new value for the /organelle
qualifier is now supported : hydrogenosome
This will be used for the annotation of sequences from anaerobic protozoa
and fungi, for which the hydrogenosome has a role in anaerobic respiration.
1.3.6 Two new qualifiers for trans splicing and ribosomal slippage
As of the October 2005 GenBank release, these two new qualifiers
have been introduced:
Qualifier /trans_splicing
Definition indicates that exons from two RNA molecules are
ligated in intermolecular reaction to form mature RNA
Value format none
Example /trans_splicing
Comment should be used on features such as CDS, mRNA and
other features that are produced as a result of a
trans-splicing event. This qualifier should be used only
when the splice event is indicated via the join operator
for the associated feature's location.
Note : legal on CDS, mRNA, misc_RNA, precursor_RNA, 5'UTR, 3'UTR, tRNA,
and gene features
Qualifier /ribosomal_slippage
Definition during protein translation, certain sequences can
program ribosomes to change to an alternative
reading frame by a mechanism known as ribosomal
slippage
Value format none
Example /ribosomal_slippage
Comment a join operator,e.g.: [join(486..1784,1787..4810)]
should be used in the CDS spans to indicate the
location of ribosomal_slippage
Note: legal on CDS features only
1.3.7 New /exception qualifier value
Coding regions for which the conceptual protein translation differs from
the supplied /translation qualifier are flagged with an /exception
qualifier. The value :
"rearrangement required for product"
is now legal for /exception as of this October 2005 GenBank release.
1.3.8 : /repeat_unit qualifer replaced
Two new qualifiers designed to replace /repeat_unit are now legal as of
the October 2005 GenBank release : /repeat_unit_seq and /repeat_unit_range .
The old qualifier accomodates both integer ranges (eg: "10..20") and
characters that represent a repeat unit pattern (eg: (AT)2(AA)5 ). Introducing
a separate qualifier for each of these representations will make it easier
to submit and validate their values.
Qualifier /rpt_unit_seq
Definition identity of a repeat sequence
Value format "text"
Example /rpt_unit_seq="aagggc"
/rpt_unit_seq="ag(5)tg(8)"
Comment used to indicate the literal sequence that constitutes
a repeated sequence specified by the feature keys oriT,
repeat_region, repeat_unit and satellite.
Note : legal on oriT, repeat_region, repeat_unit and satellite features
Qualifier /rpt_unit_range
Definition identity of a repeat range
Value format "text"
Example /rpt_unit_range="202..245"
Comment used to indicate the base range of the sequence that
constitutes a repeated sequence specified by the
feature keys oriT, repeat_region, repeat_unit and
satellite.
Note : legal on oriT, repeat_region, repeat_unit and satellite features
1.3.9 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
twenty-eight of the GSS flatfiles in Release 150.0. Consider gbgss131.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
October 15 2005
NCBI-GenBank Flat File Release 150.0
GSS Sequences (Part 1)
87189 loci, 64730126 bases, from 87189 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "131" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New Linetype for Genome Project Identifier
DDBJ, EMBL, and GenBank are working to create a collaborative system that
will assign a unique numeric identifier to genome projects. The purpose of
this new identifier is to provide a link among sequence records that pertain
to a specific genome sequencing project.
At GenBank, this new identifier will be presented in the flatfile format
via a new linetype : PROJECT . Here is a mocked-up example demonstrating
the new linetype's use:
LOCUS CH476840 1669278 bp DNA linear CON 05-OCT-2005
DEFINITION Magnaporthe grisea 70-15 supercont5.200 genomic scaffold, whole
genome shotgun sequence.
ACCESSION CH476840 AACU02000000
VERSION CH476840.1 GI:77022292
PROJECT GENOME_PROJECT:12345
The integer 12345 represents the value of a possible genome project
identifier.
There is a possibility that the contents of the PROJECT line might change
somewhat from this example by the time the new identifier is implemented.
We will keep you posted of any such changes via these release notes and the
GenBank listserv.
These Genome Project identifiers will be searchable within NCBI's
Entrez: Genome-Project database:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj
The earliest date on which this new linetype will appear in the GenBank
flatfile format is February 15 2006.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 854 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut28.idx - Index of the entries according to accession number, part 28.
23. gbaut29.idx - Index of the entries according to accession number, part 29.
24. gbaut3.idx - Index of the entries according to accession number, part 3.
25. gbaut30.idx - Index of the entries according to accession number, part 30.
26. gbaut31.idx - Index of the entries according to accession number, part 31.
27. gbaut32.idx - Index of the entries according to accession number, part 32.
28. gbaut4.idx - Index of the entries according to accession number, part 4.
29. gbaut5.idx - Index of the entries according to accession number, part 5.
30. gbaut6.idx - Index of the entries according to accession number, part 6.
31. gbaut7.idx - Index of the entries according to accession number, part 7.
32. gbaut8.idx - Index of the entries according to accession number, part 8.
33. gbaut9.idx - Index of the entries according to accession number, part 9.
34. gbbct1.seq - Bacterial sequence entries, part 1.
35. gbbct10.seq - Bacterial sequence entries, part 10.
36. gbbct11.seq - Bacterial sequence entries, part 11.
37. gbbct12.seq - Bacterial sequence entries, part 12.
38. gbbct2.seq - Bacterial sequence entries, part 2.
39. gbbct3.seq - Bacterial sequence entries, part 3.
40. gbbct4.seq - Bacterial sequence entries, part 4.
41. gbbct5.seq - Bacterial sequence entries, part 5.
42. gbbct6.seq - Bacterial sequence entries, part 6.
43. gbbct7.seq - Bacterial sequence entries, part 7.
44. gbbct8.seq - Bacterial sequence entries, part 8.
45. gbbct9.seq - Bacterial sequence entries, part 9.
46. gbchg.txt - Accession numbers of entries updated since the previous release.
47. gbcon.seq - Constructed sequence entries.
48. gbdel.txt - Accession numbers of entries deleted since the previous release.
49. gbenv1.seq - Environmental sampling sequence entries, part 1.
50. gbenv2.seq - Environmental sampling sequence entries, part 2.
51. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
52. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
53. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
54. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
55. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
56. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
57. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
58. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
59. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
60. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
61. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
62. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
63. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
64. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
65. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
66. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
67. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
68. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
69. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
70. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
71. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
72. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
73. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
74. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
75. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
76. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
77. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
78. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
79. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
80. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
81. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
82. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
83. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
84. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
85. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
86. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
87. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
88. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
89. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
90. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
91. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
92. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
93. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
94. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
95. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
96. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
97. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
98. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
99. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
100. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
101. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
102. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
103. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
104. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
105. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
106. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
107. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
108. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
109. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
110. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
111. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
112. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
113. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
114. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
115. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
116. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
117. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
118. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
119. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
120. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
121. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
122. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
123. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
124. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
125. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
126. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
127. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
128. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
129. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
130. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
131. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
132. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
133. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
134. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
135. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
136. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
137. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
138. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
139. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
140. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
141. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
142. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
143. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
144. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
145. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
146. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
147. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
148. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
149. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
150. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
151. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
152. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
153. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
154. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
155. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
156. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
157. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
158. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
159. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
160. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
161. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
162. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
163. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
164. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
165. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
166. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
167. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
168. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
169. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
170. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
171. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
172. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
173. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
174. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
175. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
176. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
177. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
178. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
179. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
180. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
181. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
182. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
183. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
184. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
185. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
186. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
187. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
188. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
189. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
190. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
191. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
192. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
193. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
194. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
195. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
196. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
197. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
198. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
199. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
200. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
201. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
202. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
203. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
204. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
205. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
206. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
207. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
208. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
209. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
210. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
211. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
212. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
213. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
214. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
215. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
216. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
217. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
218. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
219. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
220. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
221. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
222. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
223. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
224. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
225. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
226. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
227. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
228. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
229. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
230. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
231. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
232. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
233. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
234. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
235. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
236. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
237. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
238. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
239. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
240. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
241. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
242. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
243. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
244. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
245. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
246. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
247. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
248. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
249. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
250. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
251. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
252. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
253. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
254. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
255. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
256. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
257. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
258. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
259. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
260. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
261. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
262. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
263. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
264. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
265. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
266. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
267. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
268. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
269. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
270. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
271. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
272. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
273. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
274. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
275. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
276. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
277. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
278. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
279. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
280. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
281. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
282. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
283. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
284. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
285. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
286. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
287. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
288. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
289. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
290. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
291. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
292. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
293. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
294. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
295. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
296. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
297. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
298. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
299. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
300. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
301. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
302. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
303. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
304. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
305. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
306. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
307. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
308. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
309. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
310. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
311. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
312. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
313. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
314. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
315. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
316. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
317. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
318. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
319. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
320. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
321. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
322. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
323. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
324. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
325. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
326. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
327. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
328. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
329. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
330. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
331. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
332. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
333. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
334. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
335. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
336. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
337. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
338. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
339. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
340. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
341. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
342. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
343. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
344. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
345. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
346. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
347. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
348. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
349. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
350. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
351. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
352. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
353. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
354. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
355. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
356. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
357. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
358. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
359. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
360. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
361. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
362. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
363. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
364. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
365. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
366. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
367. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
368. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
369. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
370. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
371. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
372. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
373. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
374. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
375. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
376. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
377. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
378. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
379. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
380. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
381. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
382. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
383. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
384. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
385. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
386. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
387. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
388. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
389. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
390. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
391. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
392. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
393. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
394. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
395. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
396. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
397. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
398. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
399. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
400. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
401. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
402. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
403. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
404. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
405. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
406. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
407. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
408. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
409. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
410. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
411. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
412. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
413. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
414. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
415. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
416. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
417. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
418. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
419. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
420. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
421. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
422. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
423. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
424. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
425. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
426. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
427. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
428. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
429. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
430. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
431. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
432. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
433. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
434. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
435. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
436. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
437. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
438. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
439. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
440. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
441. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
442. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
443. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
444. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
445. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
446. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
447. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
448. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
449. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
450. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
451. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
452. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
453. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
454. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
455. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
456. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
457. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
458. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
459. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
460. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
461. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
462. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
463. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
464. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
465. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
466. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
467. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
468. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
469. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
470. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
471. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
472. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
473. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
474. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
475. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
476. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
477. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
478. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
479. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
480. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
481. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
482. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
483. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
484. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
485. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
486. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
487. gbgen.idx - Index of the entries according to gene symbols.
488. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
489. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
490. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
491. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
492. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
493. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
494. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
495. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
496. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
497. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
498. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
499. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
500. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
501. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
502. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
503. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
504. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
505. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
506. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
507. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
508. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
509. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
510. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
511. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
512. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
513. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
514. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
515. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
516. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
517. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
518. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
519. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
520. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
521. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
522. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
523. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
524. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
525. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
526. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
527. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
528. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
529. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
530. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
531. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
532. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
533. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
534. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
535. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
536. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
537. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
538. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
539. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
540. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
541. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
542. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
543. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
544. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
545. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
546. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
547. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
548. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
549. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
550. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
551. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
552. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
553. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
554. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
555. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
556. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
557. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
558. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
559. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
560. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
561. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
562. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
563. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
564. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
565. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
566. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
567. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
568. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
569. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
570. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
571. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
572. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
573. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
574. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
575. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
576. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
577. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
578. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
579. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
580. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
581. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
582. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
583. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
584. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
585. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
586. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
587. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
588. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
589. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
590. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
591. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
592. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
593. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
594. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
595. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
596. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
597. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
598. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
599. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
600. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
601. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
602. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
603. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
604. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
605. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
606. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
607. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
608. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
609. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
610. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
611. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
612. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
613. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
614. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
615. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
616. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
617. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
618. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
619. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
620. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
621. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
622. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
623. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
624. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
625. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
626. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
627. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
628. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
629. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
630. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
631. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
632. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
633. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
634. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
635. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
636. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
637. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
638. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
639. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
640. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
641. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
642. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
643. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
644. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
645. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
646. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
647. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
648. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
649. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
650. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
651. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
652. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
653. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
654. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
655. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
656. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
657. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
658. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
659. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
660. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
661. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
662. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
663. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
664. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
665. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
666. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
667. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
668. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
669. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
670. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
671. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
672. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
673. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
674. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
675. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
676. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
677. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
678. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
679. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
680. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
681. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
682. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
683. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
684. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
685. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
686. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
687. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
688. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
689. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
690. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
691. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
692. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
693. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
694. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
695. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
696. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
697. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
698. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
699. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
700. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
701. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
702. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
703. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
704. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
705. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
706. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
707. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
708. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
709. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
710. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
711. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
712. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
713. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
714. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
715. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
716. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
717. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
718. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
719. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
720. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
721. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
722. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
723. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
724. gbinv1.seq - Invertebrate sequence entries, part 1.
725. gbinv2.seq - Invertebrate sequence entries, part 2.
726. gbinv3.seq - Invertebrate sequence entries, part 3.
727. gbinv4.seq - Invertebrate sequence entries, part 4.
728. gbinv5.seq - Invertebrate sequence entries, part 5.
729. gbinv6.seq - Invertebrate sequence entries, part 6.
730. gbinv7.seq - Invertebrate sequence entries, part 7.
731. gbinv8.seq - Invertebrate sequence entries, part 8.
732. gbjou.idx - Index of the entries according to journal citation.
733. gbmam1.seq - Other mammalian sequence entries, part 1.
734. gbmam2.seq - Other mammalian sequence entries, part 2.
735. gbnew.txt - Accession numbers of entries new since the previous release.
736. gbpat1.seq - Patent sequence entries, part 1.
737. gbpat10.seq - Patent sequence entries, part 10.
738. gbpat11.seq - Patent sequence entries, part 11.
739. gbpat12.seq - Patent sequence entries, part 12.
740. gbpat13.seq - Patent sequence entries, part 13.
741. gbpat14.seq - Patent sequence entries, part 14.
742. gbpat15.seq - Patent sequence entries, part 15.
743. gbpat16.seq - Patent sequence entries, part 16.
744. gbpat17.seq - Patent sequence entries, part 17.
745. gbpat18.seq - Patent sequence entries, part 18.
746. gbpat2.seq - Patent sequence entries, part 2.
747. gbpat3.seq - Patent sequence entries, part 3.
748. gbpat4.seq - Patent sequence entries, part 4.
749. gbpat5.seq - Patent sequence entries, part 5.
750. gbpat6.seq - Patent sequence entries, part 6.
751. gbpat7.seq - Patent sequence entries, part 7.
752. gbpat8.seq - Patent sequence entries, part 8.
753. gbpat9.seq - Patent sequence entries, part 9.
754. gbphg.seq - Phage sequence entries.
755. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
756. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
757. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
758. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
759. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
760. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
761. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
762. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
763. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
764. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
765. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
766. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
767. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
768. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
769. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
770. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
771. gbpri1.seq - Primate sequence entries, part 1.
772. gbpri10.seq - Primate sequence entries, part 10.
773. gbpri11.seq - Primate sequence entries, part 11.
774. gbpri12.seq - Primate sequence entries, part 12.
775. gbpri13.seq - Primate sequence entries, part 13.
776. gbpri14.seq - Primate sequence entries, part 14.
777. gbpri15.seq - Primate sequence entries, part 15.
778. gbpri16.seq - Primate sequence entries, part 16.
779. gbpri17.seq - Primate sequence entries, part 17.
780. gbpri18.seq - Primate sequence entries, part 18.
781. gbpri19.seq - Primate sequence entries, part 19.
782. gbpri2.seq - Primate sequence entries, part 2.
783. gbpri20.seq - Primate sequence entries, part 20.
784. gbpri21.seq - Primate sequence entries, part 21.
785. gbpri22.seq - Primate sequence entries, part 22.
786. gbpri23.seq - Primate sequence entries, part 23.
787. gbpri24.seq - Primate sequence entries, part 24.
788. gbpri25.seq - Primate sequence entries, part 25.
789. gbpri26.seq - Primate sequence entries, part 26.
790. gbpri27.seq - Primate sequence entries, part 27.
791. gbpri28.seq - Primate sequence entries, part 28.
792. gbpri29.seq - Primate sequence entries, part 29.
793. gbpri3.seq - Primate sequence entries, part 3.
794. gbpri4.seq - Primate sequence entries, part 4.
795. gbpri5.seq - Primate sequence entries, part 5.
796. gbpri6.seq - Primate sequence entries, part 6.
797. gbpri7.seq - Primate sequence entries, part 7.
798. gbpri8.seq - Primate sequence entries, part 8.
799. gbpri9.seq - Primate sequence entries, part 9.
800. gbrel.txt - Release notes (this document).
801. gbrod1.seq - Rodent sequence entries, part 1.
802. gbrod10.seq - Rodent sequence entries, part 10.
803. gbrod11.seq - Rodent sequence entries, part 11.
804. gbrod12.seq - Rodent sequence entries, part 12.
805. gbrod13.seq - Rodent sequence entries, part 13.
806. gbrod14.seq - Rodent sequence entries, part 14.
807. gbrod15.seq - Rodent sequence entries, part 15.
808. gbrod16.seq - Rodent sequence entries, part 16.
809. gbrod17.seq - Rodent sequence entries, part 17.
810. gbrod18.seq - Rodent sequence entries, part 18.
811. gbrod19.seq - Rodent sequence entries, part 19.
812. gbrod2.seq - Rodent sequence entries, part 2.
813. gbrod20.seq - Rodent sequence entries, part 20.
814. gbrod21.seq - Rodent sequence entries, part 21.
815. gbrod3.seq - Rodent sequence entries, part 3.
816. gbrod4.seq - Rodent sequence entries, part 4.
817. gbrod5.seq - Rodent sequence entries, part 5.
818. gbrod6.seq - Rodent sequence entries, part 6.
819. gbrod7.seq - Rodent sequence entries, part 7.
820. gbrod8.seq - Rodent sequence entries, part 8.
821. gbrod9.seq - Rodent sequence entries, part 9.
822. gbsdr.txt - Short directory of the data bank.
823. gbsec.idx - Index of the entries according to secondary accession number.
824. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
825. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
826. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
827. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
828. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
829. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
830. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
831. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
832. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
833. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
834. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
835. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
836. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
837. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
838. gbsyn.seq - Synthetic and chimeric sequence entries.
839. gbuna.seq - Unannotated sequence entries.
840. gbvrl1.seq - Viral sequence entries, part 1.
841. gbvrl2.seq - Viral sequence entries, part 2.
842. gbvrl3.seq - Viral sequence entries, part 3.
843. gbvrl4.seq - Viral sequence entries, part 4.
844. gbvrl5.seq - Viral sequence entries, part 5.
845. gbvrt1.seq - Other vertebrate sequence entries, part 1.
846. gbvrt10.seq - Other vertebrate sequence entries, part 10.
847. gbvrt2.seq - Other vertebrate sequence entries, part 2.
848. gbvrt3.seq - Other vertebrate sequence entries, part 3.
849. gbvrt4.seq - Other vertebrate sequence entries, part 4.
850. gbvrt5.seq - Other vertebrate sequence entries, part 5.
851. gbvrt6.seq - Other vertebrate sequence entries, part 6.
852. gbvrt7.seq - Other vertebrate sequence entries, part 7.
853. gbvrt8.seq - Other vertebrate sequence entries, part 8.
854. gbvrt9.seq - Other vertebrate sequence entries, part 9.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 150.0 flatfiles require roughly 187 GB (sequence
files only) or 205 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1516340780 gbacc.idx
518929090 gbaut1.idx
515042461 gbaut10.idx
500011496 gbaut11.idx
500531754 gbaut12.idx
518251405 gbaut13.idx
501100561 gbaut14.idx
501788507 gbaut15.idx
509307899 gbaut16.idx
506037694 gbaut17.idx
500705600 gbaut18.idx
505116675 gbaut19.idx
519045223 gbaut2.idx
500366560 gbaut20.idx
503245430 gbaut21.idx
505548764 gbaut22.idx
503006989 gbaut23.idx
518726284 gbaut24.idx
521236865 gbaut25.idx
520681068 gbaut26.idx
516172062 gbaut27.idx
506163124 gbaut28.idx
500194127 gbaut29.idx
509911730 gbaut3.idx
502156084 gbaut30.idx
512250469 gbaut31.idx
307575683 gbaut32.idx
500642929 gbaut4.idx
515323648 gbaut5.idx
502781335 gbaut6.idx
511176675 gbaut7.idx
501267479 gbaut8.idx
515600545 gbaut9.idx
252397032 gbbct1.seq
250059344 gbbct10.seq
250144373 gbbct11.seq
119820585 gbbct12.seq
250203372 gbbct2.seq
250672887 gbbct3.seq
250001087 gbbct4.seq
250534275 gbbct5.seq
250001643 gbbct6.seq
250001896 gbbct7.seq
250325071 gbbct8.seq
255013238 gbbct9.seq
11859646 gbchg.txt
841885826 gbcon.seq
73538 gbdel.txt
250001010 gbenv1.seq
243077868 gbenv2.seq
230688425 gbest1.seq
230687597 gbest10.seq
230687648 gbest100.seq
230687900 gbest101.seq
230689174 gbest102.seq
230687856 gbest103.seq
230688520 gbest104.seq
230687975 gbest105.seq
230689669 gbest106.seq
230690098 gbest107.seq
230688310 gbest108.seq
230688667 gbest109.seq
230687816 gbest11.seq
230689796 gbest110.seq
230688387 gbest111.seq
230689245 gbest112.seq
230689753 gbest113.seq
230689053 gbest114.seq
230688620 gbest115.seq
230688699 gbest116.seq
230690226 gbest117.seq
230687563 gbest118.seq
230688163 gbest119.seq
230687685 gbest12.seq
230689423 gbest120.seq
230688833 gbest121.seq
230688747 gbest122.seq
230689898 gbest123.seq
230689014 gbest124.seq
230688831 gbest125.seq
230689900 gbest126.seq
230688934 gbest127.seq
230689259 gbest128.seq
230689923 gbest129.seq
230688069 gbest13.seq
230688022 gbest130.seq
230690515 gbest131.seq
230689648 gbest132.seq
230689767 gbest133.seq
230687803 gbest134.seq
230690541 gbest135.seq
230690449 gbest136.seq
230689126 gbest137.seq
230688586 gbest138.seq
230691385 gbest139.seq
230689688 gbest14.seq
230689063 gbest140.seq
230688972 gbest141.seq
230690138 gbest142.seq
230688516 gbest143.seq
230689072 gbest144.seq
230688606 gbest145.seq
230688036 gbest146.seq
230688745 gbest147.seq
230688541 gbest148.seq
230687917 gbest149.seq
230689253 gbest15.seq
230690186 gbest150.seq
230691324 gbest151.seq
230688133 gbest152.seq
230691638 gbest153.seq
230691599 gbest154.seq
230690054 gbest155.seq
230689689 gbest156.seq
230688218 gbest157.seq
230689193 gbest158.seq
230688766 gbest159.seq
230688960 gbest16.seq
230690660 gbest160.seq
230688589 gbest161.seq
230690676 gbest162.seq
230689768 gbest163.seq
230689981 gbest164.seq
230690257 gbest165.seq
230688170 gbest166.seq
230689214 gbest167.seq
230689433 gbest168.seq
230687666 gbest169.seq
230689258 gbest17.seq
230689171 gbest170.seq
225594256 gbest171.seq
230687705 gbest172.seq
230687578 gbest173.seq
230688041 gbest174.seq
230689747 gbest175.seq
230687696 gbest176.seq
230688335 gbest177.seq
230687720 gbest178.seq
230690442 gbest179.seq
230689487 gbest18.seq
230688466 gbest180.seq
230687887 gbest181.seq
230689261 gbest182.seq
230688671 gbest183.seq
230688026 gbest184.seq
230690258 gbest185.seq
230687879 gbest186.seq
230687644 gbest187.seq
230687736 gbest188.seq
230688292 gbest189.seq
230687919 gbest19.seq
230688486 gbest190.seq
230688644 gbest191.seq
230687782 gbest192.seq
230688416 gbest193.seq
230690257 gbest194.seq
230690797 gbest195.seq
230688202 gbest196.seq
230690191 gbest197.seq
230688989 gbest198.seq
230688141 gbest199.seq
230689482 gbest2.seq
230688549 gbest20.seq
230689896 gbest200.seq
230690230 gbest201.seq
230690199 gbest202.seq
230687638 gbest203.seq
230687580 gbest204.seq
230688523 gbest205.seq
230688524 gbest206.seq
230688039 gbest207.seq
230689411 gbest208.seq
230687508 gbest209.seq
230691433 gbest21.seq
230688449 gbest210.seq
230689202 gbest211.seq
230689050 gbest212.seq
230689644 gbest213.seq
230689574 gbest214.seq
230689305 gbest215.seq
230689981 gbest216.seq
230690226 gbest217.seq
230688410 gbest218.seq
230689607 gbest219.seq
230688212 gbest22.seq
230687637 gbest220.seq
163212760 gbest221.seq
162070051 gbest222.seq
168010581 gbest223.seq
167716973 gbest224.seq
169613041 gbest225.seq
164868332 gbest226.seq
164935341 gbest227.seq
164498817 gbest228.seq
164368329 gbest229.seq
230689496 gbest23.seq
164398259 gbest230.seq
164538357 gbest231.seq
163490074 gbest232.seq
166039079 gbest233.seq
165081385 gbest234.seq
161997229 gbest235.seq
164312619 gbest236.seq
169037519 gbest237.seq
166876078 gbest238.seq
165625223 gbest239.seq
230687858 gbest24.seq
165769269 gbest240.seq
165372370 gbest241.seq
164844016 gbest242.seq
164219629 gbest243.seq
164355373 gbest244.seq
165334973 gbest245.seq
170752728 gbest246.seq
178017653 gbest247.seq
171476677 gbest248.seq
220414324 gbest249.seq
230690818 gbest25.seq
230687897 gbest250.seq
230689354 gbest251.seq
230688170 gbest252.seq
230690026 gbest253.seq
230689830 gbest254.seq
230689507 gbest255.seq
230689990 gbest256.seq
230688115 gbest257.seq
230688733 gbest258.seq
230689409 gbest259.seq
230689391 gbest26.seq
230690795 gbest260.seq
230688372 gbest261.seq
230688314 gbest262.seq
230690776 gbest263.seq
230689750 gbest264.seq
230689248 gbest265.seq
230689913 gbest266.seq
230690574 gbest267.seq
230690820 gbest268.seq
230689272 gbest269.seq
230689361 gbest27.seq
230688734 gbest270.seq
230688459 gbest271.seq
230689690 gbest272.seq
230689296 gbest273.seq
230689106 gbest274.seq
230690137 gbest275.seq
230689826 gbest276.seq
230688370 gbest277.seq
214957792 gbest278.seq
228468849 gbest279.seq
230689420 gbest28.seq
230687550 gbest280.seq
230688783 gbest281.seq
230688668 gbest282.seq
230688124 gbest283.seq
230690324 gbest284.seq
230687705 gbest285.seq
230687509 gbest286.seq
230687446 gbest287.seq
230688413 gbest288.seq
230688958 gbest289.seq
230688925 gbest29.seq
230690672 gbest290.seq
230689389 gbest291.seq
230689194 gbest292.seq
230687500 gbest293.seq
230687493 gbest294.seq
230688005 gbest295.seq
230689131 gbest296.seq
230689686 gbest297.seq
230689770 gbest298.seq
230689876 gbest299.seq
230687569 gbest3.seq
230689313 gbest30.seq
230689637 gbest300.seq
230689614 gbest301.seq
230689606 gbest302.seq
230354220 gbest303.seq
230687872 gbest304.seq
230689444 gbest305.seq
230689466 gbest306.seq
230688291 gbest307.seq
230689757 gbest308.seq
230688977 gbest309.seq
230690757 gbest31.seq
230689477 gbest310.seq
212509080 gbest311.seq
230690992 gbest312.seq
230688404 gbest313.seq
230688372 gbest314.seq
230689568 gbest315.seq
230688787 gbest316.seq
186073627 gbest317.seq
144257045 gbest318.seq
230689397 gbest319.seq
230689634 gbest32.seq
230688861 gbest320.seq
230688925 gbest321.seq
230689479 gbest322.seq
230689229 gbest323.seq
230687710 gbest324.seq
230688684 gbest325.seq
230690055 gbest326.seq
230689321 gbest327.seq
230689262 gbest328.seq
230689011 gbest329.seq
230687547 gbest33.seq
230688562 gbest330.seq
230687839 gbest331.seq
230687675 gbest332.seq
230690431 gbest333.seq
230691222 gbest334.seq
230689388 gbest335.seq
230688419 gbest336.seq
230688383 gbest337.seq
230687735 gbest338.seq
230689751 gbest339.seq
230688689 gbest34.seq
230687551 gbest340.seq
230689399 gbest341.seq
230689776 gbest342.seq
230689315 gbest343.seq
230691235 gbest344.seq
230688389 gbest345.seq
230687997 gbest346.seq
230688293 gbest347.seq
230689512 gbest348.seq
230688294 gbest349.seq
230687450 gbest35.seq
230694011 gbest350.seq
230690869 gbest351.seq
230691616 gbest352.seq
230688380 gbest353.seq
230689693 gbest354.seq
230690271 gbest355.seq
230689009 gbest356.seq
230687572 gbest357.seq
230689980 gbest358.seq
230689957 gbest359.seq
230687444 gbest36.seq
230689683 gbest360.seq
222205636 gbest361.seq
230690450 gbest362.seq
230690756 gbest363.seq
230687528 gbest364.seq
230691276 gbest365.seq
230691016 gbest366.seq
230688411 gbest367.seq
206826787 gbest368.seq
230688045 gbest369.seq
230688002 gbest37.seq
230689718 gbest370.seq
230688698 gbest371.seq
230688874 gbest372.seq
230688145 gbest373.seq
230688753 gbest374.seq
230688257 gbest375.seq
230688810 gbest376.seq
230687965 gbest377.seq
230688581 gbest378.seq
230687957 gbest379.seq
230689626 gbest38.seq
230687592 gbest380.seq
230689200 gbest381.seq
230690133 gbest382.seq
230688005 gbest383.seq
230688212 gbest384.seq
230688561 gbest385.seq
230688475 gbest386.seq
230688632 gbest387.seq
230691712 gbest388.seq
230688727 gbest389.seq
230688228 gbest39.seq
230687572 gbest390.seq
230689747 gbest391.seq
230688982 gbest392.seq
230689602 gbest393.seq
230688074 gbest394.seq
230689577 gbest395.seq
230690131 gbest396.seq
230690876 gbest397.seq
230688586 gbest398.seq
230688241 gbest399.seq
230687842 gbest4.seq
196456539 gbest40.seq
230688028 gbest400.seq
230688778 gbest401.seq
230691011 gbest402.seq
230690497 gbest403.seq
230689716 gbest404.seq
230689169 gbest405.seq
230688762 gbest406.seq
230688762 gbest407.seq
230691756 gbest408.seq
230688964 gbest409.seq
191760989 gbest41.seq
230690245 gbest410.seq
230690425 gbest411.seq
230688077 gbest412.seq
230688279 gbest413.seq
230688860 gbest414.seq
230687745 gbest415.seq
230690082 gbest416.seq
230688558 gbest417.seq
230691298 gbest418.seq
230690615 gbest419.seq
203519394 gbest42.seq
230690113 gbest420.seq
230689483 gbest421.seq
230689631 gbest422.seq
227484633 gbest423.seq
230690758 gbest424.seq
230687860 gbest425.seq
230688248 gbest426.seq
230688349 gbest427.seq
230688222 gbest428.seq
230690002 gbest429.seq
214922754 gbest43.seq
230690676 gbest430.seq
230687717 gbest431.seq
230689725 gbest432.seq
230690422 gbest433.seq
230508929 gbest434.seq
230688359 gbest435.seq
109160299 gbest436.seq
216304215 gbest44.seq
216286911 gbest45.seq
216578576 gbest46.seq
230687613 gbest47.seq
230688182 gbest48.seq
219994945 gbest49.seq
164950269 gbest5.seq
230688370 gbest50.seq
230688959 gbest51.seq
230690628 gbest52.seq
230689138 gbest53.seq
230687712 gbest54.seq
230689693 gbest55.seq
230689191 gbest56.seq
230687783 gbest57.seq
230692214 gbest58.seq
230690585 gbest59.seq
177138923 gbest6.seq
230688693 gbest60.seq
230690206 gbest61.seq
230687705 gbest62.seq
230688531 gbest63.seq
230689382 gbest64.seq
228680361 gbest65.seq
209825024 gbest66.seq
209188599 gbest67.seq
208881355 gbest68.seq
209165395 gbest69.seq
230688093 gbest7.seq
210399212 gbest70.seq
209805168 gbest71.seq
208652089 gbest72.seq
209420928 gbest73.seq
210543066 gbest74.seq
206392569 gbest75.seq
206744002 gbest76.seq
208152459 gbest77.seq
208610675 gbest78.seq
215481179 gbest79.seq
230690240 gbest8.seq
230688364 gbest80.seq
230692549 gbest81.seq
230692364 gbest82.seq
216809973 gbest83.seq
214787162 gbest84.seq
216903992 gbest85.seq
230688291 gbest86.seq
230689551 gbest87.seq
230688044 gbest88.seq
230688069 gbest89.seq
230689340 gbest9.seq
230689397 gbest90.seq
230690139 gbest91.seq
230687773 gbest92.seq
230690044 gbest93.seq
230691136 gbest94.seq
230689002 gbest95.seq
230689130 gbest96.seq
230688290 gbest97.seq
230690053 gbest98.seq
230689343 gbest99.seq
49363682 gbgen.idx
230689539 gbgss1.seq
230687499 gbgss10.seq
227251108 gbgss100.seq
228367634 gbgss101.seq
228713725 gbgss102.seq
228640826 gbgss103.seq
227919245 gbgss104.seq
227430192 gbgss105.seq
230688069 gbgss106.seq
230689047 gbgss107.seq
230687486 gbgss108.seq
230688362 gbgss109.seq
230691316 gbgss11.seq
230690164 gbgss110.seq
230688555 gbgss111.seq
230687451 gbgss112.seq
230687652 gbgss113.seq
230689607 gbgss114.seq
230687541 gbgss115.seq
230688016 gbgss116.seq
230689794 gbgss117.seq
230689324 gbgss118.seq
230687695 gbgss119.seq
230688172 gbgss12.seq
230688668 gbgss120.seq
230688426 gbgss121.seq
230689940 gbgss122.seq
230687756 gbgss123.seq
230689294 gbgss124.seq
230688046 gbgss125.seq
230687803 gbgss126.seq
230689706 gbgss127.seq
230689128 gbgss128.seq
230687885 gbgss129.seq
230690677 gbgss13.seq
80128793 gbgss130.seq
250001848 gbgss131.seq
250000462 gbgss132.seq
250000318 gbgss133.seq
250001515 gbgss134.seq
250002078 gbgss135.seq
250000207 gbgss136.seq
250000140 gbgss137.seq
250001789 gbgss138.seq
250002453 gbgss139.seq
230689721 gbgss14.seq
250001461 gbgss140.seq
250000233 gbgss141.seq
250002079 gbgss142.seq
250001527 gbgss143.seq
250001663 gbgss144.seq
250000534 gbgss145.seq
250001248 gbgss146.seq
250003779 gbgss147.seq
250000537 gbgss148.seq
250001206 gbgss149.seq
230689022 gbgss15.seq
250002227 gbgss150.seq
250000756 gbgss151.seq
250000483 gbgss152.seq
250002436 gbgss153.seq
250002709 gbgss154.seq
250002467 gbgss155.seq
250002177 gbgss156.seq
250000427 gbgss157.seq
39685067 gbgss158.seq
230689951 gbgss16.seq
230689464 gbgss17.seq
230688642 gbgss18.seq
230687507 gbgss19.seq
230689883 gbgss2.seq
230690121 gbgss20.seq
230690586 gbgss21.seq
230687634 gbgss22.seq
230688996 gbgss23.seq
230687856 gbgss24.seq
230689792 gbgss25.seq
230688723 gbgss26.seq
230690585 gbgss27.seq
230690367 gbgss28.seq
230689954 gbgss29.seq
230688931 gbgss3.seq
230689958 gbgss30.seq
230689859 gbgss31.seq
230688251 gbgss32.seq
230689234 gbgss33.seq
230690589 gbgss34.seq
230690074 gbgss35.seq
230688762 gbgss36.seq
230689063 gbgss37.seq
230687704 gbgss38.seq
230689672 gbgss39.seq
230689635 gbgss4.seq
230687793 gbgss40.seq
230687835 gbgss41.seq
230689901 gbgss42.seq
230687696 gbgss43.seq
230687984 gbgss44.seq
230689471 gbgss45.seq
230688866 gbgss46.seq
230687830 gbgss47.seq
230689602 gbgss48.seq
230690745 gbgss49.seq
230689060 gbgss5.seq
230687781 gbgss50.seq
230688676 gbgss51.seq
230688321 gbgss52.seq
230688221 gbgss53.seq
230688705 gbgss54.seq
230689073 gbgss55.seq
230688410 gbgss56.seq
230689869 gbgss57.seq
230689007 gbgss58.seq
230688720 gbgss59.seq
230690103 gbgss6.seq
230688494 gbgss60.seq
229363978 gbgss61.seq
230689503 gbgss62.seq
230689995 gbgss63.seq
230688986 gbgss64.seq
230689020 gbgss65.seq
230687889 gbgss66.seq
230687475 gbgss67.seq
230688641 gbgss68.seq
230688207 gbgss69.seq
230688253 gbgss7.seq
230688475 gbgss70.seq
230689492 gbgss71.seq
230688522 gbgss72.seq
230688998 gbgss73.seq
230687990 gbgss74.seq
230689745 gbgss75.seq
230689674 gbgss76.seq
230689689 gbgss77.seq
230687582 gbgss78.seq
230689864 gbgss79.seq
230688823 gbgss8.seq
230687821 gbgss80.seq
198947333 gbgss81.seq
194747376 gbgss82.seq
220402445 gbgss83.seq
230687779 gbgss84.seq
230687671 gbgss85.seq
230687600 gbgss86.seq
230689176 gbgss87.seq
230687854 gbgss88.seq
230687519 gbgss89.seq
230690336 gbgss9.seq
230690209 gbgss90.seq
230688489 gbgss91.seq
230688080 gbgss92.seq
230689303 gbgss93.seq
230688702 gbgss94.seq
230689884 gbgss95.seq
230688693 gbgss96.seq
230688823 gbgss97.seq
230689044 gbgss98.seq
230688082 gbgss99.seq
250001803 gbhtc1.seq
59047178 gbhtc10.seq
250003822 gbhtc2.seq
250014376 gbhtc3.seq
250007672 gbhtc4.seq
250001304 gbhtc5.seq
250002020 gbhtc6.seq
250001331 gbhtc7.seq
250002267 gbhtc8.seq
250002435 gbhtc9.seq
250063914 gbhtg1.seq
250100408 gbhtg10.seq
250023352 gbhtg11.seq
250027159 gbhtg12.seq
250167427 gbhtg13.seq
250315118 gbhtg14.seq
250158431 gbhtg15.seq
250258507 gbhtg16.seq
250084566 gbhtg17.seq
250197154 gbhtg18.seq
250196119 gbhtg19.seq
250005030 gbhtg2.seq
250143707 gbhtg20.seq
250266508 gbhtg21.seq
250050855 gbhtg22.seq
250214154 gbhtg23.seq
250005611 gbhtg24.seq
250310504 gbhtg25.seq
250247948 gbhtg26.seq
250064688 gbhtg27.seq
250265505 gbhtg28.seq
250109955 gbhtg29.seq
250067288 gbhtg3.seq
250357168 gbhtg30.seq
250064968 gbhtg31.seq
250009372 gbhtg32.seq
250307540 gbhtg33.seq
250102394 gbhtg34.seq
250210047 gbhtg35.seq
250066131 gbhtg36.seq
250242542 gbhtg37.seq
250276064 gbhtg38.seq
250114165 gbhtg39.seq
250174052 gbhtg4.seq
250247582 gbhtg40.seq
250043320 gbhtg41.seq
250211410 gbhtg42.seq
250024213 gbhtg43.seq
250119942 gbhtg44.seq
250164605 gbhtg45.seq
250161336 gbhtg46.seq
250105621 gbhtg47.seq
250206221 gbhtg48.seq
250191214 gbhtg49.seq
250092782 gbhtg5.seq
250000317 gbhtg50.seq
250135208 gbhtg51.seq
250191609 gbhtg52.seq
250075461 gbhtg53.seq
250092290 gbhtg54.seq
250077325 gbhtg55.seq
250241670 gbhtg56.seq
250129206 gbhtg57.seq
250120522 gbhtg58.seq
250106141 gbhtg59.seq
250120763 gbhtg6.seq
250037685 gbhtg60.seq
250126009 gbhtg61.seq
250248671 gbhtg62.seq
250058825 gbhtg63.seq
250211400 gbhtg64.seq
250061216 gbhtg65.seq
250219278 gbhtg66.seq
250015159 gbhtg67.seq
201691285 gbhtg68.seq
250107091 gbhtg7.seq
250173070 gbhtg8.seq
250028325 gbhtg9.seq
250047934 gbinv1.seq
250100271 gbinv2.seq
250001737 gbinv3.seq
250001206 gbinv4.seq
250001843 gbinv5.seq
250057589 gbinv6.seq
250026062 gbinv7.seq
41708671 gbinv8.seq
671760397 gbjou.idx
250001910 gbmam1.seq
123634974 gbmam2.seq
34944613 gbnew.txt
250000417 gbpat1.seq
250000771 gbpat10.seq
250003057 gbpat11.seq
250001463 gbpat12.seq
250001425 gbpat13.seq
250000747 gbpat14.seq
250000494 gbpat15.seq
250335055 gbpat16.seq
250000164 gbpat17.seq
233994058 gbpat18.seq
250000931 gbpat2.seq
250000557 gbpat3.seq
250000140 gbpat4.seq
250000307 gbpat5.seq
250049742 gbpat6.seq
250000306 gbpat7.seq
250000078 gbpat8.seq
250001326 gbpat9.seq
42599518 gbphg.seq
250004314 gbpln1.seq
250001283 gbpln10.seq
250000226 gbpln11.seq
250000975 gbpln12.seq
250003907 gbpln13.seq
250078492 gbpln14.seq
250191390 gbpln15.seq
235419586 gbpln16.seq
250098387 gbpln2.seq
250002144 gbpln3.seq
250003651 gbpln4.seq
250005291 gbpln5.seq
250003939 gbpln6.seq
250093940 gbpln7.seq
275670584 gbpln8.seq
250570165 gbpln9.seq
250160030 gbpri1.seq
250190943 gbpri10.seq
250080075 gbpri11.seq
250136929 gbpri12.seq
250190827 gbpri13.seq
250176316 gbpri14.seq
250220479 gbpri15.seq
250002008 gbpri16.seq
250183242 gbpri17.seq
250046612 gbpri18.seq
250019779 gbpri19.seq
250182735 gbpri2.seq
250151851 gbpri20.seq
250003800 gbpri21.seq
250005141 gbpri22.seq
250004176 gbpri23.seq
250028639 gbpri24.seq
250011422 gbpri25.seq
250064478 gbpri26.seq
250000930 gbpri27.seq
250001929 gbpri28.seq
72826826 gbpri29.seq
250193790 gbpri3.seq
250204692 gbpri4.seq
250172352 gbpri5.seq
250090245 gbpri6.seq
250054226 gbpri7.seq
250072244 gbpri8.seq
250199340 gbpri9.seq
208177 gbrel.txt
250063469 gbrod1.seq
250029526 gbrod10.seq
250186355 gbrod11.seq
250231188 gbrod12.seq
250054875 gbrod13.seq
250186066 gbrod14.seq
250001241 gbrod15.seq
250067394 gbrod16.seq
250192278 gbrod17.seq
250048075 gbrod18.seq
250008957 gbrod19.seq
250181553 gbrod2.seq
250231241 gbrod20.seq
204939333 gbrod21.seq
250144868 gbrod3.seq
250036653 gbrod4.seq
250089261 gbrod5.seq
250172063 gbrod6.seq
250033392 gbrod7.seq
250104364 gbrod8.seq
250212570 gbrod9.seq
3932248782 gbsdr.txt
1566058 gbsec.idx
250002508 gbsts1.seq
250003255 gbsts10.seq
250002897 gbsts11.seq
250001955 gbsts12.seq
250002161 gbsts13.seq
20582246 gbsts14.seq
250000493 gbsts2.seq
250001590 gbsts3.seq
250001812 gbsts4.seq
250003054 gbsts5.seq
250001547 gbsts6.seq
250001692 gbsts7.seq
250000160 gbsts8.seq
250002341 gbsts9.seq
103491591 gbsyn.seq
424442 gbuna.seq
250003022 gbvrl1.seq
250001332 gbvrl2.seq
250002499 gbvrl3.seq
250001776 gbvrl4.seq
102159216 gbvrl5.seq
250005130 gbvrt1.seq
27295276 gbvrt10.seq
250047029 gbvrt2.seq
250000770 gbvrt3.seq
250002575 gbvrt4.seq
250315238 gbvrt5.seq
250110189 gbvrt6.seq
250047461 gbvrt7.seq
250128992 gbvrt8.seq
250000036 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 24552 102802505
BCT10 454 109366700
BCT11 42289 92502325
BCT12 12484 43769089
BCT2 7477 107448276
BCT3 297 114527223
BCT4 27943 103023877
BCT5 30053 96207411
BCT6 60648 86367387
BCT7 8048 113574561
BCT8 4150 93432656
BCT9 2202 110488744
ENV1 96639 71171716
ENV2 91273 76154220
EST1 68034 26258363
EST10 76493 29723216
EST100 73317 36391107
EST101 72760 48446198
EST102 72792 42722837
EST103 69261 46296494
EST104 74077 33208256
EST105 70334 29616354
EST106 64300 31978923
EST107 68320 40723640
EST108 69608 38430347
EST109 70923 42028736
EST11 74698 28608637
EST110 75691 34152605
EST111 74659 27627456
EST112 75290 29348538
EST113 72601 39628514
EST114 65557 31910283
EST115 78948 48092396
EST116 78996 44680730
EST117 70649 46910621
EST118 69322 40298309
EST119 72519 49456798
EST12 77211 30612340
EST120 68361 42749959
EST121 73809 45205977
EST122 75777 44399537
EST123 71679 49153480
EST124 74720 48029046
EST125 76300 47018334
EST126 76884 32752216
EST127 78398 31544440
EST128 79884 47588431
EST129 74823 42662511
EST13 76235 29134866
EST130 64855 34950878
EST131 71661 37193354
EST132 67089 36882979
EST133 66142 36132584
EST134 71246 43983772
EST135 72820 44581772
EST136 67870 39712753
EST137 67210 39999654
EST138 77039 45933995
EST139 68755 40875153
EST14 77985 31416184
EST140 60136 34040014
EST141 99105 53907419
EST142 81694 46915077
EST143 87637 45512194
EST144 108731 57757918
EST145 105223 57105563
EST146 97179 55714645
EST147 76358 45564986
EST148 93646 55827830
EST149 100066 59206702
EST15 74272 31340841
EST150 86829 48654129
EST151 72247 43042917
EST152 64618 31480811
EST153 64327 29358580
EST154 52687 24612459
EST155 67058 32681058
EST156 59163 29945254
EST157 71626 41079394
EST158 69454 46901957
EST159 68829 48381365
EST16 75803 33404914
EST160 78093 45078292
EST161 58352 30145668
EST162 64189 32754822
EST163 66764 38932529
EST164 64655 44742305
EST165 62538 36450745
EST166 97038 45254163
EST167 86246 48533618
EST168 102142 58386780
EST169 102798 59559471
EST17 80845 33050023
EST170 95357 50785952
EST171 90455 38130255
EST172 93186 47588717
EST173 92409 41170933
EST174 92079 38966764
EST175 81091 39285658
EST176 63512 43846292
EST177 71113 39137363
EST178 59851 41975331
EST179 69697 33379460
EST18 81513 32880208
EST180 74994 27732242
EST181 71624 45857768
EST182 81248 40831505
EST183 64710 33149404
EST184 68398 43186305
EST185 67888 51324126
EST186 70286 36980604
EST187 67398 39495433
EST188 70421 57297075
EST189 68277 36281258
EST19 78260 31519976
EST190 72911 36566201
EST191 69858 57817131
EST192 68301 53007071
EST193 64516 47271256
EST194 64318 47390025
EST195 65786 46891595
EST196 64487 44300139
EST197 63999 50148032
EST198 63307 39461122
EST199 64939 34374149
EST2 74718 28667916
EST20 74205 30887785
EST200 63943 37548766
EST201 82819 44376431
EST202 85072 55449839
EST203 67978 41017655
EST204 103542 65078832
EST205 108048 65428099
EST206 109279 64765727
EST207 104277 66205564
EST208 105490 62656104
EST209 106792 52204219
EST21 74913 34226601
EST210 91716 53786285
EST211 98764 43630091
EST212 85901 50218157
EST213 68326 38673458
EST214 69803 49482078
EST215 68452 59014396
EST216 76375 51323596
EST217 79342 38684461
EST218 77174 51025361
EST219 71684 51274418
EST22 73174 29510787
EST220 67398 41338334
EST221 27782 10441873
EST222 27869 10457589
EST223 26889 9861489
EST224 26956 9563576
EST225 26676 9132060
EST226 27332 10165611
EST227 27196 9634787
EST228 27226 9995051
EST229 27222 11399552
EST23 77454 32919136
EST230 27170 11590407
EST231 27205 10715255
EST232 27516 9630846
EST233 27152 8814569
EST234 27406 10930399
EST235 27882 10829686
EST236 27553 11037392
EST237 26622 11602878
EST238 26818 11969365
EST239 27122 10644430
EST24 74075 31990372
EST240 26995 11213083
EST241 27050 11910388
EST242 27227 11395282
EST243 27276 10735763
EST244 27250 10900718
EST245 27154 10348227
EST246 26173 14421538
EST247 24892 16959394
EST248 25862 17629400
EST249 89356 31411179
EST25 75076 32930108
EST250 89124 41037335
EST251 69562 44341872
EST252 69144 44739144
EST253 69100 44187552
EST254 66525 41332251
EST255 75419 43325324
EST256 65566 40577141
EST257 71410 49203786
EST258 55445 27162987
EST259 99133 47090369
EST26 73677 29978862
EST260 90852 45078272
EST261 71748 40191471
EST262 61613 28858635
EST263 70856 42003521
EST264 72241 36227990
EST265 72054 33990114
EST266 70591 42761001
EST267 72743 40736726
EST268 63751 37789060
EST269 72122 33993456
EST27 75033 32412762
EST270 85502 46814225
EST271 71248 46058699
EST272 80572 54502793
EST273 95614 51674021
EST274 98722 46717601
EST275 78061 43710416
EST276 68545 45212352
EST277 76393 35829814
EST278 69974 31598006
EST279 72578 33790020
EST28 106369 50114943
EST280 67187 40539216
EST281 60025 37608940
EST282 66991 38483522
EST283 69115 44159102
EST284 60825 38699997
EST285 85426 43252966
EST286 79952 41417707
EST287 71364 43945522
EST288 99246 56547217
EST289 118731 49044539
EST29 97900 45865335
EST290 91247 41197327
EST291 64568 34800856
EST292 71329 43673465
EST293 82118 43697108
EST294 72339 39169017
EST295 69960 44650674
EST296 69355 38386703
EST297 63674 37329645
EST298 47140 25198157
EST299 72556 52515714
EST3 73590 29860872
EST30 99167 53270037
EST300 71237 40072568
EST301 76632 48355481
EST302 62506 34501764
EST303 78085 45014363
EST304 76375 36406991
EST305 74593 33799101
EST306 77541 32987218
EST307 77534 33637889
EST308 93456 61645596
EST309 68304 53253358
EST31 80011 45465408
EST310 82209 50088749
EST311 75680 38896388
EST312 68031 53891151
EST313 65093 49866360
EST314 59743 43981248
EST315 62721 33299920
EST316 72099 47678435
EST317 59197 36774029
EST318 48699 23935702
EST319 68129 36242824
EST32 67025 52401272
EST320 65541 35234976
EST321 61527 29881451
EST322 63642 41170151
EST323 81373 45182081
EST324 72432 40589596
EST325 68663 41440556
EST326 71351 40814204
EST327 62296 42901718
EST328 84971 48573295
EST329 84885 49999274
EST33 75309 53199310
EST330 81323 44731234
EST331 64201 35771224
EST332 67582 37222842
EST333 72820 39878513
EST334 47674 24516911
EST335 62941 35805313
EST336 69774 42263893
EST337 98221 45798310
EST338 75467 44985128
EST339 74522 50110921
EST34 86484 46900746
EST340 74476 48416565
EST341 63606 34943439
EST342 78547 37044832
EST343 77222 38681803
EST344 55514 39189793
EST345 61296 38768427
EST346 61367 39239651
EST347 95553 53791255
EST348 82482 43540146
EST349 70400 46894836
EST35 87620 44851639
EST350 73927 37856899
EST351 47592 29468026
EST352 44209 23149315
EST353 81601 54073573
EST354 80254 39513395
EST355 78630 46618619
EST356 68718 40360546
EST357 66885 38804752
EST358 68379 42319579
EST359 66839 38349116
EST36 93697 52346085
EST360 62428 34554857
EST361 80162 25241829
EST362 72666 34975304
EST363 70794 40295663
EST364 69112 36568672
EST365 70043 42834932
EST366 75795 48325061
EST367 64400 38814394
EST368 79682 46442087
EST369 57185 33142632
EST37 101176 45990899
EST370 68849 44846308
EST371 80297 49610495
EST372 82778 46426056
EST373 61268 39442344
EST374 56425 41279037
EST375 57432 40451522
EST376 60304 40650694
EST377 78095 48135161
EST378 54102 32080086
EST379 56142 36662085
EST38 97764 50547316
EST380 62415 40149053
EST381 57046 41524152
EST382 61061 42327632
EST383 47767 33736156
EST384 78933 39873326
EST385 57231 39879044
EST386 51457 40489431
EST387 76741 45358098
EST388 56877 34529163
EST389 98292 49803873
EST39 102496 46838988
EST390 94474 55179407
EST391 85770 53567050
EST392 66306 46167122
EST393 42466 29567481
EST394 46954 58513734
EST395 60396 56649659
EST396 63121 41605549
EST397 71038 43910965
EST398 67989 42900334
EST399 70499 43541915
EST4 73953 28155396
EST40 70887 21346443
EST400 61639 51419104
EST401 63315 42785292
EST402 57014 38215175
EST403 57157 40892278
EST404 58733 39194992
EST405 66510 51085809
EST406 64012 46314442
EST407 59201 40675602
EST408 51780 38526493
EST409 56818 38638187
EST41 68753 18204283
EST410 55726 41498336
EST411 66044 37344149
EST412 64564 43880698
EST413 57067 38187285
EST414 59008 42244419
EST415 58417 45738920
EST416 59773 45359649
EST417 55770 40401904
EST418 58050 41529061
EST419 56243 36772459
EST42 76806 22485432
EST420 58168 38135619
EST421 74916 42736741
EST422 62381 50004870
EST423 74537 57669255
EST424 79264 50132341
EST425 47030 55151595
EST426 51911 50505337
EST427 62740 51030242
EST428 57821 39564211
EST429 80939 30577865
EST43 43485 12055737
EST430 70098 24882434
EST431 73547 27691690
EST432 74071 26183927
EST433 78798 26928986
EST434 75018 27213906
EST435 68668 29300748
EST436 38565 13296764
EST44 43230 11776132
EST45 42900 12011831
EST46 42968 11176232
EST47 98213 43765307
EST48 94283 43763598
EST49 90013 47578965
EST5 48552 15462195
EST50 86721 39489322
EST51 106908 56678629
EST52 91391 43941942
EST53 74024 31101859
EST54 69168 30794917
EST55 70591 30643214
EST56 73396 30902311
EST57 82423 32491997
EST58 71882 28093422
EST59 64019 28068068
EST6 55001 17440741
EST60 72773 31568953
EST61 74936 35481875
EST62 73784 32271846
EST63 75747 27125227
EST64 79287 31054011
EST65 71884 31115070
EST66 39991 11408288
EST67 40030 11344339
EST68 40186 12599056
EST69 40449 12231105
EST7 74090 29152490
EST70 40427 12453868
EST71 40344 12869839
EST72 40351 12491127
EST73 40175 12061622
EST74 40200 12302750
EST75 41009 12205242
EST76 41130 12333957
EST77 41050 13053089
EST78 40851 12971563
EST79 43409 12451015
EST8 75313 30469369
EST80 43469 19870297
EST81 40615 24713510
EST82 42588 18489879
EST83 49618 21097708
EST84 50848 21388555
EST85 49808 21938161
EST86 79409 43489486
EST87 72224 27935308
EST88 75763 29480562
EST89 74628 38880541
EST9 77448 29829010
EST90 76427 41914876
EST91 77950 44737002
EST92 75542 34799667
EST93 75606 43750645
EST94 70799 36336624
EST95 75155 33626204
EST96 72610 44928808
EST97 73265 34062526
EST98 72973 42873521
EST99 67047 36008169
GSS1 90825 38838374
GSS10 75205 43833923
GSS100 75196 41109744
GSS101 73893 44374237
GSS102 73489 45391505
GSS103 73573 45179572
GSS104 73235 45056680
GSS105 73603 43965682
GSS106 79449 52130752
GSS107 86079 58445081
GSS108 81832 53766433
GSS109 84512 52612587
GSS11 69998 35693198
GSS110 86172 51306276
GSS111 79798 65808394
GSS112 86603 46643126
GSS113 94476 56508493
GSS114 75987 47618217
GSS115 85686 59278422
GSS116 84196 65089982
GSS117 77176 39221769
GSS118 84297 54458168
GSS119 94187 53792390
GSS12 73548 38676139
GSS120 84786 55753612
GSS121 85069 55329947
GSS122 82489 57991951
GSS123 76670 69909081
GSS124 78594 66232449
GSS125 78739 54392379
GSS126 78596 54829732
GSS127 79301 53707616
GSS128 79087 54100430
GSS129 78399 55145918
GSS13 76846 38733068
GSS130 28214 17686948
GSS131 87189 64730126
GSS132 83935 63019497
GSS133 101311 46888797
GSS134 68799 58599541
GSS135 68296 58745907
GSS136 69348 56613476
GSS137 69621 56082951
GSS138 70278 55419927
GSS139 86049 73374580
GSS14 71351 32037362
GSS140 85313 40431100
GSS141 70907 48228907
GSS142 109999 71837295
GSS143 85394 35965880
GSS144 90762 68076060
GSS145 73220 60878875
GSS146 70232 59161488
GSS147 66132 63154574
GSS148 74673 56074743
GSS149 120670 73160850
GSS15 70727 35302355
GSS150 118174 75728887
GSS151 104435 58892426
GSS152 88215 55953190
GSS153 93471 57417904
GSS154 85521 45434260
GSS155 91712 51067995
GSS156 86238 62577394
GSS157 102366 49486503
GSS158 15538 6819387
GSS16 77805 45829341
GSS17 70880 33341715
GSS18 58368 27832664
GSS19 56833 28963673
GSS2 89386 39537205
GSS20 57717 26580474
GSS21 61790 30521317
GSS22 64701 36732561
GSS23 57508 27136654
GSS24 67089 42491182
GSS25 67317 27788589
GSS26 58125 25492551
GSS27 66241 32328960
GSS28 64506 32387341
GSS29 79220 40156130
GSS3 87699 41940144
GSS30 82123 39902420
GSS31 74222 40352992
GSS32 70471 48512182
GSS33 80005 37624826
GSS34 75905 40292774
GSS35 74374 39340216
GSS36 87736 57805086
GSS37 87596 58176489
GSS38 85652 44895069
GSS39 85834 49549719
GSS4 79303 41207047
GSS40 87299 38845126
GSS41 82757 34009078
GSS42 81263 56908701
GSS43 79620 57640913
GSS44 72032 47495447
GSS45 72037 47428341
GSS46 77835 45455272
GSS47 78046 39400845
GSS48 83577 58296595
GSS49 86643 65958461
GSS5 79041 40731282
GSS50 82625 53438198
GSS51 93543 59670465
GSS52 88622 59030929
GSS53 75348 40195855
GSS54 74361 42581732
GSS55 86004 45597609
GSS56 88465 59112252
GSS57 76347 66964893
GSS58 72031 79231791
GSS59 88229 68527411
GSS6 78255 38895462
GSS60 86956 57928940
GSS61 63531 45297606
GSS62 69224 47671944
GSS63 89663 67258677
GSS64 86190 58139321
GSS65 87493 53892713
GSS66 87665 56788287
GSS67 97100 58010510
GSS68 100582 54567212
GSS69 100682 54439986
GSS7 77539 39418357
GSS70 101370 53568620
GSS71 102347 52329070
GSS72 102419 52237097
GSS73 102693 51890037
GSS74 102088 52656399
GSS75 98441 57315581
GSS76 90170 69724551
GSS77 89833 70782396
GSS78 88048 69610767
GSS79 87829 69671899
GSS8 76330 38105833
GSS80 89102 63254342
GSS81 80838 23855279
GSS82 77798 24499292
GSS83 88037 36324842
GSS84 84159 50449025
GSS85 80753 49008004
GSS86 89510 64569283
GSS87 78721 61991391
GSS88 78080 79495133
GSS89 76552 56173113
GSS9 72576 37287728
GSS90 94886 51038385
GSS91 76016 40994182
GSS92 86149 49605824
GSS93 69298 61632667
GSS94 86129 52217766
GSS95 82467 61189559
GSS96 87371 57356171
GSS97 82932 57666309
GSS98 90706 54235130
GSS99 80427 67745453
HTC1 31500 54333086
HTC10 13071 21812641
HTC2 28724 63888728
HTC3 17511 41047686
HTC4 16141 39813846
HTC5 40806 30691362
HTC6 68319 60303310
HTC7 79269 67446869
HTC8 67903 59695502
HTC9 63867 87041314
HTG1 1315 188873586
HTG10 1240 186599456
HTG11 1429 184143201
HTG12 877 191866114
HTG13 751 192351055
HTG14 741 192407714
HTG15 776 192259975
HTG16 803 192166211
HTG17 764 192239765
HTG18 2018 171831359
HTG19 1033 188317118
HTG2 2562 185987793
HTG20 1053 188396307
HTG21 776 192077412
HTG22 923 190357187
HTG23 880 191002667
HTG24 828 191124020
HTG25 771 192277748
HTG26 846 191489931
HTG27 854 191487048
HTG28 962 189909858
HTG29 918 190676403
HTG3 2450 185367940
HTG30 929 190770956
HTG31 882 191171934
HTG32 957 189809603
HTG33 891 191070779
HTG34 838 191688257
HTG35 835 191885462
HTG36 884 190994624
HTG37 945 190425358
HTG38 944 190744769
HTG39 969 190159901
HTG4 2528 188491565
HTG40 1147 187856396
HTG41 1138 188446622
HTG42 1318 187066536
HTG43 1168 188473122
HTG44 1113 189447223
HTG45 1166 191349096
HTG46 1281 190918452
HTG47 1159 191484049
HTG48 1143 191361086
HTG49 1051 190833609
HTG5 1281 185672761
HTG50 926 189188753
HTG51 1075 190193642
HTG52 928 189821006
HTG53 1084 189938840
HTG54 953 189961847
HTG55 1024 190231197
HTG56 967 189407639
HTG57 941 189477515
HTG58 1567 186083255
HTG59 1669 186442595
HTG6 1273 185317990
HTG60 1730 182841769
HTG61 1238 191385232
HTG62 1125 191037774
HTG63 1553 188612628
HTG64 1028 194008678
HTG65 1028 193977516
HTG66 1050 193985134
HTG67 794 181996663
HTG68 880 147901638
HTG7 1247 185558835
HTG8 1288 185063308
HTG9 1183 187094560
INV1 17465 161506963
INV2 1605 166306551
INV3 34769 114772198
INV4 76282 75415616
INV5 76473 74158774
INV6 51192 96562901
INV7 52128 98468369
INV8 1564 21811610
MAM1 52992 114446373
MAM2 29556 46283400
PAT1 222671 70172634
PAT10 128933 47841964
PAT11 97123 61985189
PAT12 127509 52879880
PAT13 146951 55560908
PAT14 165670 72143294
PAT15 100082 124374609
PAT16 123450 102792157
PAT17 112785 108436463
PAT18 153340 70279920
PAT2 194383 84711839
PAT3 172019 95882664
PAT4 153753 106055882
PAT5 143528 89514438
PAT6 116572 110607914
PAT7 143991 91091822
PAT8 129560 98134037
PAT9 135465 92265301
PHG 2713 16892737
PLN1 35722 120665929
PLN10 3327 174051990
PLN11 60718 63392321
PLN12 77257 78474058
PLN13 75422 78821563
PLN14 30389 120528796
PLN15 49001 106006810
PLN16 38653 100907188
PLN2 1372 176061816
PLN3 7005 161042422
PLN4 77241 78245697
PLN5 69570 66635054
PLN6 31540 54583147
PLN7 4016 160572942
PLN8 1482 193109364
PLN9 6 197759100
PRI1 21385 141291438
PRI10 1439 181601196
PRI11 1297 178993935
PRI12 1535 178239302
PRI13 1609 179766023
PRI14 1483 186462441
PRI15 19902 158699499
PRI16 43567 101684928
PRI17 19688 130546712
PRI18 1610 183572072
PRI19 1718 183439903
PRI2 1464 173186141
PRI20 2071 181914735
PRI21 2076 182316473
PRI22 20776 148017752
PRI23 49995 82644293
PRI24 27194 95505401
PRI25 7817 176587045
PRI26 22213 149002936
PRI27 52112 115214155
PRI28 41928 122651213
PRI29 19777 25898904
PRI3 1278 186319459
PRI4 1331 184437581
PRI5 1193 181116628
PRI6 1204 179249884
PRI7 1232 180155920
PRI8 1369 174614632
PRI9 1232 177892935
ROD1 9105 169550313
ROD10 987 182638165
ROD11 994 185963836
ROD12 1014 186743265
ROD13 969 179790252
ROD14 971 183406785
ROD15 24620 149837087
ROD16 4276 181949031
ROD17 1201 192964436
ROD18 1295 193838472
ROD19 39248 96356666
ROD2 925 174137255
ROD20 18542 123391283
ROD21 46127 82360095
ROD3 904 174367270
ROD4 903 174076551
ROD5 930 174533804
ROD6 981 180560947
ROD7 978 180565114
ROD8 979 181722241
ROD9 1026 183925935
STS1 82591 35548343
STS10 58196 44474190
STS11 58015 43677385
STS12 76098 38169809
STS13 88245 39069267
STS14 8836 3789706
STS2 83958 44526595
STS3 76847 31086836
STS4 66334 33768234
STS5 54871 31972804
STS6 54726 32230056
STS7 54690 32200496
STS8 56412 38823659
STS9 58081 44561334
SYN 23907 32611130
UNA 216 116205
VRL1 72415 65666371
VRL2 72193 65413007
VRL3 71214 69418406
VRL4 74922 62965440
VRL5 26464 31924732
VRT1 53931 111415911
VRT10 7989 8694193
VRT2 21068 158552464
VRT3 69093 87720768
VRT4 44555 65304813
VRT5 2154 191672681
VRT6 1287 193156973
VRT7 1359 192886822
VRT8 20402 164034304
VRT9 31407 146745650
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 150.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
8605799 11223873006 Homo sapiens
6619554 7826513924 Mus musculus
1015598 5669351545 Rattus norvegicus
863370 2190523168 Danio rerio
1217918 2106396859 Bos taurus
2621324 1742224470 Zea mays
357968 1171422358 Oryza sativa (japonica cultivar-group)
1178574 950295949 Xenopus tropicalis
1409337 805797459 Canis familiaris
533781 785906528 Drosophila melanogaster
777451 668960557 Gallus gallus
981325 647874977 Arabidopsis thaliana
207686 528676975 Pan troglodytes
784728 463990613 Sorghum bicolor
661770 449692566 Sus scrofa
693916 419866886 Ciona intestinalis
387865 409144272 Medicago truncatula
596253 404129844 Brassica oleracea
65653 386652884 Macaca mulatta
612478 348405643 Triticum aestivum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 October 2005
NCBI-GenBank Flat File Release 150.0
Bacterial Sequences (Part 1)
37811 loci, 97585608 bases, from 37811 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
bits-request@ncbi.nlm.nih.gov
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A.,
Wheeler D.L. GenBank. Nucl. Acids Res. 28(1):15-18 (2000)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to
indicate the GenBank release number (e.g., Release 150.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
