Release Notes For GenBank Release 150

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2005

               NCBI-GenBank Flat File Release 150.0

                    Distribution Release Notes

 49152445 loci, 53655236500 bases, from 49152445 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 150.0
1.2 Cutoff Date
1.3 Important Changes in Release 150.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 150.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 150.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.

1.2 Cutoff Date

  This full release, 150.0, incorporates data available to the collaborating
databases as of October 8, 2005 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 150.0

1.3.1 Problems generating accession number and keyword indexes

  Continuing software problems again prevented the generation of
the gbacc.idx and gbkey.idx 'index' files which normally accompany
GenBank releases.

  A version of gbacc.idx was built manually. However, the first field
contains just an accession number rather than Accession.Version .

  The gbkey.idx index could not be created without substantial
additional delays in release processing, so it is completely absent
from 150.0 .

  Our apologies for any inconvenience that this ongoing problem
may cause.

1.3.2 Organizational changes

  The total number of sequence data files increased by 37 with this release:

  - the BCT division is now comprised of  12 files (+1)
  - the EST division is now comprised of 436 files (+23)
  - the GSS division is now comprised of 158 files (+7)
  - the HTC division is now comprised of  10 files (+3)
  - the INV division is now comprised of   8 files (+1)
  - the ROD division is now comprised of  21 files (+1)
  - the VRT division is now comprised of  10 files (+1)

1.3.3 New qualifiers for the source feature

  A set of five new source feature qualifiers are now legal as of this
October 2005 release.

	Qualifier          /lat_lon 
	Definition         geographical coordinates of the location where
                           the specimen was collected 
	Value format      "text" 
	Example            /lat_lon="47.94 N 28.12 W" 

	Comment            decimal degrees latitude [N/S] decimal degrees longitude [E/W] 


	Qualifier          /collected_by 
	Definition         name of the person who collected the specimen 
	Value format       "text" 
	Example            /collected_by="Dan Janzen" 

	Qualifier          /collection_date
	Definition         date that the specimen was collected 
	Value format       "DD-MMM-YYYY", "MMM-YYYY" or "YYYY" 
	Example            /collection_date="21-OCT-1952" 
	                   /collection_date="OCT-1952" 
	                   /collection_date="1952" 

	Comment            full date format DD-MMM-YYYY is preferred;
	where day and/or month of collection is not known either "MMM-YYYY" or "YYYY"
	can be used; three-letter month abbreviation can be one of the following:
	JAN, FEB, MAR, APR, MAY, JUN, JUL, AUG, SEP, OCT, NOV, DEC. 


	Qualifier          /identified_by 
	Definition         name of the taxonomist who identified the specimen 
	Value format       "text" 
	Example            /identified_by="John Burns" 

	Qualifier          /PCR_primers 
	Definition         PCR primers that were used to amplify the sequence. 
	Value format       /PCR_primers="fwd_name:XXX, fwd_seq:xxxxx, 
	                   rev_name:YYY, rev_seq:yyyyy" 
	Example            /PCR_primers="fwd_name:CO1P1, fwd_seq:ttgattttttggtcayccwgaagt, 
	rev_name:CO1R4, rev_seq:ccwvytardcctarraartgttg" 

	Comment            fwd_seq and rev_seq are both required.
	                   fwd_name and rev_name are both optional. 
	                   Both sequences should be presented in 5'>3' order.
	                   The sequences should utilize the IUPAC degenerate-base alphabet.

For the /PCR_primers qualifier, the order of the elements within the 
qualifier value must always be as shown above. Multiple /PCR_primers
qualifiers may exist on a source feature.

  These qualifiers will most likely see their first use in association
with environmental sampling projects and the BarCode project.

1.3.4 : /evidence qualifer replaced 

  Two new qualifiers which replace /evidence are legal as of the
October 2005 GenBank release :

	/experiment
	/inference

Existing /evidence="not_experimental" qualifiers have been replaced by:

   /inference="non-experimental evidence, no additional details recorded"

While existing /evidence="experimental" qualifiers are now:

   /experiment="experimental evidence, no additional details recorded"

The complete definitions of these two new qualifiers are as follows:

	Qualifier           /experiment
	Definition          a brief description of the nature of the experimental
	                    evidence that supports the feature identification
	                    or assignment.
	Value format        "text"
	Example             /experiment="Northern blot"
	Comment             detailed experimental details should not be included,
	                    and would normally be found in the cited publications.
	                    /experiment="experimental evidence, no additional details recorded"
	                    is for use purely to replace existing instances of
	                    /evidence=EXPERIMENTAL
 
	Qualifier           /inference
	Definition          a structured description of non-experimental evidence
	                    that supports the feature identification or assignment.
	Value format        "TYPE[ (same species)][:EVIDENCE_BASIS]"
	                    where TYPE is one of the following:
	                    "non-experimental evidence, no additional details recorded"
	                    "similar to sequence"
	                    "similar to AA sequence"
	                    "similar to DNA sequence"
	                    "similar to RNA sequence"
	                    "similar to RNA sequence, mRNA"
	                    "similar to RNA sequence, EST"
	                    "similar to RNA sequence, other RNA"
	                    "profile"
	                    "nucleotide motif"
	                    "protein motif"
	                    "ab initio prediction"

	where the optional text " (same species)" is included when the inference
	comes from the same species as the entry.

	where the optional "EVIDENCE_BASIS" is either a reference to a database
	entry (including accession and version) or an algorithm (including version),
	eg 'INSD:AACN010222672.1', 'InterPro:IPR001900', 'ProDom:PD000600',
	'Genscan:2.0', etc.

	Example             /inference="similar to DNA sequence:INSD:AY411252.1"
	                    /inference="similar to RNA, mRNA sequence:RefSeq:NM_000041.2"
	                    /inference="similar to DNA sequence (same species):INSD:AACN010222672.1"
	                    /inference="profile:tRNAscan:2.1"
	                    /inference="protein motif:InterPro:IPR001900"
	                    /inference="ab initio prediction:Genscan:2.0"

	Comment             /inference="non-experimental evidence, no additional details recorded"
	                    is for use purely to replace existing instances of
	                    /evidence=NOT_EXPERIMENTAL

1.3.5 New /organelle qualifier value

  As of the October 2005 GenBank release, a new value for the /organelle
qualifier is now supported : hydrogenosome 

  This will be used for the annotation of sequences from anaerobic protozoa
and fungi, for which the hydrogenosome has a role in anaerobic respiration. 

1.3.6 Two new qualifiers for trans splicing and ribosomal slippage

  As of the October 2005 GenBank release, these two new qualifiers
have been introduced:

	Qualifier           /trans_splicing 
	Definition          indicates that exons from two RNA molecules are 
	                    ligated in intermolecular reaction to form mature RNA 
	Value format        none 
	Example             /trans_splicing 
	Comment             should be used on features such as CDS, mRNA and 
	                    other features that are produced as a result of a
	                    trans-splicing event. This qualifier should be used only
	                    when the splice event is indicated via the join operator
	                    for the associated feature's location.

	Note : legal on CDS, mRNA, misc_RNA, precursor_RNA, 5'UTR, 3'UTR, tRNA,
	and gene features


	Qualifier           /ribosomal_slippage 
	Definition          during protein translation, certain sequences can 
	                    program ribosomes to change to an alternative
	                    reading frame by a mechanism known as ribosomal
	                    slippage 
	Value format        none 
	Example             /ribosomal_slippage 
	Comment             a join operator,e.g.: [join(486..1784,1787..4810)]
	                    should be used in the CDS spans to indicate the
	                    location of ribosomal_slippage 

	Note: legal on CDS features only 

1.3.7 New /exception qualifier value

  Coding regions for which the conceptual protein translation differs from
the supplied /translation qualifier are flagged with an /exception 
qualifier. The value :

	"rearrangement required for product"

is now legal for /exception as of this October 2005 GenBank release.

1.3.8 : /repeat_unit qualifer replaced 

  Two new qualifiers designed to replace /repeat_unit are now legal as of
the October 2005 GenBank release : /repeat_unit_seq and /repeat_unit_range .

  The old qualifier accomodates both integer ranges (eg: "10..20") and
characters that represent a repeat unit pattern (eg: (AT)2(AA)5 ). Introducing
a separate qualifier for each of these representations will make it easier
to submit and validate their values.

	Qualifier       /rpt_unit_seq
	Definition      identity of a repeat sequence
	Value format    "text"
	Example         /rpt_unit_seq="aagggc"
	                /rpt_unit_seq="ag(5)tg(8)"
	Comment         used to indicate the literal sequence that constitutes
	                a repeated sequence specified by the feature keys oriT,
	                repeat_region, repeat_unit and satellite.

	Note : legal on oriT, repeat_region, repeat_unit and satellite features


	Qualifier       /rpt_unit_range
	Definition      identity of a repeat range
	Value format    "text"
	Example         /rpt_unit_range="202..245"
	Comment         used to indicate the base range of the sequence that
	                constitutes a repeated sequence specified by the
	                feature keys oriT, repeat_region, repeat_unit and
                        satellite.

	Note : legal on oriT, repeat_region, repeat_unit and satellite features

1.3.9 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
twenty-eight of the GSS flatfiles in Release 150.0. Consider gbgss131.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                          October 15 2005

                NCBI-GenBank Flat File Release 150.0

                           GSS Sequences (Part 1)

   87189 loci,    64730126 bases, from    87189 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "131" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New Linetype for Genome Project Identifier

  DDBJ, EMBL, and GenBank are working to create a collaborative system that
will assign a unique numeric identifier to genome projects. The purpose of
this new identifier is to provide a link among sequence records that pertain
to a specific genome sequencing project.

  At GenBank, this new identifier will be presented in the flatfile format
via a new linetype : PROJECT . Here is a mocked-up example demonstrating
the new linetype's use:

LOCUS       CH476840             1669278 bp    DNA     linear   CON 05-OCT-2005
DEFINITION  Magnaporthe grisea 70-15 supercont5.200 genomic scaffold, whole
            genome shotgun sequence.
ACCESSION   CH476840 AACU02000000
VERSION     CH476840.1  GI:77022292
PROJECT     GENOME_PROJECT:12345

The integer 12345 represents the value of a possible genome project
identifier.

There is a possibility that the contents of the PROJECT line might change 
somewhat from this example by the time the new identifier is implemented.
We will keep you posted of any such changes via these release notes and the
GenBank listserv.

  These Genome Project identifiers will be searchable within NCBI's
Entrez: Genome-Project database:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  The earliest date on which this new linetype will appear in the GenBank
flatfile format is February 15 2006.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview


  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 854 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut28.idx - Index of the entries according to accession number, part 28.
23. gbaut29.idx - Index of the entries according to accession number, part 29.
24. gbaut3.idx - Index of the entries according to accession number, part 3.
25. gbaut30.idx - Index of the entries according to accession number, part 30.
26. gbaut31.idx - Index of the entries according to accession number, part 31.
27. gbaut32.idx - Index of the entries according to accession number, part 32.
28. gbaut4.idx - Index of the entries according to accession number, part 4.
29. gbaut5.idx - Index of the entries according to accession number, part 5.
30. gbaut6.idx - Index of the entries according to accession number, part 6.
31. gbaut7.idx - Index of the entries according to accession number, part 7.
32. gbaut8.idx - Index of the entries according to accession number, part 8.
33. gbaut9.idx - Index of the entries according to accession number, part 9.
34. gbbct1.seq - Bacterial sequence entries, part 1.
35. gbbct10.seq - Bacterial sequence entries, part 10.
36. gbbct11.seq - Bacterial sequence entries, part 11.
37. gbbct12.seq - Bacterial sequence entries, part 12.
38. gbbct2.seq - Bacterial sequence entries, part 2.
39. gbbct3.seq - Bacterial sequence entries, part 3.
40. gbbct4.seq - Bacterial sequence entries, part 4.
41. gbbct5.seq - Bacterial sequence entries, part 5.
42. gbbct6.seq - Bacterial sequence entries, part 6.
43. gbbct7.seq - Bacterial sequence entries, part 7.
44. gbbct8.seq - Bacterial sequence entries, part 8.
45. gbbct9.seq - Bacterial sequence entries, part 9.
46. gbchg.txt - Accession numbers of entries updated since the previous release.
47. gbcon.seq - Constructed sequence entries.
48. gbdel.txt - Accession numbers of entries deleted since the previous release.
49. gbenv1.seq - Environmental sampling sequence entries, part 1.
50. gbenv2.seq - Environmental sampling sequence entries, part 2.
51. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
52. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
53. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
54. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
55. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
56. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
57. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
58. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
59. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
60. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
61. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
62. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
63. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
64. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
65. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
66. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
67. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
68. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
69. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
70. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
71. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
72. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
73. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
74. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
75. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
76. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
77. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
78. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
79. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
80. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
81. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
82. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
83. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
84. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
85. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
86. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
87. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
88. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
89. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
90. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
91. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
92. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
93. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
94. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
95. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
96. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
97. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
98. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
99. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
100. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
101. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
102. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
103. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
104. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
105. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
106. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
107. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
108. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
109. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
110. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
111. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
112. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
113. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
114. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
115. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
116. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
117. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
118. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
119. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
120. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
121. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
122. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
123. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
124. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
125. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
126. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
127. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
128. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
129. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
130. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
131. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
132. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
133. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
134. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
135. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
136. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
137. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
138. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
139. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
140. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
141. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
142. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
143. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
144. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
145. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
146. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
147. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
148. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
149. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
150. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
151. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
152. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
153. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
154. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
155. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
156. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
157. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
158. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
159. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
160. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
161. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
162. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
163. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
164. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
165. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
166. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
167. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
168. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
169. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
170. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
171. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
172. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
173. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
174. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
175. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
176. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
177. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
178. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
179. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
180. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
181. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
182. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
183. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
184. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
185. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
186. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
187. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
188. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
189. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
190. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
191. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
192. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
193. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
194. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
195. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
196. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
197. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
198. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
199. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
200. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
201. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
202. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
203. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
204. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
205. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
206. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
207. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
208. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
209. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
210. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
211. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
212. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
213. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
214. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
215. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
216. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
217. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
218. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
219. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
220. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
221. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
222. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
223. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
224. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
225. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
226. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
227. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
228. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
229. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
230. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
231. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
232. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
233. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
234. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
235. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
236. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
237. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
238. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
239. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
240. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
241. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
242. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
243. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
244. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
245. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
246. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
247. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
248. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
249. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
250. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
251. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
252. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
253. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
254. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
255. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
256. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
257. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
258. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
259. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
260. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
261. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
262. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
263. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
264. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
265. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
266. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
267. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
268. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
269. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
270. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
271. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
272. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
273. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
274. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
275. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
276. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
277. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
278. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
279. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
280. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
281. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
282. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
283. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
284. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
285. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
286. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
287. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
288. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
289. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
290. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
291. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
292. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
293. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
294. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
295. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
296. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
297. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
298. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
299. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
300. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
301. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
302. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
303. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
304. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
305. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
306. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
307. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
308. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
309. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
310. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
311. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
312. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
313. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
314. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
315. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
316. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
317. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
318. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
319. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
320. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
321. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
322. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
323. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
324. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
325. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
326. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
327. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
328. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
329. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
330. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
331. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
332. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
333. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
334. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
335. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
336. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
337. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
338. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
339. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
340. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
341. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
342. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
343. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
344. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
345. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
346. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
347. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
348. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
349. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
350. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
351. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
352. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
353. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
354. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
355. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
356. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
357. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
358. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
359. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
360. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
361. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
362. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
363. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
364. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
365. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
366. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
367. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
368. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
369. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
370. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
371. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
372. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
373. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
374. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
375. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
376. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
377. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
378. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
379. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
380. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
381. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
382. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
383. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
384. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
385. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
386. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
387. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
388. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
389. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
390. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
391. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
392. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
393. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
394. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
395. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
396. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
397. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
398. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
399. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
400. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
401. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
402. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
403. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
404. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
405. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
406. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
407. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
408. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
409. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
410. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
411. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
412. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
413. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
414. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
415. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
416. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
417. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
418. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
419. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
420. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
421. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
422. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
423. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
424. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
425. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
426. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
427. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
428. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
429. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
430. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
431. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
432. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
433. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
434. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
435. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
436. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
437. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
438. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
439. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
440. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
441. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
442. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
443. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
444. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
445. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
446. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
447. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
448. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
449. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
450. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
451. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
452. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
453. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
454. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
455. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
456. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
457. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
458. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
459. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
460. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
461. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
462. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
463. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
464. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
465. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
466. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
467. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
468. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
469. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
470. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
471. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
472. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
473. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
474. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
475. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
476. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
477. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
478. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
479. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
480. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
481. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
482. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
483. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
484. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
485. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
486. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
487. gbgen.idx - Index of the entries according to gene symbols.
488. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
489. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
490. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
491. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
492. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
493. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
494. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
495. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
496. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
497. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
498. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
499. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
500. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
501. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
502. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
503. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
504. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
505. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
506. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
507. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
508. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
509. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
510. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
511. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
512. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
513. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
514. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
515. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
516. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
517. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
518. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
519. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
520. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
521. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
522. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
523. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
524. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
525. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
526. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
527. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
528. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
529. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
530. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
531. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
532. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
533. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
534. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
535. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
536. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
537. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
538. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
539. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
540. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
541. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
542. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
543. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
544. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
545. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
546. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
547. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
548. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
549. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
550. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
551. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
552. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
553. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
554. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
555. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
556. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
557. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
558. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
559. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
560. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
561. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
562. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
563. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
564. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
565. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
566. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
567. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
568. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
569. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
570. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
571. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
572. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
573. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
574. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
575. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
576. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
577. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
578. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
579. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
580. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
581. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
582. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
583. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
584. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
585. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
586. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
587. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
588. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
589. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
590. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
591. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
592. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
593. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
594. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
595. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
596. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
597. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
598. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
599. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
600. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
601. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
602. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
603. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
604. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
605. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
606. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
607. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
608. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
609. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
610. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
611. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
612. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
613. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
614. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
615. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
616. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
617. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
618. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
619. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
620. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
621. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
622. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
623. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
624. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
625. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
626. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
627. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
628. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
629. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
630. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
631. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
632. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
633. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
634. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
635. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
636. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
637. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
638. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
639. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
640. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
641. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
642. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
643. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
644. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
645. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
646. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
647. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
648. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
649. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
650. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
651. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
652. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
653. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
654. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
655. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
656. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
657. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
658. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
659. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
660. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
661. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
662. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
663. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
664. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
665. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
666. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
667. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
668. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
669. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
670. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
671. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
672. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
673. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
674. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
675. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
676. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
677. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
678. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
679. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
680. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
681. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
682. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
683. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
684. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
685. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
686. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
687. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
688. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
689. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
690. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
691. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
692. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
693. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
694. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
695. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
696. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
697. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
698. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
699. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
700. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
701. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
702. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
703. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
704. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
705. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
706. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
707. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
708. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
709. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
710. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
711. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
712. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
713. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
714. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
715. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
716. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
717. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
718. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
719. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
720. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
721. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
722. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
723. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
724. gbinv1.seq - Invertebrate sequence entries, part 1.
725. gbinv2.seq - Invertebrate sequence entries, part 2.
726. gbinv3.seq - Invertebrate sequence entries, part 3.
727. gbinv4.seq - Invertebrate sequence entries, part 4.
728. gbinv5.seq - Invertebrate sequence entries, part 5.
729. gbinv6.seq - Invertebrate sequence entries, part 6.
730. gbinv7.seq - Invertebrate sequence entries, part 7.
731. gbinv8.seq - Invertebrate sequence entries, part 8.
732. gbjou.idx - Index of the entries according to journal citation.
733. gbmam1.seq - Other mammalian sequence entries, part 1.
734. gbmam2.seq - Other mammalian sequence entries, part 2.
735. gbnew.txt - Accession numbers of entries new since the previous release.
736. gbpat1.seq - Patent sequence entries, part 1.
737. gbpat10.seq - Patent sequence entries, part 10.
738. gbpat11.seq - Patent sequence entries, part 11.
739. gbpat12.seq - Patent sequence entries, part 12.
740. gbpat13.seq - Patent sequence entries, part 13.
741. gbpat14.seq - Patent sequence entries, part 14.
742. gbpat15.seq - Patent sequence entries, part 15.
743. gbpat16.seq - Patent sequence entries, part 16.
744. gbpat17.seq - Patent sequence entries, part 17.
745. gbpat18.seq - Patent sequence entries, part 18.
746. gbpat2.seq - Patent sequence entries, part 2.
747. gbpat3.seq - Patent sequence entries, part 3.
748. gbpat4.seq - Patent sequence entries, part 4.
749. gbpat5.seq - Patent sequence entries, part 5.
750. gbpat6.seq - Patent sequence entries, part 6.
751. gbpat7.seq - Patent sequence entries, part 7.
752. gbpat8.seq - Patent sequence entries, part 8.
753. gbpat9.seq - Patent sequence entries, part 9.
754. gbphg.seq - Phage sequence entries.
755. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
756. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
757. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
758. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
759. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
760. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
761. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
762. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
763. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
764. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
765. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
766. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
767. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
768. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
769. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
770. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
771. gbpri1.seq - Primate sequence entries, part 1.
772. gbpri10.seq - Primate sequence entries, part 10.
773. gbpri11.seq - Primate sequence entries, part 11.
774. gbpri12.seq - Primate sequence entries, part 12.
775. gbpri13.seq - Primate sequence entries, part 13.
776. gbpri14.seq - Primate sequence entries, part 14.
777. gbpri15.seq - Primate sequence entries, part 15.
778. gbpri16.seq - Primate sequence entries, part 16.
779. gbpri17.seq - Primate sequence entries, part 17.
780. gbpri18.seq - Primate sequence entries, part 18.
781. gbpri19.seq - Primate sequence entries, part 19.
782. gbpri2.seq - Primate sequence entries, part 2.
783. gbpri20.seq - Primate sequence entries, part 20.
784. gbpri21.seq - Primate sequence entries, part 21.
785. gbpri22.seq - Primate sequence entries, part 22.
786. gbpri23.seq - Primate sequence entries, part 23.
787. gbpri24.seq - Primate sequence entries, part 24.
788. gbpri25.seq - Primate sequence entries, part 25.
789. gbpri26.seq - Primate sequence entries, part 26.
790. gbpri27.seq - Primate sequence entries, part 27.
791. gbpri28.seq - Primate sequence entries, part 28.
792. gbpri29.seq - Primate sequence entries, part 29.
793. gbpri3.seq - Primate sequence entries, part 3.
794. gbpri4.seq - Primate sequence entries, part 4.
795. gbpri5.seq - Primate sequence entries, part 5.
796. gbpri6.seq - Primate sequence entries, part 6.
797. gbpri7.seq - Primate sequence entries, part 7.
798. gbpri8.seq - Primate sequence entries, part 8.
799. gbpri9.seq - Primate sequence entries, part 9.
800. gbrel.txt - Release notes (this document).
801. gbrod1.seq - Rodent sequence entries, part 1.
802. gbrod10.seq - Rodent sequence entries, part 10.
803. gbrod11.seq - Rodent sequence entries, part 11.
804. gbrod12.seq - Rodent sequence entries, part 12.
805. gbrod13.seq - Rodent sequence entries, part 13.
806. gbrod14.seq - Rodent sequence entries, part 14.
807. gbrod15.seq - Rodent sequence entries, part 15.
808. gbrod16.seq - Rodent sequence entries, part 16.
809. gbrod17.seq - Rodent sequence entries, part 17.
810. gbrod18.seq - Rodent sequence entries, part 18.
811. gbrod19.seq - Rodent sequence entries, part 19.
812. gbrod2.seq - Rodent sequence entries, part 2.
813. gbrod20.seq - Rodent sequence entries, part 20.
814. gbrod21.seq - Rodent sequence entries, part 21.
815. gbrod3.seq - Rodent sequence entries, part 3.
816. gbrod4.seq - Rodent sequence entries, part 4.
817. gbrod5.seq - Rodent sequence entries, part 5.
818. gbrod6.seq - Rodent sequence entries, part 6.
819. gbrod7.seq - Rodent sequence entries, part 7.
820. gbrod8.seq - Rodent sequence entries, part 8.
821. gbrod9.seq - Rodent sequence entries, part 9.
822. gbsdr.txt - Short directory of the data bank.
823. gbsec.idx - Index of the entries according to secondary accession number.
824. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
825. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
826. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
827. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
828. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
829. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
830. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
831. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
832. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
833. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
834. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
835. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
836. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
837. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
838. gbsyn.seq - Synthetic and chimeric sequence entries.
839. gbuna.seq - Unannotated sequence entries.
840. gbvrl1.seq - Viral sequence entries, part 1.
841. gbvrl2.seq - Viral sequence entries, part 2.
842. gbvrl3.seq - Viral sequence entries, part 3.
843. gbvrl4.seq - Viral sequence entries, part 4.
844. gbvrl5.seq - Viral sequence entries, part 5.
845. gbvrt1.seq - Other vertebrate sequence entries, part 1.
846. gbvrt10.seq - Other vertebrate sequence entries, part 10.
847. gbvrt2.seq - Other vertebrate sequence entries, part 2.
848. gbvrt3.seq - Other vertebrate sequence entries, part 3.
849. gbvrt4.seq - Other vertebrate sequence entries, part 4.
850. gbvrt5.seq - Other vertebrate sequence entries, part 5.
851. gbvrt6.seq - Other vertebrate sequence entries, part 6.
852. gbvrt7.seq - Other vertebrate sequence entries, part 7.
853. gbvrt8.seq - Other vertebrate sequence entries, part 8.
854. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 150.0 flatfiles require roughly 187 GB (sequence
files only) or 205 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1516340780     gbacc.idx
 518929090     gbaut1.idx
 515042461     gbaut10.idx
 500011496     gbaut11.idx
 500531754     gbaut12.idx
 518251405     gbaut13.idx
 501100561     gbaut14.idx
 501788507     gbaut15.idx
 509307899     gbaut16.idx
 506037694     gbaut17.idx
 500705600     gbaut18.idx
 505116675     gbaut19.idx
 519045223     gbaut2.idx
 500366560     gbaut20.idx
 503245430     gbaut21.idx
 505548764     gbaut22.idx
 503006989     gbaut23.idx
 518726284     gbaut24.idx
 521236865     gbaut25.idx
 520681068     gbaut26.idx
 516172062     gbaut27.idx
 506163124     gbaut28.idx
 500194127     gbaut29.idx
 509911730     gbaut3.idx
 502156084     gbaut30.idx
 512250469     gbaut31.idx
 307575683     gbaut32.idx
 500642929     gbaut4.idx
 515323648     gbaut5.idx
 502781335     gbaut6.idx
 511176675     gbaut7.idx
 501267479     gbaut8.idx
 515600545     gbaut9.idx
 252397032     gbbct1.seq
 250059344     gbbct10.seq
 250144373     gbbct11.seq
 119820585     gbbct12.seq
 250203372     gbbct2.seq
 250672887     gbbct3.seq
 250001087     gbbct4.seq
 250534275     gbbct5.seq
 250001643     gbbct6.seq
 250001896     gbbct7.seq
 250325071     gbbct8.seq
 255013238     gbbct9.seq
  11859646     gbchg.txt
 841885826     gbcon.seq
     73538     gbdel.txt
 250001010     gbenv1.seq
 243077868     gbenv2.seq
 230688425     gbest1.seq
 230687597     gbest10.seq
 230687648     gbest100.seq
 230687900     gbest101.seq
 230689174     gbest102.seq
 230687856     gbest103.seq
 230688520     gbest104.seq
 230687975     gbest105.seq
 230689669     gbest106.seq
 230690098     gbest107.seq
 230688310     gbest108.seq
 230688667     gbest109.seq
 230687816     gbest11.seq
 230689796     gbest110.seq
 230688387     gbest111.seq
 230689245     gbest112.seq
 230689753     gbest113.seq
 230689053     gbest114.seq
 230688620     gbest115.seq
 230688699     gbest116.seq
 230690226     gbest117.seq
 230687563     gbest118.seq
 230688163     gbest119.seq
 230687685     gbest12.seq
 230689423     gbest120.seq
 230688833     gbest121.seq
 230688747     gbest122.seq
 230689898     gbest123.seq
 230689014     gbest124.seq
 230688831     gbest125.seq
 230689900     gbest126.seq
 230688934     gbest127.seq
 230689259     gbest128.seq
 230689923     gbest129.seq
 230688069     gbest13.seq
 230688022     gbest130.seq
 230690515     gbest131.seq
 230689648     gbest132.seq
 230689767     gbest133.seq
 230687803     gbest134.seq
 230690541     gbest135.seq
 230690449     gbest136.seq
 230689126     gbest137.seq
 230688586     gbest138.seq
 230691385     gbest139.seq
 230689688     gbest14.seq
 230689063     gbest140.seq
 230688972     gbest141.seq
 230690138     gbest142.seq
 230688516     gbest143.seq
 230689072     gbest144.seq
 230688606     gbest145.seq
 230688036     gbest146.seq
 230688745     gbest147.seq
 230688541     gbest148.seq
 230687917     gbest149.seq
 230689253     gbest15.seq
 230690186     gbest150.seq
 230691324     gbest151.seq
 230688133     gbest152.seq
 230691638     gbest153.seq
 230691599     gbest154.seq
 230690054     gbest155.seq
 230689689     gbest156.seq
 230688218     gbest157.seq
 230689193     gbest158.seq
 230688766     gbest159.seq
 230688960     gbest16.seq
 230690660     gbest160.seq
 230688589     gbest161.seq
 230690676     gbest162.seq
 230689768     gbest163.seq
 230689981     gbest164.seq
 230690257     gbest165.seq
 230688170     gbest166.seq
 230689214     gbest167.seq
 230689433     gbest168.seq
 230687666     gbest169.seq
 230689258     gbest17.seq
 230689171     gbest170.seq
 225594256     gbest171.seq
 230687705     gbest172.seq
 230687578     gbest173.seq
 230688041     gbest174.seq
 230689747     gbest175.seq
 230687696     gbest176.seq
 230688335     gbest177.seq
 230687720     gbest178.seq
 230690442     gbest179.seq
 230689487     gbest18.seq
 230688466     gbest180.seq
 230687887     gbest181.seq
 230689261     gbest182.seq
 230688671     gbest183.seq
 230688026     gbest184.seq
 230690258     gbest185.seq
 230687879     gbest186.seq
 230687644     gbest187.seq
 230687736     gbest188.seq
 230688292     gbest189.seq
 230687919     gbest19.seq
 230688486     gbest190.seq
 230688644     gbest191.seq
 230687782     gbest192.seq
 230688416     gbest193.seq
 230690257     gbest194.seq
 230690797     gbest195.seq
 230688202     gbest196.seq
 230690191     gbest197.seq
 230688989     gbest198.seq
 230688141     gbest199.seq
 230689482     gbest2.seq
 230688549     gbest20.seq
 230689896     gbest200.seq
 230690230     gbest201.seq
 230690199     gbest202.seq
 230687638     gbest203.seq
 230687580     gbest204.seq
 230688523     gbest205.seq
 230688524     gbest206.seq
 230688039     gbest207.seq
 230689411     gbest208.seq
 230687508     gbest209.seq
 230691433     gbest21.seq
 230688449     gbest210.seq
 230689202     gbest211.seq
 230689050     gbest212.seq
 230689644     gbest213.seq
 230689574     gbest214.seq
 230689305     gbest215.seq
 230689981     gbest216.seq
 230690226     gbest217.seq
 230688410     gbest218.seq
 230689607     gbest219.seq
 230688212     gbest22.seq
 230687637     gbest220.seq
 163212760     gbest221.seq
 162070051     gbest222.seq
 168010581     gbest223.seq
 167716973     gbest224.seq
 169613041     gbest225.seq
 164868332     gbest226.seq
 164935341     gbest227.seq
 164498817     gbest228.seq
 164368329     gbest229.seq
 230689496     gbest23.seq
 164398259     gbest230.seq
 164538357     gbest231.seq
 163490074     gbest232.seq
 166039079     gbest233.seq
 165081385     gbest234.seq
 161997229     gbest235.seq
 164312619     gbest236.seq
 169037519     gbest237.seq
 166876078     gbest238.seq
 165625223     gbest239.seq
 230687858     gbest24.seq
 165769269     gbest240.seq
 165372370     gbest241.seq
 164844016     gbest242.seq
 164219629     gbest243.seq
 164355373     gbest244.seq
 165334973     gbest245.seq
 170752728     gbest246.seq
 178017653     gbest247.seq
 171476677     gbest248.seq
 220414324     gbest249.seq
 230690818     gbest25.seq
 230687897     gbest250.seq
 230689354     gbest251.seq
 230688170     gbest252.seq
 230690026     gbest253.seq
 230689830     gbest254.seq
 230689507     gbest255.seq
 230689990     gbest256.seq
 230688115     gbest257.seq
 230688733     gbest258.seq
 230689409     gbest259.seq
 230689391     gbest26.seq
 230690795     gbest260.seq
 230688372     gbest261.seq
 230688314     gbest262.seq
 230690776     gbest263.seq
 230689750     gbest264.seq
 230689248     gbest265.seq
 230689913     gbest266.seq
 230690574     gbest267.seq
 230690820     gbest268.seq
 230689272     gbest269.seq
 230689361     gbest27.seq
 230688734     gbest270.seq
 230688459     gbest271.seq
 230689690     gbest272.seq
 230689296     gbest273.seq
 230689106     gbest274.seq
 230690137     gbest275.seq
 230689826     gbest276.seq
 230688370     gbest277.seq
 214957792     gbest278.seq
 228468849     gbest279.seq
 230689420     gbest28.seq
 230687550     gbest280.seq
 230688783     gbest281.seq
 230688668     gbest282.seq
 230688124     gbest283.seq
 230690324     gbest284.seq
 230687705     gbest285.seq
 230687509     gbest286.seq
 230687446     gbest287.seq
 230688413     gbest288.seq
 230688958     gbest289.seq
 230688925     gbest29.seq
 230690672     gbest290.seq
 230689389     gbest291.seq
 230689194     gbest292.seq
 230687500     gbest293.seq
 230687493     gbest294.seq
 230688005     gbest295.seq
 230689131     gbest296.seq
 230689686     gbest297.seq
 230689770     gbest298.seq
 230689876     gbest299.seq
 230687569     gbest3.seq
 230689313     gbest30.seq
 230689637     gbest300.seq
 230689614     gbest301.seq
 230689606     gbest302.seq
 230354220     gbest303.seq
 230687872     gbest304.seq
 230689444     gbest305.seq
 230689466     gbest306.seq
 230688291     gbest307.seq
 230689757     gbest308.seq
 230688977     gbest309.seq
 230690757     gbest31.seq
 230689477     gbest310.seq
 212509080     gbest311.seq
 230690992     gbest312.seq
 230688404     gbest313.seq
 230688372     gbest314.seq
 230689568     gbest315.seq
 230688787     gbest316.seq
 186073627     gbest317.seq
 144257045     gbest318.seq
 230689397     gbest319.seq
 230689634     gbest32.seq
 230688861     gbest320.seq
 230688925     gbest321.seq
 230689479     gbest322.seq
 230689229     gbest323.seq
 230687710     gbest324.seq
 230688684     gbest325.seq
 230690055     gbest326.seq
 230689321     gbest327.seq
 230689262     gbest328.seq
 230689011     gbest329.seq
 230687547     gbest33.seq
 230688562     gbest330.seq
 230687839     gbest331.seq
 230687675     gbest332.seq
 230690431     gbest333.seq
 230691222     gbest334.seq
 230689388     gbest335.seq
 230688419     gbest336.seq
 230688383     gbest337.seq
 230687735     gbest338.seq
 230689751     gbest339.seq
 230688689     gbest34.seq
 230687551     gbest340.seq
 230689399     gbest341.seq
 230689776     gbest342.seq
 230689315     gbest343.seq
 230691235     gbest344.seq
 230688389     gbest345.seq
 230687997     gbest346.seq
 230688293     gbest347.seq
 230689512     gbest348.seq
 230688294     gbest349.seq
 230687450     gbest35.seq
 230694011     gbest350.seq
 230690869     gbest351.seq
 230691616     gbest352.seq
 230688380     gbest353.seq
 230689693     gbest354.seq
 230690271     gbest355.seq
 230689009     gbest356.seq
 230687572     gbest357.seq
 230689980     gbest358.seq
 230689957     gbest359.seq
 230687444     gbest36.seq
 230689683     gbest360.seq
 222205636     gbest361.seq
 230690450     gbest362.seq
 230690756     gbest363.seq
 230687528     gbest364.seq
 230691276     gbest365.seq
 230691016     gbest366.seq
 230688411     gbest367.seq
 206826787     gbest368.seq
 230688045     gbest369.seq
 230688002     gbest37.seq
 230689718     gbest370.seq
 230688698     gbest371.seq
 230688874     gbest372.seq
 230688145     gbest373.seq
 230688753     gbest374.seq
 230688257     gbest375.seq
 230688810     gbest376.seq
 230687965     gbest377.seq
 230688581     gbest378.seq
 230687957     gbest379.seq
 230689626     gbest38.seq
 230687592     gbest380.seq
 230689200     gbest381.seq
 230690133     gbest382.seq
 230688005     gbest383.seq
 230688212     gbest384.seq
 230688561     gbest385.seq
 230688475     gbest386.seq
 230688632     gbest387.seq
 230691712     gbest388.seq
 230688727     gbest389.seq
 230688228     gbest39.seq
 230687572     gbest390.seq
 230689747     gbest391.seq
 230688982     gbest392.seq
 230689602     gbest393.seq
 230688074     gbest394.seq
 230689577     gbest395.seq
 230690131     gbest396.seq
 230690876     gbest397.seq
 230688586     gbest398.seq
 230688241     gbest399.seq
 230687842     gbest4.seq
 196456539     gbest40.seq
 230688028     gbest400.seq
 230688778     gbest401.seq
 230691011     gbest402.seq
 230690497     gbest403.seq
 230689716     gbest404.seq
 230689169     gbest405.seq
 230688762     gbest406.seq
 230688762     gbest407.seq
 230691756     gbest408.seq
 230688964     gbest409.seq
 191760989     gbest41.seq
 230690245     gbest410.seq
 230690425     gbest411.seq
 230688077     gbest412.seq
 230688279     gbest413.seq
 230688860     gbest414.seq
 230687745     gbest415.seq
 230690082     gbest416.seq
 230688558     gbest417.seq
 230691298     gbest418.seq
 230690615     gbest419.seq
 203519394     gbest42.seq
 230690113     gbest420.seq
 230689483     gbest421.seq
 230689631     gbest422.seq
 227484633     gbest423.seq
 230690758     gbest424.seq
 230687860     gbest425.seq
 230688248     gbest426.seq
 230688349     gbest427.seq
 230688222     gbest428.seq
 230690002     gbest429.seq
 214922754     gbest43.seq
 230690676     gbest430.seq
 230687717     gbest431.seq
 230689725     gbest432.seq
 230690422     gbest433.seq
 230508929     gbest434.seq
 230688359     gbest435.seq
 109160299     gbest436.seq
 216304215     gbest44.seq
 216286911     gbest45.seq
 216578576     gbest46.seq
 230687613     gbest47.seq
 230688182     gbest48.seq
 219994945     gbest49.seq
 164950269     gbest5.seq
 230688370     gbest50.seq
 230688959     gbest51.seq
 230690628     gbest52.seq
 230689138     gbest53.seq
 230687712     gbest54.seq
 230689693     gbest55.seq
 230689191     gbest56.seq
 230687783     gbest57.seq
 230692214     gbest58.seq
 230690585     gbest59.seq
 177138923     gbest6.seq
 230688693     gbest60.seq
 230690206     gbest61.seq
 230687705     gbest62.seq
 230688531     gbest63.seq
 230689382     gbest64.seq
 228680361     gbest65.seq
 209825024     gbest66.seq
 209188599     gbest67.seq
 208881355     gbest68.seq
 209165395     gbest69.seq
 230688093     gbest7.seq
 210399212     gbest70.seq
 209805168     gbest71.seq
 208652089     gbest72.seq
 209420928     gbest73.seq
 210543066     gbest74.seq
 206392569     gbest75.seq
 206744002     gbest76.seq
 208152459     gbest77.seq
 208610675     gbest78.seq
 215481179     gbest79.seq
 230690240     gbest8.seq
 230688364     gbest80.seq
 230692549     gbest81.seq
 230692364     gbest82.seq
 216809973     gbest83.seq
 214787162     gbest84.seq
 216903992     gbest85.seq
 230688291     gbest86.seq
 230689551     gbest87.seq
 230688044     gbest88.seq
 230688069     gbest89.seq
 230689340     gbest9.seq
 230689397     gbest90.seq
 230690139     gbest91.seq
 230687773     gbest92.seq
 230690044     gbest93.seq
 230691136     gbest94.seq
 230689002     gbest95.seq
 230689130     gbest96.seq
 230688290     gbest97.seq
 230690053     gbest98.seq
 230689343     gbest99.seq
  49363682     gbgen.idx
 230689539     gbgss1.seq
 230687499     gbgss10.seq
 227251108     gbgss100.seq
 228367634     gbgss101.seq
 228713725     gbgss102.seq
 228640826     gbgss103.seq
 227919245     gbgss104.seq
 227430192     gbgss105.seq
 230688069     gbgss106.seq
 230689047     gbgss107.seq
 230687486     gbgss108.seq
 230688362     gbgss109.seq
 230691316     gbgss11.seq
 230690164     gbgss110.seq
 230688555     gbgss111.seq
 230687451     gbgss112.seq
 230687652     gbgss113.seq
 230689607     gbgss114.seq
 230687541     gbgss115.seq
 230688016     gbgss116.seq
 230689794     gbgss117.seq
 230689324     gbgss118.seq
 230687695     gbgss119.seq
 230688172     gbgss12.seq
 230688668     gbgss120.seq
 230688426     gbgss121.seq
 230689940     gbgss122.seq
 230687756     gbgss123.seq
 230689294     gbgss124.seq
 230688046     gbgss125.seq
 230687803     gbgss126.seq
 230689706     gbgss127.seq
 230689128     gbgss128.seq
 230687885     gbgss129.seq
 230690677     gbgss13.seq
  80128793     gbgss130.seq
 250001848     gbgss131.seq
 250000462     gbgss132.seq
 250000318     gbgss133.seq
 250001515     gbgss134.seq
 250002078     gbgss135.seq
 250000207     gbgss136.seq
 250000140     gbgss137.seq
 250001789     gbgss138.seq
 250002453     gbgss139.seq
 230689721     gbgss14.seq
 250001461     gbgss140.seq
 250000233     gbgss141.seq
 250002079     gbgss142.seq
 250001527     gbgss143.seq
 250001663     gbgss144.seq
 250000534     gbgss145.seq
 250001248     gbgss146.seq
 250003779     gbgss147.seq
 250000537     gbgss148.seq
 250001206     gbgss149.seq
 230689022     gbgss15.seq
 250002227     gbgss150.seq
 250000756     gbgss151.seq
 250000483     gbgss152.seq
 250002436     gbgss153.seq
 250002709     gbgss154.seq
 250002467     gbgss155.seq
 250002177     gbgss156.seq
 250000427     gbgss157.seq
  39685067     gbgss158.seq
 230689951     gbgss16.seq
 230689464     gbgss17.seq
 230688642     gbgss18.seq
 230687507     gbgss19.seq
 230689883     gbgss2.seq
 230690121     gbgss20.seq
 230690586     gbgss21.seq
 230687634     gbgss22.seq
 230688996     gbgss23.seq
 230687856     gbgss24.seq
 230689792     gbgss25.seq
 230688723     gbgss26.seq
 230690585     gbgss27.seq
 230690367     gbgss28.seq
 230689954     gbgss29.seq
 230688931     gbgss3.seq
 230689958     gbgss30.seq
 230689859     gbgss31.seq
 230688251     gbgss32.seq
 230689234     gbgss33.seq
 230690589     gbgss34.seq
 230690074     gbgss35.seq
 230688762     gbgss36.seq
 230689063     gbgss37.seq
 230687704     gbgss38.seq
 230689672     gbgss39.seq
 230689635     gbgss4.seq
 230687793     gbgss40.seq
 230687835     gbgss41.seq
 230689901     gbgss42.seq
 230687696     gbgss43.seq
 230687984     gbgss44.seq
 230689471     gbgss45.seq
 230688866     gbgss46.seq
 230687830     gbgss47.seq
 230689602     gbgss48.seq
 230690745     gbgss49.seq
 230689060     gbgss5.seq
 230687781     gbgss50.seq
 230688676     gbgss51.seq
 230688321     gbgss52.seq
 230688221     gbgss53.seq
 230688705     gbgss54.seq
 230689073     gbgss55.seq
 230688410     gbgss56.seq
 230689869     gbgss57.seq
 230689007     gbgss58.seq
 230688720     gbgss59.seq
 230690103     gbgss6.seq
 230688494     gbgss60.seq
 229363978     gbgss61.seq
 230689503     gbgss62.seq
 230689995     gbgss63.seq
 230688986     gbgss64.seq
 230689020     gbgss65.seq
 230687889     gbgss66.seq
 230687475     gbgss67.seq
 230688641     gbgss68.seq
 230688207     gbgss69.seq
 230688253     gbgss7.seq
 230688475     gbgss70.seq
 230689492     gbgss71.seq
 230688522     gbgss72.seq
 230688998     gbgss73.seq
 230687990     gbgss74.seq
 230689745     gbgss75.seq
 230689674     gbgss76.seq
 230689689     gbgss77.seq
 230687582     gbgss78.seq
 230689864     gbgss79.seq
 230688823     gbgss8.seq
 230687821     gbgss80.seq
 198947333     gbgss81.seq
 194747376     gbgss82.seq
 220402445     gbgss83.seq
 230687779     gbgss84.seq
 230687671     gbgss85.seq
 230687600     gbgss86.seq
 230689176     gbgss87.seq
 230687854     gbgss88.seq
 230687519     gbgss89.seq
 230690336     gbgss9.seq
 230690209     gbgss90.seq
 230688489     gbgss91.seq
 230688080     gbgss92.seq
 230689303     gbgss93.seq
 230688702     gbgss94.seq
 230689884     gbgss95.seq
 230688693     gbgss96.seq
 230688823     gbgss97.seq
 230689044     gbgss98.seq
 230688082     gbgss99.seq
 250001803     gbhtc1.seq
  59047178     gbhtc10.seq
 250003822     gbhtc2.seq
 250014376     gbhtc3.seq
 250007672     gbhtc4.seq
 250001304     gbhtc5.seq
 250002020     gbhtc6.seq
 250001331     gbhtc7.seq
 250002267     gbhtc8.seq
 250002435     gbhtc9.seq
 250063914     gbhtg1.seq
 250100408     gbhtg10.seq
 250023352     gbhtg11.seq
 250027159     gbhtg12.seq
 250167427     gbhtg13.seq
 250315118     gbhtg14.seq
 250158431     gbhtg15.seq
 250258507     gbhtg16.seq
 250084566     gbhtg17.seq
 250197154     gbhtg18.seq
 250196119     gbhtg19.seq
 250005030     gbhtg2.seq
 250143707     gbhtg20.seq
 250266508     gbhtg21.seq
 250050855     gbhtg22.seq
 250214154     gbhtg23.seq
 250005611     gbhtg24.seq
 250310504     gbhtg25.seq
 250247948     gbhtg26.seq
 250064688     gbhtg27.seq
 250265505     gbhtg28.seq
 250109955     gbhtg29.seq
 250067288     gbhtg3.seq
 250357168     gbhtg30.seq
 250064968     gbhtg31.seq
 250009372     gbhtg32.seq
 250307540     gbhtg33.seq
 250102394     gbhtg34.seq
 250210047     gbhtg35.seq
 250066131     gbhtg36.seq
 250242542     gbhtg37.seq
 250276064     gbhtg38.seq
 250114165     gbhtg39.seq
 250174052     gbhtg4.seq
 250247582     gbhtg40.seq
 250043320     gbhtg41.seq
 250211410     gbhtg42.seq
 250024213     gbhtg43.seq
 250119942     gbhtg44.seq
 250164605     gbhtg45.seq
 250161336     gbhtg46.seq
 250105621     gbhtg47.seq
 250206221     gbhtg48.seq
 250191214     gbhtg49.seq
 250092782     gbhtg5.seq
 250000317     gbhtg50.seq
 250135208     gbhtg51.seq
 250191609     gbhtg52.seq
 250075461     gbhtg53.seq
 250092290     gbhtg54.seq
 250077325     gbhtg55.seq
 250241670     gbhtg56.seq
 250129206     gbhtg57.seq
 250120522     gbhtg58.seq
 250106141     gbhtg59.seq
 250120763     gbhtg6.seq
 250037685     gbhtg60.seq
 250126009     gbhtg61.seq
 250248671     gbhtg62.seq
 250058825     gbhtg63.seq
 250211400     gbhtg64.seq
 250061216     gbhtg65.seq
 250219278     gbhtg66.seq
 250015159     gbhtg67.seq
 201691285     gbhtg68.seq
 250107091     gbhtg7.seq
 250173070     gbhtg8.seq
 250028325     gbhtg9.seq
 250047934     gbinv1.seq
 250100271     gbinv2.seq
 250001737     gbinv3.seq
 250001206     gbinv4.seq
 250001843     gbinv5.seq
 250057589     gbinv6.seq
 250026062     gbinv7.seq
  41708671     gbinv8.seq
 671760397     gbjou.idx
 250001910     gbmam1.seq
 123634974     gbmam2.seq
  34944613     gbnew.txt
 250000417     gbpat1.seq
 250000771     gbpat10.seq
 250003057     gbpat11.seq
 250001463     gbpat12.seq
 250001425     gbpat13.seq
 250000747     gbpat14.seq
 250000494     gbpat15.seq
 250335055     gbpat16.seq
 250000164     gbpat17.seq
 233994058     gbpat18.seq
 250000931     gbpat2.seq
 250000557     gbpat3.seq
 250000140     gbpat4.seq
 250000307     gbpat5.seq
 250049742     gbpat6.seq
 250000306     gbpat7.seq
 250000078     gbpat8.seq
 250001326     gbpat9.seq
  42599518     gbphg.seq
 250004314     gbpln1.seq
 250001283     gbpln10.seq
 250000226     gbpln11.seq
 250000975     gbpln12.seq
 250003907     gbpln13.seq
 250078492     gbpln14.seq
 250191390     gbpln15.seq
 235419586     gbpln16.seq
 250098387     gbpln2.seq
 250002144     gbpln3.seq
 250003651     gbpln4.seq
 250005291     gbpln5.seq
 250003939     gbpln6.seq
 250093940     gbpln7.seq
 275670584     gbpln8.seq
 250570165     gbpln9.seq
 250160030     gbpri1.seq
 250190943     gbpri10.seq
 250080075     gbpri11.seq
 250136929     gbpri12.seq
 250190827     gbpri13.seq
 250176316     gbpri14.seq
 250220479     gbpri15.seq
 250002008     gbpri16.seq
 250183242     gbpri17.seq
 250046612     gbpri18.seq
 250019779     gbpri19.seq
 250182735     gbpri2.seq
 250151851     gbpri20.seq
 250003800     gbpri21.seq
 250005141     gbpri22.seq
 250004176     gbpri23.seq
 250028639     gbpri24.seq
 250011422     gbpri25.seq
 250064478     gbpri26.seq
 250000930     gbpri27.seq
 250001929     gbpri28.seq
  72826826     gbpri29.seq
 250193790     gbpri3.seq
 250204692     gbpri4.seq
 250172352     gbpri5.seq
 250090245     gbpri6.seq
 250054226     gbpri7.seq
 250072244     gbpri8.seq
 250199340     gbpri9.seq
    208177     gbrel.txt
 250063469     gbrod1.seq
 250029526     gbrod10.seq
 250186355     gbrod11.seq
 250231188     gbrod12.seq
 250054875     gbrod13.seq
 250186066     gbrod14.seq
 250001241     gbrod15.seq
 250067394     gbrod16.seq
 250192278     gbrod17.seq
 250048075     gbrod18.seq
 250008957     gbrod19.seq
 250181553     gbrod2.seq
 250231241     gbrod20.seq
 204939333     gbrod21.seq
 250144868     gbrod3.seq
 250036653     gbrod4.seq
 250089261     gbrod5.seq
 250172063     gbrod6.seq
 250033392     gbrod7.seq
 250104364     gbrod8.seq
 250212570     gbrod9.seq
3932248782     gbsdr.txt
   1566058     gbsec.idx
 250002508     gbsts1.seq
 250003255     gbsts10.seq
 250002897     gbsts11.seq
 250001955     gbsts12.seq
 250002161     gbsts13.seq
  20582246     gbsts14.seq
 250000493     gbsts2.seq
 250001590     gbsts3.seq
 250001812     gbsts4.seq
 250003054     gbsts5.seq
 250001547     gbsts6.seq
 250001692     gbsts7.seq
 250000160     gbsts8.seq
 250002341     gbsts9.seq
 103491591     gbsyn.seq
    424442     gbuna.seq
 250003022     gbvrl1.seq
 250001332     gbvrl2.seq
 250002499     gbvrl3.seq
 250001776     gbvrl4.seq
 102159216     gbvrl5.seq
 250005130     gbvrt1.seq
  27295276     gbvrt10.seq
 250047029     gbvrt2.seq
 250000770     gbvrt3.seq
 250002575     gbvrt4.seq
 250315238     gbvrt5.seq
 250110189     gbvrt6.seq
 250047461     gbvrt7.seq
 250128992     gbvrt8.seq
 250000036     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         24552      102802505
BCT10        454        109366700
BCT11        42289      92502325
BCT12        12484      43769089
BCT2         7477       107448276
BCT3         297        114527223
BCT4         27943      103023877
BCT5         30053      96207411
BCT6         60648      86367387
BCT7         8048       113574561
BCT8         4150       93432656
BCT9         2202       110488744
ENV1         96639      71171716
ENV2         91273      76154220
EST1         68034      26258363
EST10        76493      29723216
EST100       73317      36391107
EST101       72760      48446198
EST102       72792      42722837
EST103       69261      46296494
EST104       74077      33208256
EST105       70334      29616354
EST106       64300      31978923
EST107       68320      40723640
EST108       69608      38430347
EST109       70923      42028736
EST11        74698      28608637
EST110       75691      34152605
EST111       74659      27627456
EST112       75290      29348538
EST113       72601      39628514
EST114       65557      31910283
EST115       78948      48092396
EST116       78996      44680730
EST117       70649      46910621
EST118       69322      40298309
EST119       72519      49456798
EST12        77211      30612340
EST120       68361      42749959
EST121       73809      45205977
EST122       75777      44399537
EST123       71679      49153480
EST124       74720      48029046
EST125       76300      47018334
EST126       76884      32752216
EST127       78398      31544440
EST128       79884      47588431
EST129       74823      42662511
EST13        76235      29134866
EST130       64855      34950878
EST131       71661      37193354
EST132       67089      36882979
EST133       66142      36132584
EST134       71246      43983772
EST135       72820      44581772
EST136       67870      39712753
EST137       67210      39999654
EST138       77039      45933995
EST139       68755      40875153
EST14        77985      31416184
EST140       60136      34040014
EST141       99105      53907419
EST142       81694      46915077
EST143       87637      45512194
EST144       108731     57757918
EST145       105223     57105563
EST146       97179      55714645
EST147       76358      45564986
EST148       93646      55827830
EST149       100066     59206702
EST15        74272      31340841
EST150       86829      48654129
EST151       72247      43042917
EST152       64618      31480811
EST153       64327      29358580
EST154       52687      24612459
EST155       67058      32681058
EST156       59163      29945254
EST157       71626      41079394
EST158       69454      46901957
EST159       68829      48381365
EST16        75803      33404914
EST160       78093      45078292
EST161       58352      30145668
EST162       64189      32754822
EST163       66764      38932529
EST164       64655      44742305
EST165       62538      36450745
EST166       97038      45254163
EST167       86246      48533618
EST168       102142     58386780
EST169       102798     59559471
EST17        80845      33050023
EST170       95357      50785952
EST171       90455      38130255
EST172       93186      47588717
EST173       92409      41170933
EST174       92079      38966764
EST175       81091      39285658
EST176       63512      43846292
EST177       71113      39137363
EST178       59851      41975331
EST179       69697      33379460
EST18        81513      32880208
EST180       74994      27732242
EST181       71624      45857768
EST182       81248      40831505
EST183       64710      33149404
EST184       68398      43186305
EST185       67888      51324126
EST186       70286      36980604
EST187       67398      39495433
EST188       70421      57297075
EST189       68277      36281258
EST19        78260      31519976
EST190       72911      36566201
EST191       69858      57817131
EST192       68301      53007071
EST193       64516      47271256
EST194       64318      47390025
EST195       65786      46891595
EST196       64487      44300139
EST197       63999      50148032
EST198       63307      39461122
EST199       64939      34374149
EST2         74718      28667916
EST20        74205      30887785
EST200       63943      37548766
EST201       82819      44376431
EST202       85072      55449839
EST203       67978      41017655
EST204       103542     65078832
EST205       108048     65428099
EST206       109279     64765727
EST207       104277     66205564
EST208       105490     62656104
EST209       106792     52204219
EST21        74913      34226601
EST210       91716      53786285
EST211       98764      43630091
EST212       85901      50218157
EST213       68326      38673458
EST214       69803      49482078
EST215       68452      59014396
EST216       76375      51323596
EST217       79342      38684461
EST218       77174      51025361
EST219       71684      51274418
EST22        73174      29510787
EST220       67398      41338334
EST221       27782      10441873
EST222       27869      10457589
EST223       26889      9861489
EST224       26956      9563576
EST225       26676      9132060
EST226       27332      10165611
EST227       27196      9634787
EST228       27226      9995051
EST229       27222      11399552
EST23        77454      32919136
EST230       27170      11590407
EST231       27205      10715255
EST232       27516      9630846
EST233       27152      8814569
EST234       27406      10930399
EST235       27882      10829686
EST236       27553      11037392
EST237       26622      11602878
EST238       26818      11969365
EST239       27122      10644430
EST24        74075      31990372
EST240       26995      11213083
EST241       27050      11910388
EST242       27227      11395282
EST243       27276      10735763
EST244       27250      10900718
EST245       27154      10348227
EST246       26173      14421538
EST247       24892      16959394
EST248       25862      17629400
EST249       89356      31411179
EST25        75076      32930108
EST250       89124      41037335
EST251       69562      44341872
EST252       69144      44739144
EST253       69100      44187552
EST254       66525      41332251
EST255       75419      43325324
EST256       65566      40577141
EST257       71410      49203786
EST258       55445      27162987
EST259       99133      47090369
EST26        73677      29978862
EST260       90852      45078272
EST261       71748      40191471
EST262       61613      28858635
EST263       70856      42003521
EST264       72241      36227990
EST265       72054      33990114
EST266       70591      42761001
EST267       72743      40736726
EST268       63751      37789060
EST269       72122      33993456
EST27        75033      32412762
EST270       85502      46814225
EST271       71248      46058699
EST272       80572      54502793
EST273       95614      51674021
EST274       98722      46717601
EST275       78061      43710416
EST276       68545      45212352
EST277       76393      35829814
EST278       69974      31598006
EST279       72578      33790020
EST28        106369     50114943
EST280       67187      40539216
EST281       60025      37608940
EST282       66991      38483522
EST283       69115      44159102
EST284       60825      38699997
EST285       85426      43252966
EST286       79952      41417707
EST287       71364      43945522
EST288       99246      56547217
EST289       118731     49044539
EST29        97900      45865335
EST290       91247      41197327
EST291       64568      34800856
EST292       71329      43673465
EST293       82118      43697108
EST294       72339      39169017
EST295       69960      44650674
EST296       69355      38386703
EST297       63674      37329645
EST298       47140      25198157
EST299       72556      52515714
EST3         73590      29860872
EST30        99167      53270037
EST300       71237      40072568
EST301       76632      48355481
EST302       62506      34501764
EST303       78085      45014363
EST304       76375      36406991
EST305       74593      33799101
EST306       77541      32987218
EST307       77534      33637889
EST308       93456      61645596
EST309       68304      53253358
EST31        80011      45465408
EST310       82209      50088749
EST311       75680      38896388
EST312       68031      53891151
EST313       65093      49866360
EST314       59743      43981248
EST315       62721      33299920
EST316       72099      47678435
EST317       59197      36774029
EST318       48699      23935702
EST319       68129      36242824
EST32        67025      52401272
EST320       65541      35234976
EST321       61527      29881451
EST322       63642      41170151
EST323       81373      45182081
EST324       72432      40589596
EST325       68663      41440556
EST326       71351      40814204
EST327       62296      42901718
EST328       84971      48573295
EST329       84885      49999274
EST33        75309      53199310
EST330       81323      44731234
EST331       64201      35771224
EST332       67582      37222842
EST333       72820      39878513
EST334       47674      24516911
EST335       62941      35805313
EST336       69774      42263893
EST337       98221      45798310
EST338       75467      44985128
EST339       74522      50110921
EST34        86484      46900746
EST340       74476      48416565
EST341       63606      34943439
EST342       78547      37044832
EST343       77222      38681803
EST344       55514      39189793
EST345       61296      38768427
EST346       61367      39239651
EST347       95553      53791255
EST348       82482      43540146
EST349       70400      46894836
EST35        87620      44851639
EST350       73927      37856899
EST351       47592      29468026
EST352       44209      23149315
EST353       81601      54073573
EST354       80254      39513395
EST355       78630      46618619
EST356       68718      40360546
EST357       66885      38804752
EST358       68379      42319579
EST359       66839      38349116
EST36        93697      52346085
EST360       62428      34554857
EST361       80162      25241829
EST362       72666      34975304
EST363       70794      40295663
EST364       69112      36568672
EST365       70043      42834932
EST366       75795      48325061
EST367       64400      38814394
EST368       79682      46442087
EST369       57185      33142632
EST37        101176     45990899
EST370       68849      44846308
EST371       80297      49610495
EST372       82778      46426056
EST373       61268      39442344
EST374       56425      41279037
EST375       57432      40451522
EST376       60304      40650694
EST377       78095      48135161
EST378       54102      32080086
EST379       56142      36662085
EST38        97764      50547316
EST380       62415      40149053
EST381       57046      41524152
EST382       61061      42327632
EST383       47767      33736156
EST384       78933      39873326
EST385       57231      39879044
EST386       51457      40489431
EST387       76741      45358098
EST388       56877      34529163
EST389       98292      49803873
EST39        102496     46838988
EST390       94474      55179407
EST391       85770      53567050
EST392       66306      46167122
EST393       42466      29567481
EST394       46954      58513734
EST395       60396      56649659
EST396       63121      41605549
EST397       71038      43910965
EST398       67989      42900334
EST399       70499      43541915
EST4         73953      28155396
EST40        70887      21346443
EST400       61639      51419104
EST401       63315      42785292
EST402       57014      38215175
EST403       57157      40892278
EST404       58733      39194992
EST405       66510      51085809
EST406       64012      46314442
EST407       59201      40675602
EST408       51780      38526493
EST409       56818      38638187
EST41        68753      18204283
EST410       55726      41498336
EST411       66044      37344149
EST412       64564      43880698
EST413       57067      38187285
EST414       59008      42244419
EST415       58417      45738920
EST416       59773      45359649
EST417       55770      40401904
EST418       58050      41529061
EST419       56243      36772459
EST42        76806      22485432
EST420       58168      38135619
EST421       74916      42736741
EST422       62381      50004870
EST423       74537      57669255
EST424       79264      50132341
EST425       47030      55151595
EST426       51911      50505337
EST427       62740      51030242
EST428       57821      39564211
EST429       80939      30577865
EST43        43485      12055737
EST430       70098      24882434
EST431       73547      27691690
EST432       74071      26183927
EST433       78798      26928986
EST434       75018      27213906
EST435       68668      29300748
EST436       38565      13296764
EST44        43230      11776132
EST45        42900      12011831
EST46        42968      11176232
EST47        98213      43765307
EST48        94283      43763598
EST49        90013      47578965
EST5         48552      15462195
EST50        86721      39489322
EST51        106908     56678629
EST52        91391      43941942
EST53        74024      31101859
EST54        69168      30794917
EST55        70591      30643214
EST56        73396      30902311
EST57        82423      32491997
EST58        71882      28093422
EST59        64019      28068068
EST6         55001      17440741
EST60        72773      31568953
EST61        74936      35481875
EST62        73784      32271846
EST63        75747      27125227
EST64        79287      31054011
EST65        71884      31115070
EST66        39991      11408288
EST67        40030      11344339
EST68        40186      12599056
EST69        40449      12231105
EST7         74090      29152490
EST70        40427      12453868
EST71        40344      12869839
EST72        40351      12491127
EST73        40175      12061622
EST74        40200      12302750
EST75        41009      12205242
EST76        41130      12333957
EST77        41050      13053089
EST78        40851      12971563
EST79        43409      12451015
EST8         75313      30469369
EST80        43469      19870297
EST81        40615      24713510
EST82        42588      18489879
EST83        49618      21097708
EST84        50848      21388555
EST85        49808      21938161
EST86        79409      43489486
EST87        72224      27935308
EST88        75763      29480562
EST89        74628      38880541
EST9         77448      29829010
EST90        76427      41914876
EST91        77950      44737002
EST92        75542      34799667
EST93        75606      43750645
EST94        70799      36336624
EST95        75155      33626204
EST96        72610      44928808
EST97        73265      34062526
EST98        72973      42873521
EST99        67047      36008169
GSS1         90825      38838374
GSS10        75205      43833923
GSS100       75196      41109744
GSS101       73893      44374237
GSS102       73489      45391505
GSS103       73573      45179572
GSS104       73235      45056680
GSS105       73603      43965682
GSS106       79449      52130752
GSS107       86079      58445081
GSS108       81832      53766433
GSS109       84512      52612587
GSS11        69998      35693198
GSS110       86172      51306276
GSS111       79798      65808394
GSS112       86603      46643126
GSS113       94476      56508493
GSS114       75987      47618217
GSS115       85686      59278422
GSS116       84196      65089982
GSS117       77176      39221769
GSS118       84297      54458168
GSS119       94187      53792390
GSS12        73548      38676139
GSS120       84786      55753612
GSS121       85069      55329947
GSS122       82489      57991951
GSS123       76670      69909081
GSS124       78594      66232449
GSS125       78739      54392379
GSS126       78596      54829732
GSS127       79301      53707616
GSS128       79087      54100430
GSS129       78399      55145918
GSS13        76846      38733068
GSS130       28214      17686948
GSS131       87189      64730126
GSS132       83935      63019497
GSS133       101311     46888797
GSS134       68799      58599541
GSS135       68296      58745907
GSS136       69348      56613476
GSS137       69621      56082951
GSS138       70278      55419927
GSS139       86049      73374580
GSS14        71351      32037362
GSS140       85313      40431100
GSS141       70907      48228907
GSS142       109999     71837295
GSS143       85394      35965880
GSS144       90762      68076060
GSS145       73220      60878875
GSS146       70232      59161488
GSS147       66132      63154574
GSS148       74673      56074743
GSS149       120670     73160850
GSS15        70727      35302355
GSS150       118174     75728887
GSS151       104435     58892426
GSS152       88215      55953190
GSS153       93471      57417904
GSS154       85521      45434260
GSS155       91712      51067995
GSS156       86238      62577394
GSS157       102366     49486503
GSS158       15538      6819387
GSS16        77805      45829341
GSS17        70880      33341715
GSS18        58368      27832664
GSS19        56833      28963673
GSS2         89386      39537205
GSS20        57717      26580474
GSS21        61790      30521317
GSS22        64701      36732561
GSS23        57508      27136654
GSS24        67089      42491182
GSS25        67317      27788589
GSS26        58125      25492551
GSS27        66241      32328960
GSS28        64506      32387341
GSS29        79220      40156130
GSS3         87699      41940144
GSS30        82123      39902420
GSS31        74222      40352992
GSS32        70471      48512182
GSS33        80005      37624826
GSS34        75905      40292774
GSS35        74374      39340216
GSS36        87736      57805086
GSS37        87596      58176489
GSS38        85652      44895069
GSS39        85834      49549719
GSS4         79303      41207047
GSS40        87299      38845126
GSS41        82757      34009078
GSS42        81263      56908701
GSS43        79620      57640913
GSS44        72032      47495447
GSS45        72037      47428341
GSS46        77835      45455272
GSS47        78046      39400845
GSS48        83577      58296595
GSS49        86643      65958461
GSS5         79041      40731282
GSS50        82625      53438198
GSS51        93543      59670465
GSS52        88622      59030929
GSS53        75348      40195855
GSS54        74361      42581732
GSS55        86004      45597609
GSS56        88465      59112252
GSS57        76347      66964893
GSS58        72031      79231791
GSS59        88229      68527411
GSS6         78255      38895462
GSS60        86956      57928940
GSS61        63531      45297606
GSS62        69224      47671944
GSS63        89663      67258677
GSS64        86190      58139321
GSS65        87493      53892713
GSS66        87665      56788287
GSS67        97100      58010510
GSS68        100582     54567212
GSS69        100682     54439986
GSS7         77539      39418357
GSS70        101370     53568620
GSS71        102347     52329070
GSS72        102419     52237097
GSS73        102693     51890037
GSS74        102088     52656399
GSS75        98441      57315581
GSS76        90170      69724551
GSS77        89833      70782396
GSS78        88048      69610767
GSS79        87829      69671899
GSS8         76330      38105833
GSS80        89102      63254342
GSS81        80838      23855279
GSS82        77798      24499292
GSS83        88037      36324842
GSS84        84159      50449025
GSS85        80753      49008004
GSS86        89510      64569283
GSS87        78721      61991391
GSS88        78080      79495133
GSS89        76552      56173113
GSS9         72576      37287728
GSS90        94886      51038385
GSS91        76016      40994182
GSS92        86149      49605824
GSS93        69298      61632667
GSS94        86129      52217766
GSS95        82467      61189559
GSS96        87371      57356171
GSS97        82932      57666309
GSS98        90706      54235130
GSS99        80427      67745453
HTC1         31500      54333086
HTC10        13071      21812641
HTC2         28724      63888728
HTC3         17511      41047686
HTC4         16141      39813846
HTC5         40806      30691362
HTC6         68319      60303310
HTC7         79269      67446869
HTC8         67903      59695502
HTC9         63867      87041314
HTG1         1315       188873586
HTG10        1240       186599456
HTG11        1429       184143201
HTG12        877        191866114
HTG13        751        192351055
HTG14        741        192407714
HTG15        776        192259975
HTG16        803        192166211
HTG17        764        192239765
HTG18        2018       171831359
HTG19        1033       188317118
HTG2         2562       185987793
HTG20        1053       188396307
HTG21        776        192077412
HTG22        923        190357187
HTG23        880        191002667
HTG24        828        191124020
HTG25        771        192277748
HTG26        846        191489931
HTG27        854        191487048
HTG28        962        189909858
HTG29        918        190676403
HTG3         2450       185367940
HTG30        929        190770956
HTG31        882        191171934
HTG32        957        189809603
HTG33        891        191070779
HTG34        838        191688257
HTG35        835        191885462
HTG36        884        190994624
HTG37        945        190425358
HTG38        944        190744769
HTG39        969        190159901
HTG4         2528       188491565
HTG40        1147       187856396
HTG41        1138       188446622
HTG42        1318       187066536
HTG43        1168       188473122
HTG44        1113       189447223
HTG45        1166       191349096
HTG46        1281       190918452
HTG47        1159       191484049
HTG48        1143       191361086
HTG49        1051       190833609
HTG5         1281       185672761
HTG50        926        189188753
HTG51        1075       190193642
HTG52        928        189821006
HTG53        1084       189938840
HTG54        953        189961847
HTG55        1024       190231197
HTG56        967        189407639
HTG57        941        189477515
HTG58        1567       186083255
HTG59        1669       186442595
HTG6         1273       185317990
HTG60        1730       182841769
HTG61        1238       191385232
HTG62        1125       191037774
HTG63        1553       188612628
HTG64        1028       194008678
HTG65        1028       193977516
HTG66        1050       193985134
HTG67        794        181996663
HTG68        880        147901638
HTG7         1247       185558835
HTG8         1288       185063308
HTG9         1183       187094560
INV1         17465      161506963
INV2         1605       166306551
INV3         34769      114772198
INV4         76282      75415616
INV5         76473      74158774
INV6         51192      96562901
INV7         52128      98468369
INV8         1564       21811610
MAM1         52992      114446373
MAM2         29556      46283400
PAT1         222671     70172634
PAT10        128933     47841964
PAT11        97123      61985189
PAT12        127509     52879880
PAT13        146951     55560908
PAT14        165670     72143294
PAT15        100082     124374609
PAT16        123450     102792157
PAT17        112785     108436463
PAT18        153340     70279920
PAT2         194383     84711839
PAT3         172019     95882664
PAT4         153753     106055882
PAT5         143528     89514438
PAT6         116572     110607914
PAT7         143991     91091822
PAT8         129560     98134037
PAT9         135465     92265301
PHG          2713       16892737
PLN1         35722      120665929
PLN10        3327       174051990
PLN11        60718      63392321
PLN12        77257      78474058
PLN13        75422      78821563
PLN14        30389      120528796
PLN15        49001      106006810
PLN16        38653      100907188
PLN2         1372       176061816
PLN3         7005       161042422
PLN4         77241      78245697
PLN5         69570      66635054
PLN6         31540      54583147
PLN7         4016       160572942
PLN8         1482       193109364
PLN9         6          197759100
PRI1         21385      141291438
PRI10        1439       181601196
PRI11        1297       178993935
PRI12        1535       178239302
PRI13        1609       179766023
PRI14        1483       186462441
PRI15        19902      158699499
PRI16        43567      101684928
PRI17        19688      130546712
PRI18        1610       183572072
PRI19        1718       183439903
PRI2         1464       173186141
PRI20        2071       181914735
PRI21        2076       182316473
PRI22        20776      148017752
PRI23        49995      82644293
PRI24        27194      95505401
PRI25        7817       176587045
PRI26        22213      149002936
PRI27        52112      115214155
PRI28        41928      122651213
PRI29        19777      25898904
PRI3         1278       186319459
PRI4         1331       184437581
PRI5         1193       181116628
PRI6         1204       179249884
PRI7         1232       180155920
PRI8         1369       174614632
PRI9         1232       177892935
ROD1         9105       169550313
ROD10        987        182638165
ROD11        994        185963836
ROD12        1014       186743265
ROD13        969        179790252
ROD14        971        183406785
ROD15        24620      149837087
ROD16        4276       181949031
ROD17        1201       192964436
ROD18        1295       193838472
ROD19        39248      96356666
ROD2         925        174137255
ROD20        18542      123391283
ROD21        46127      82360095
ROD3         904        174367270
ROD4         903        174076551
ROD5         930        174533804
ROD6         981        180560947
ROD7         978        180565114
ROD8         979        181722241
ROD9         1026       183925935
STS1         82591      35548343
STS10        58196      44474190
STS11        58015      43677385
STS12        76098      38169809
STS13        88245      39069267
STS14        8836       3789706
STS2         83958      44526595
STS3         76847      31086836
STS4         66334      33768234
STS5         54871      31972804
STS6         54726      32230056
STS7         54690      32200496
STS8         56412      38823659
STS9         58081      44561334
SYN          23907      32611130
UNA          216        116205
VRL1         72415      65666371
VRL2         72193      65413007
VRL3         71214      69418406
VRL4         74922      62965440
VRL5         26464      31924732
VRT1         53931      111415911
VRT10        7989       8694193
VRT2         21068      158552464
VRT3         69093      87720768
VRT4         44555      65304813
VRT5         2154       191672681
VRT6         1287       193156973
VRT7         1359       192886822
VRT8         20402      164034304
VRT9         31407      146745650


2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 150.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries       Bases   Species

8605799 11223873006   Homo sapiens
6619554  7826513924   Mus musculus
1015598  5669351545   Rattus norvegicus
863370   2190523168   Danio rerio
1217918  2106396859   Bos taurus
2621324  1742224470   Zea mays
357968   1171422358   Oryza sativa (japonica cultivar-group)
1178574   950295949   Xenopus tropicalis
1409337   805797459   Canis familiaris
533781    785906528   Drosophila melanogaster
777451    668960557   Gallus gallus
981325    647874977   Arabidopsis thaliana
207686    528676975   Pan troglodytes
784728    463990613   Sorghum bicolor
661770    449692566   Sus scrofa
693916    419866886   Ciona intestinalis
387865    409144272   Medicago truncatula
596253    404129844   Brassica oleracea
65653     386652884   Macaca mulatta
612478    348405643   Triticum aestivum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 October 2005

                NCBI-GenBank Flat File Release 150.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 150.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
	Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
	Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
	Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
	Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Tony Stearman

User Support
	Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
	Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
	Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
	David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center