Release Notes For GenBank Release 151

GBREL.TXT          Genetic Sequence Data Bank
                         December 15 2005

               NCBI-GenBank Flat File Release 151.0

                    Distribution Release Notes

 52016762 loci, 56037734462 bases, from 52016762 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource from which those other
efforts draw. For information about TPA and RefSeq, please refer to:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 151.0
1.2 Cutoff Date
1.3 Important Changes in Release 151.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 151.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 151.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.

1.2 Cutoff Date

  This full release, 151.0, incorporates data available to the collaborating
databases as of December 9, 2005 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 151.0

1.3.1 Problems generating accession, keyword, and author-name indexes

  The methods used to generate the 'index' files which accompany GenBank
releases (see Section 3.3) are no longer adequate to the task of generating
those products.

  The required multi-server queries which obtain and sort many millions of
rows of terms from several different databases, with ever-growing RAM
requirements, have simply outgrown the capacity of the hardware used for
GenBank Release generation. For GenBank 151.0, the affected 'indexes' include:

	    gbacc.idx  (accession number index)
	    gbaut*.idx (author name index)
	    gbkey.idx  (keyword index)

  A version of gbacc.idx was built manually (but note that the first field
contains just an accession number, rather than Accession.Version). For
the author name index, only the first 26 of an expected 34 gbaut*.idx files
could be generated. The gbkey.idx file failed completely, and is absent from
this release.

  The 'index' files are considered to be largely a legacy data product by
NCBI, generated mainly for historical reasons. FTP statistics since January
2005 seem to support this: the index files are transferred only half as
frequently as the files of sequence records. The inherent inefficiency of
the index file format also leads us to suspect that they have little
serious use by the user community. For example, what value is there in a
triplet of data values for keyword "EST" in gbkey.idx, for each and every
one of the 32 *million* EST sequences in GenBank? That keyword could 
simply be assumed to apply to every sequence in the gbest*.seq sequence files.

  As a result, the software to generate the index file products has received
little attention over the years, and has finally reached its limitations. 
Several courses are now possible:

a) Cease support of the 'index' file products altogether.

b) Segment the index files by major functional categories (EST, GSS, and
   'other'), generating, for example, an EST-specific author-name index,
   a GSS-specific author-name index, and an author-name index for all
   other sequences.

c) Provide a new product that presents some of the most useful data from
   the legacy 'index' files, and cease support for other types index data.

  Our short-term choice will most likely be (b). But even that is a stop-gap,
and thus we are likely to pursue either (a) or (c) within the next year.

  If you are a user of the 'index' files associated with GenBank files, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that this ongoing problem may cause.

1.3.2 Organizational changes

  The total number of sequence data files increased by 41 with this release:

  - the BCT division is now comprised of  13 files (+1)
  - the ENV division is now comprised of   3 files (+1)
  - the EST division is now comprised of 464 files (+28)
  - the GSS division is now comprised of 164 files (+6)
  - the HTG division is now comprised of  69 files (+1)
  - the PAT division is now comprised of  19 files (+1)
  - the PLN division is now comprised of  17 files (+1)
  - the ROD division is now comprised of  23 files (+2)

  The total number of author-name 'index' files decreased by 6 with this
  release, for reasons described in Section 1.3.1 .

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
thirty-two of the GSS flatfiles in Release 151.0. Consider gbgss133.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                          December 15 2005

                NCBI-GenBank Flat File Release 151.0

                           GSS Sequences (Part 1)

   87159 loci,    64705276 bases, from    87159 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "133" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New Linetype for Genome Project Identifier

  DDBJ, EMBL, and GenBank are working to create a collaborative system that
will assign a unique numeric identifier to genome projects. The purpose of
this new identifier is to provide a link among sequence records that pertain
to a specific genome sequencing project.

  At GenBank, this new identifier will be presented in the flatfile format
via a new linetype : PROJECT . Here is a mocked-up example demonstrating
the new linetype's use:

LOCUS       CH476840             1669278 bp    DNA     linear   CON 05-OCT-2005
DEFINITION  Magnaporthe grisea 70-15 supercont5.200 genomic scaffold, whole
            genome shotgun sequence.
ACCESSION   CH476840 AACU02000000
VERSION     CH476840.1  GI:77022292
PROJECT     GENOME_PROJECT:12345

The integer 12345 represents the value of a possible genome project
identifier.

There is a possibility that the contents of the PROJECT line might change 
somewhat from this example by the time the new identifier is implemented.
We will keep you posted of any such changes via these release notes and the
GenBank listserv.

  These Genome Project identifiers will be searchable within NCBI's
Entrez: Genome-Project database:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  The earliest date on which this new linetype will appear in the GenBank
flatfile format is February 15 2006.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview


  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 890 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut3.idx - Index of the entries according to accession number, part 3.
22. gbaut4.idx - Index of the entries according to accession number, part 4.
23. gbaut5.idx - Index of the entries according to accession number, part 5.
24. gbaut6.idx - Index of the entries according to accession number, part 6.
25. gbaut7.idx - Index of the entries according to accession number, part 7.
26. gbaut8.idx - Index of the entries according to accession number, part 8.
27. gbaut9.idx - Index of the entries according to accession number, part 9.
28. gbbct1.seq - Bacterial sequence entries, part 1.
29. gbbct10.seq - Bacterial sequence entries, part 10.
30. gbbct11.seq - Bacterial sequence entries, part 11.
31. gbbct12.seq - Bacterial sequence entries, part 12.
32. gbbct13.seq - Bacterial sequence entries, part 13.
33. gbbct2.seq - Bacterial sequence entries, part 2.
34. gbbct3.seq - Bacterial sequence entries, part 3.
35. gbbct4.seq - Bacterial sequence entries, part 4.
36. gbbct5.seq - Bacterial sequence entries, part 5.
37. gbbct6.seq - Bacterial sequence entries, part 6.
38. gbbct7.seq - Bacterial sequence entries, part 7.
39. gbbct8.seq - Bacterial sequence entries, part 8.
40. gbbct9.seq - Bacterial sequence entries, part 9.
41. gbchg.txt - Accession numbers of entries updated since the previous release.
42. gbcon.seq - Constructed sequence entries.
43. gbdel.txt - Accession numbers of entries deleted since the previous release.
44. gbenv1.seq - Environmental sampling sequence entries, part 1.
45. gbenv2.seq - Environmental sampling sequence entries, part 2.
46. gbenv3.seq - Environmental sampling sequence entries, part 3.
47. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
48. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
49. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
50. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
51. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
52. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
53. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
54. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
55. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
56. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
57. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
58. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
59. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
60. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
61. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
62. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
63. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
64. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
65. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
66. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
67. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
68. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
69. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
70. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
71. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
72. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
73. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
74. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
75. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
76. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
77. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
78. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
79. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
80. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
81. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
82. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
83. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
84. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
85. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
86. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
87. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
88. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
89. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
90. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
91. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
92. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
93. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
94. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
95. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
96. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
97. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
98. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
99. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
100. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
101. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
102. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
103. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
104. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
105. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
106. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
107. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
108. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
109. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
110. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
111. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
112. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
113. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
114. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
115. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
116. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
117. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
118. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
119. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
120. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
121. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
122. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
123. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
124. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
125. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
126. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
127. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
128. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
129. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
130. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
131. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
132. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
133. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
134. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
135. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
136. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
137. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
138. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
139. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
140. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
141. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
142. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
143. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
144. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
145. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
146. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
147. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
148. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
149. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
150. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
151. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
152. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
153. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
154. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
155. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
156. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
157. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
158. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
159. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
160. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
161. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
162. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
163. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
164. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
165. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
166. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
167. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
168. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
169. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
170. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
171. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
172. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
173. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
174. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
175. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
176. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
177. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
178. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
179. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
180. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
181. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
182. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
183. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
184. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
185. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
186. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
187. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
188. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
189. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
190. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
191. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
192. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
193. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
194. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
195. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
196. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
197. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
198. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
199. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
200. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
201. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
202. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
203. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
204. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
205. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
206. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
207. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
208. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
209. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
210. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
211. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
212. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
213. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
214. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
215. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
216. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
217. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
218. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
219. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
220. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
221. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
222. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
223. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
224. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
225. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
226. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
227. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
228. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
229. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
230. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
231. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
232. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
233. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
234. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
235. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
236. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
237. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
238. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
239. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
240. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
241. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
242. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
243. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
244. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
245. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
246. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
247. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
248. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
249. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
250. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
251. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
252. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
253. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
254. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
255. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
256. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
257. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
258. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
259. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
260. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
261. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
262. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
263. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
264. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
265. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
266. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
267. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
268. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
269. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
270. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
271. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
272. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
273. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
274. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
275. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
276. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
277. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
278. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
279. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
280. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
281. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
282. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
283. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
284. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
285. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
286. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
287. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
288. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
289. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
290. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
291. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
292. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
293. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
294. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
295. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
296. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
297. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
298. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
299. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
300. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
301. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
302. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
303. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
304. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
305. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
306. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
307. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
308. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
309. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
310. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
311. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
312. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
313. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
314. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
315. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
316. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
317. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
318. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
319. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
320. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
321. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
322. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
323. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
324. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
325. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
326. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
327. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
328. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
329. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
330. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
331. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
332. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
333. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
334. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
335. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
336. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
337. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
338. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
339. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
340. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
341. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
342. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
343. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
344. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
345. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
346. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
347. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
348. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
349. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
350. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
351. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
352. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
353. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
354. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
355. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
356. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
357. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
358. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
359. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
360. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
361. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
362. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
363. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
364. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
365. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
366. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
367. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
368. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
369. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
370. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
371. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
372. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
373. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
374. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
375. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
376. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
377. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
378. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
379. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
380. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
381. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
382. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
383. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
384. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
385. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
386. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
387. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
388. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
389. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
390. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
391. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
392. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
393. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
394. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
395. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
396. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
397. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
398. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
399. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
400. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
401. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
402. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
403. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
404. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
405. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
406. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
407. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
408. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
409. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
410. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
411. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
412. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
413. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
414. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
415. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
416. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
417. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
418. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
419. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
420. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
421. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
422. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
423. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
424. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
425. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
426. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
427. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
428. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
429. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
430. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
431. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
432. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
433. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
434. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
435. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
436. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
437. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
438. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
439. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
440. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
441. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
442. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
443. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
444. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
445. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
446. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
447. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
448. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
449. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
450. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
451. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
452. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
453. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
454. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
455. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
456. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
457. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
458. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
459. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
460. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
461. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
462. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
463. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
464. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
465. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
466. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
467. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
468. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
469. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
470. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
471. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
472. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
473. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
474. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
475. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
476. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
477. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
478. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
479. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
480. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
481. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
482. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
483. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
484. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
485. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
486. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
487. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
488. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
489. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
490. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
491. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
492. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
493. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
494. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
495. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
496. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
497. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
498. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
499. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
500. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
501. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
502. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
503. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
504. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
505. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
506. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
507. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
508. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
509. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
510. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
511. gbgen.idx - Index of the entries according to gene symbols.
512. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
513. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
514. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
515. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
516. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
517. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
518. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
519. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
520. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
521. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
522. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
523. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
524. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
525. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
526. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
527. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
528. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
529. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
530. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
531. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
532. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
533. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
534. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
535. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
536. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
537. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
538. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
539. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
540. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
541. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
542. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
543. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
544. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
545. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
546. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
547. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
548. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
549. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
550. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
551. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
552. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
553. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
554. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
555. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
556. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
557. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
558. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
559. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
560. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
561. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
562. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
563. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
564. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
565. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
566. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
567. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
568. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
569. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
570. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
571. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
572. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
573. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
574. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
575. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
576. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
577. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
578. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
579. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
580. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
581. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
582. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
583. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
584. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
585. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
586. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
587. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
588. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
589. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
590. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
591. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
592. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
593. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
594. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
595. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
596. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
597. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
598. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
599. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
600. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
601. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
602. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
603. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
604. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
605. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
606. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
607. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
608. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
609. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
610. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
611. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
612. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
613. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
614. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
615. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
616. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
617. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
618. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
619. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
620. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
621. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
622. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
623. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
624. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
625. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
626. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
627. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
628. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
629. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
630. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
631. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
632. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
633. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
634. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
635. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
636. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
637. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
638. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
639. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
640. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
641. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
642. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
643. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
644. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
645. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
646. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
647. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
648. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
649. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
650. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
651. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
652. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
653. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
654. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
655. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
656. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
657. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
658. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
659. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
660. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
661. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
662. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
663. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
664. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
665. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
666. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
667. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
668. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
669. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
670. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
671. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
672. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
673. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
674. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
675. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
676. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
677. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
678. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
679. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
680. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
681. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
682. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
683. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
684. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
685. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
686. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
687. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
688. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
689. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
690. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
691. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
692. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
693. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
694. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
695. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
696. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
697. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
698. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
699. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
700. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
701. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
702. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
703. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
704. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
705. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
706. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
707. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
708. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
709. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
710. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
711. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
712. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
713. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
714. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
715. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
716. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
717. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
718. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
719. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
720. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
721. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
722. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
723. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
724. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
725. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
726. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
727. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
728. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
729. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
730. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
731. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
732. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
733. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
734. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
735. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
736. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
737. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
738. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
739. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
740. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
741. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
742. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
743. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
744. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
745. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
746. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
747. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
748. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
749. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
750. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
751. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
752. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
753. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
754. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
755. gbinv1.seq - Invertebrate sequence entries, part 1.
756. gbinv2.seq - Invertebrate sequence entries, part 2.
757. gbinv3.seq - Invertebrate sequence entries, part 3.
758. gbinv4.seq - Invertebrate sequence entries, part 4.
759. gbinv5.seq - Invertebrate sequence entries, part 5.
760. gbinv6.seq - Invertebrate sequence entries, part 6.
761. gbinv7.seq - Invertebrate sequence entries, part 7.
762. gbinv8.seq - Invertebrate sequence entries, part 8.
763. gbjou.idx - Index of the entries according to journal citation.
764. gbmam1.seq - Other mammalian sequence entries, part 1.
765. gbmam2.seq - Other mammalian sequence entries, part 2.
766. gbnew.txt - Accession numbers of entries new since the previous release.
767. gbpat1.seq - Patent sequence entries, part 1.
768. gbpat10.seq - Patent sequence entries, part 10.
769. gbpat11.seq - Patent sequence entries, part 11.
770. gbpat12.seq - Patent sequence entries, part 12.
771. gbpat13.seq - Patent sequence entries, part 13.
772. gbpat14.seq - Patent sequence entries, part 14.
773. gbpat15.seq - Patent sequence entries, part 15.
774. gbpat16.seq - Patent sequence entries, part 16.
775. gbpat17.seq - Patent sequence entries, part 17.
776. gbpat18.seq - Patent sequence entries, part 18.
777. gbpat19.seq - Patent sequence entries, part 19.
778. gbpat2.seq - Patent sequence entries, part 2.
779. gbpat3.seq - Patent sequence entries, part 3.
780. gbpat4.seq - Patent sequence entries, part 4.
781. gbpat5.seq - Patent sequence entries, part 5.
782. gbpat6.seq - Patent sequence entries, part 6.
783. gbpat7.seq - Patent sequence entries, part 7.
784. gbpat8.seq - Patent sequence entries, part 8.
785. gbpat9.seq - Patent sequence entries, part 9.
786. gbphg.seq - Phage sequence entries.
787. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
788. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
789. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
790. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
791. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
792. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
793. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
794. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
795. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
796. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
797. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
798. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
799. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
800. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
801. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
802. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
803. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
804. gbpri1.seq - Primate sequence entries, part 1.
805. gbpri10.seq - Primate sequence entries, part 10.
806. gbpri11.seq - Primate sequence entries, part 11.
807. gbpri12.seq - Primate sequence entries, part 12.
808. gbpri13.seq - Primate sequence entries, part 13.
809. gbpri14.seq - Primate sequence entries, part 14.
810. gbpri15.seq - Primate sequence entries, part 15.
811. gbpri16.seq - Primate sequence entries, part 16.
812. gbpri17.seq - Primate sequence entries, part 17.
813. gbpri18.seq - Primate sequence entries, part 18.
814. gbpri19.seq - Primate sequence entries, part 19.
815. gbpri2.seq - Primate sequence entries, part 2.
816. gbpri20.seq - Primate sequence entries, part 20.
817. gbpri21.seq - Primate sequence entries, part 21.
818. gbpri22.seq - Primate sequence entries, part 22.
819. gbpri23.seq - Primate sequence entries, part 23.
820. gbpri24.seq - Primate sequence entries, part 24.
821. gbpri25.seq - Primate sequence entries, part 25.
822. gbpri26.seq - Primate sequence entries, part 26.
823. gbpri27.seq - Primate sequence entries, part 27.
824. gbpri28.seq - Primate sequence entries, part 28.
825. gbpri29.seq - Primate sequence entries, part 29.
826. gbpri3.seq - Primate sequence entries, part 3.
827. gbpri4.seq - Primate sequence entries, part 4.
828. gbpri5.seq - Primate sequence entries, part 5.
829. gbpri6.seq - Primate sequence entries, part 6.
830. gbpri7.seq - Primate sequence entries, part 7.
831. gbpri8.seq - Primate sequence entries, part 8.
832. gbpri9.seq - Primate sequence entries, part 9.
833. gbrel.txt - Release notes (this document).
834. gbrod1.seq - Rodent sequence entries, part 1.
835. gbrod10.seq - Rodent sequence entries, part 10.
836. gbrod11.seq - Rodent sequence entries, part 11.
837. gbrod12.seq - Rodent sequence entries, part 12.
838. gbrod13.seq - Rodent sequence entries, part 13.
839. gbrod14.seq - Rodent sequence entries, part 14.
840. gbrod15.seq - Rodent sequence entries, part 15.
841. gbrod16.seq - Rodent sequence entries, part 16.
842. gbrod17.seq - Rodent sequence entries, part 17.
843. gbrod18.seq - Rodent sequence entries, part 18.
844. gbrod19.seq - Rodent sequence entries, part 19.
845. gbrod2.seq - Rodent sequence entries, part 2.
846. gbrod20.seq - Rodent sequence entries, part 20.
847. gbrod21.seq - Rodent sequence entries, part 21.
848. gbrod22.seq - Rodent sequence entries, part 22.
849. gbrod23.seq - Rodent sequence entries, part 23.
850. gbrod3.seq - Rodent sequence entries, part 3.
851. gbrod4.seq - Rodent sequence entries, part 4.
852. gbrod5.seq - Rodent sequence entries, part 5.
853. gbrod6.seq - Rodent sequence entries, part 6.
854. gbrod7.seq - Rodent sequence entries, part 7.
855. gbrod8.seq - Rodent sequence entries, part 8.
856. gbrod9.seq - Rodent sequence entries, part 9.
857. gbsdr.txt - Short directory of the data bank.
858. gbsec.idx - Index of the entries according to secondary accession number.
859. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
860. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
861. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
862. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
863. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
864. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
865. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
866. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
867. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
868. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
869. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
870. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
871. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
872. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
873. gbsyn.seq - Synthetic and chimeric sequence entries.
874. gbuna.seq - Unannotated sequence entries.
875. gbvrl1.seq - Viral sequence entries, part 1.
876. gbvrl2.seq - Viral sequence entries, part 2.
877. gbvrl3.seq - Viral sequence entries, part 3.
878. gbvrl4.seq - Viral sequence entries, part 4.
879. gbvrl5.seq - Viral sequence entries, part 5.
880. gbvrt1.seq - Other vertebrate sequence entries, part 1.
881. gbvrt10.seq - Other vertebrate sequence entries, part 10.
882. gbvrt2.seq - Other vertebrate sequence entries, part 2.
883. gbvrt3.seq - Other vertebrate sequence entries, part 3.
884. gbvrt4.seq - Other vertebrate sequence entries, part 4.
885. gbvrt5.seq - Other vertebrate sequence entries, part 5.
886. gbvrt6.seq - Other vertebrate sequence entries, part 6.
887. gbvrt7.seq - Other vertebrate sequence entries, part 7.
888. gbvrt8.seq - Other vertebrate sequence entries, part 8.
889. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 151.0 flatfiles require roughly 196 GB (sequence
files only) or 216 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1605136604     gbacc.idx
 505206170     gbaut1.idx
 510854603     gbaut10.idx
 519305882     gbaut11.idx
 506544288     gbaut12.idx
 508027764     gbaut13.idx
 506441395     gbaut14.idx
 500917233     gbaut15.idx
 500600401     gbaut16.idx
 502046558     gbaut17.idx
 500072332     gbaut18.idx
 515897070     gbaut19.idx
 504520655     gbaut2.idx
 511637988     gbaut20.idx
 506473770     gbaut21.idx
 500577146     gbaut22.idx
 504858530     gbaut23.idx
 510065474     gbaut24.idx
 505966027     gbaut25.idx
 202997760     gbaut26.idx
 511577228     gbaut3.idx
 509554287     gbaut4.idx
 503070067     gbaut5.idx
 500429208     gbaut6.idx
 515313235     gbaut7.idx
 509808213     gbaut8.idx
 502703583     gbaut9.idx
 254876785     gbbct1.seq
 253440962     gbbct10.seq
 250006174     gbbct11.seq
 250517149     gbbct12.seq
  44711004     gbbct13.seq
 250203373     gbbct2.seq
 250544545     gbbct3.seq
 250008314     gbbct4.seq
 251370493     gbbct5.seq
 250000252     gbbct6.seq
 266555988     gbbct7.seq
 250342159     gbbct8.seq
 250123161     gbbct9.seq
   7443969     gbchg.txt
 837494928     gbcon.seq
     28161     gbdel.txt
 250001701     gbenv1.seq
 250001088     gbenv2.seq
  26029670     gbenv3.seq
 230687890     gbest1.seq
 230689203     gbest10.seq
 230689269     gbest100.seq
 230690253     gbest101.seq
 230688333     gbest102.seq
 230690304     gbest103.seq
 230689203     gbest104.seq
 230687445     gbest105.seq
 230689655     gbest106.seq
 230689765     gbest107.seq
 230689442     gbest108.seq
 230689794     gbest109.seq
 230688357     gbest11.seq
 230689205     gbest110.seq
 230600484     gbest111.seq
 230690472     gbest112.seq
 230688866     gbest113.seq
 230690281     gbest114.seq
 230688160     gbest115.seq
 230687553     gbest116.seq
 230688416     gbest117.seq
 230687459     gbest118.seq
 230688629     gbest119.seq
 230688106     gbest12.seq
 230689571     gbest120.seq
 230688588     gbest121.seq
 230689977     gbest122.seq
 230687880     gbest123.seq
 230690091     gbest124.seq
 230690176     gbest125.seq
 230689184     gbest126.seq
 230689844     gbest127.seq
 230687982     gbest128.seq
 230689086     gbest129.seq
 230688579     gbest13.seq
 230691210     gbest130.seq
 230687788     gbest131.seq
 230689096     gbest132.seq
 230689050     gbest133.seq
 230690685     gbest134.seq
 230691373     gbest135.seq
 230690101     gbest136.seq
 230691337     gbest137.seq
 230688885     gbest138.seq
 230691821     gbest139.seq
 230688169     gbest14.seq
 230688910     gbest140.seq
 230688792     gbest141.seq
 230688060     gbest142.seq
 230688819     gbest143.seq
 230687465     gbest144.seq
 230687664     gbest145.seq
 230688918     gbest146.seq
 230687917     gbest147.seq
 230689285     gbest148.seq
 230687969     gbest149.seq
 230689465     gbest15.seq
 230690293     gbest150.seq
 230690530     gbest151.seq
 230689116     gbest152.seq
 230689354     gbest153.seq
 230687863     gbest154.seq
 230688598     gbest155.seq
 230693331     gbest156.seq
 230687807     gbest157.seq
 230688153     gbest158.seq
 230689379     gbest159.seq
 230689693     gbest16.seq
 230690633     gbest160.seq
 230688239     gbest161.seq
 230688878     gbest162.seq
 230688647     gbest163.seq
 230690029     gbest164.seq
 230688440     gbest165.seq
 230687726     gbest166.seq
 230688796     gbest167.seq
 230689530     gbest168.seq
 230688026     gbest169.seq
 230687454     gbest17.seq
 230689562     gbest170.seq
 221937708     gbest171.seq
 230688186     gbest172.seq
 230690058     gbest173.seq
 230688462     gbest174.seq
 230691025     gbest175.seq
 230688332     gbest176.seq
 230690925     gbest177.seq
 230690144     gbest178.seq
 230688303     gbest179.seq
 230688261     gbest18.seq
 230688028     gbest180.seq
 230687940     gbest181.seq
 230689243     gbest182.seq
 230687660     gbest183.seq
 230688387     gbest184.seq
 230688920     gbest185.seq
 230688700     gbest186.seq
 230688801     gbest187.seq
 230689546     gbest188.seq
 230689823     gbest189.seq
 230687460     gbest19.seq
 230689575     gbest190.seq
 230689066     gbest191.seq
 230690764     gbest192.seq
 230689937     gbest193.seq
 230689449     gbest194.seq
 230688431     gbest195.seq
 230688043     gbest196.seq
 230688668     gbest197.seq
 230687729     gbest198.seq
 230687450     gbest199.seq
 230689426     gbest2.seq
 230689632     gbest20.seq
 230689640     gbest200.seq
 230688197     gbest201.seq
 230688225     gbest202.seq
 230689507     gbest203.seq
 230687511     gbest204.seq
 230689591     gbest205.seq
 230689200     gbest206.seq
 230688257     gbest207.seq
 230687638     gbest208.seq
 230688530     gbest209.seq
 230688262     gbest21.seq
 230688639     gbest210.seq
 230689675     gbest211.seq
 230688100     gbest212.seq
 230689379     gbest213.seq
 230689273     gbest214.seq
 230690882     gbest215.seq
 230690739     gbest216.seq
 230690497     gbest217.seq
 230688350     gbest218.seq
 230689320     gbest219.seq
 230688270     gbest22.seq
 220198703     gbest220.seq
 163043492     gbest221.seq
 162245390     gbest222.seq
 169249175     gbest223.seq
 168194682     gbest224.seq
 167346629     gbest225.seq
 165490543     gbest226.seq
 164894567     gbest227.seq
 164476033     gbest228.seq
 164385856     gbest229.seq
 230688836     gbest23.seq
 164278219     gbest230.seq
 164382993     gbest231.seq
 163424640     gbest232.seq
 167026489     gbest233.seq
 164399880     gbest234.seq
 161959683     gbest235.seq
 165171689     gbest236.seq
 168559738     gbest237.seq
 166700333     gbest238.seq
 165643145     gbest239.seq
 230689093     gbest24.seq
 165861237     gbest240.seq
 165116590     gbest241.seq
 164727403     gbest242.seq
 164238557     gbest243.seq
 164591338     gbest244.seq
 165127193     gbest245.seq
 173854720     gbest246.seq
 176757587     gbest247.seq
 173791063     gbest248.seq
 230689705     gbest249.seq
 230687797     gbest25.seq
 230687690     gbest250.seq
 230690660     gbest251.seq
 230689615     gbest252.seq
 230690722     gbest253.seq
 230689410     gbest254.seq
 230688397     gbest255.seq
 230690258     gbest256.seq
 230691717     gbest257.seq
 230688399     gbest258.seq
 230689146     gbest259.seq
 230690376     gbest26.seq
 230689084     gbest260.seq
 230688182     gbest261.seq
 230687657     gbest262.seq
 230691038     gbest263.seq
 230688412     gbest264.seq
 230690943     gbest265.seq
 230689316     gbest266.seq
 230691997     gbest267.seq
 230688911     gbest268.seq
 230689773     gbest269.seq
 230687870     gbest27.seq
 230688518     gbest270.seq
 230690337     gbest271.seq
 230688143     gbest272.seq
 230688022     gbest273.seq
 230689761     gbest274.seq
 230688121     gbest275.seq
 230687513     gbest276.seq
 230687752     gbest277.seq
 214374548     gbest278.seq
 230690348     gbest279.seq
 230688111     gbest28.seq
 230688052     gbest280.seq
 230687563     gbest281.seq
 230689282     gbest282.seq
 230688823     gbest283.seq
 230690079     gbest284.seq
 230687605     gbest285.seq
 230690467     gbest286.seq
 230688415     gbest287.seq
 230688608     gbest288.seq
 230688484     gbest289.seq
 230688543     gbest29.seq
 230687511     gbest290.seq
 230689410     gbest291.seq
 230688330     gbest292.seq
 230689774     gbest293.seq
 230688996     gbest294.seq
 230687531     gbest295.seq
 230691017     gbest296.seq
 230690009     gbest297.seq
 230687950     gbest298.seq
 230688847     gbest299.seq
 230690270     gbest3.seq
 230688302     gbest30.seq
 230688861     gbest300.seq
 230690705     gbest301.seq
 230689053     gbest302.seq
 230687899     gbest303.seq
 230688702     gbest304.seq
 230689804     gbest305.seq
 230688053     gbest306.seq
 230687831     gbest307.seq
 230690767     gbest308.seq
 230688875     gbest309.seq
 230690632     gbest31.seq
 220669967     gbest310.seq
 225083517     gbest311.seq
 230688857     gbest312.seq
 230687815     gbest313.seq
 230690212     gbest314.seq
 230689508     gbest315.seq
 230689582     gbest316.seq
 166781084     gbest317.seq
 160185954     gbest318.seq
 230689494     gbest319.seq
 230690297     gbest32.seq
 230687794     gbest320.seq
 230693150     gbest321.seq
 230688510     gbest322.seq
 230688820     gbest323.seq
 230690355     gbest324.seq
 230689868     gbest325.seq
 230688693     gbest326.seq
 230687625     gbest327.seq
 230689152     gbest328.seq
 230688777     gbest329.seq
 230690266     gbest33.seq
 230689776     gbest330.seq
 230690078     gbest331.seq
 230688385     gbest332.seq
 230688762     gbest333.seq
 230691373     gbest334.seq
 230690697     gbest335.seq
 230688588     gbest336.seq
 230688956     gbest337.seq
 230688810     gbest338.seq
 230689206     gbest339.seq
 230689982     gbest34.seq
 230690639     gbest340.seq
 230690621     gbest341.seq
 230689123     gbest342.seq
 230687991     gbest343.seq
 230691855     gbest344.seq
 230689583     gbest345.seq
 230688381     gbest346.seq
 230689703     gbest347.seq
 230689851     gbest348.seq
 230689630     gbest349.seq
 230688633     gbest35.seq
 230689793     gbest350.seq
 230692945     gbest351.seq
 230689276     gbest352.seq
 230687663     gbest353.seq
 230687534     gbest354.seq
 230687810     gbest355.seq
 230690214     gbest356.seq
 230688402     gbest357.seq
 230689462     gbest358.seq
 230689831     gbest359.seq
 230687796     gbest36.seq
 230689612     gbest360.seq
 222358846     gbest361.seq
 230689707     gbest362.seq
 230690318     gbest363.seq
 230690316     gbest364.seq
 230690353     gbest365.seq
 230688766     gbest366.seq
 230689336     gbest367.seq
 222113867     gbest368.seq
 230688496     gbest369.seq
 230688139     gbest37.seq
 230688160     gbest370.seq
 230689342     gbest371.seq
 230687991     gbest372.seq
 230690911     gbest373.seq
 230688853     gbest374.seq
 230687626     gbest375.seq
 230688054     gbest376.seq
 230688973     gbest377.seq
 230687525     gbest378.seq
 230689797     gbest379.seq
 230687710     gbest38.seq
 230688482     gbest380.seq
 230690368     gbest381.seq
 230690673     gbest382.seq
 230687884     gbest383.seq
 230687655     gbest384.seq
 225925804     gbest385.seq
 211948608     gbest386.seq
 211615055     gbest387.seq
 211860840     gbest388.seq
 211720773     gbest389.seq
 230688466     gbest39.seq
 211972615     gbest390.seq
 211985645     gbest391.seq
 213598158     gbest392.seq
 213017631     gbest393.seq
 212562827     gbest394.seq
 215672571     gbest395.seq
 213201694     gbest396.seq
 212161956     gbest397.seq
 212189263     gbest398.seq
 212332460     gbest399.seq
 230690637     gbest4.seq
 204449183     gbest40.seq
 211728727     gbest400.seq
 211804507     gbest401.seq
 222022875     gbest402.seq
 230688848     gbest403.seq
 230690030     gbest404.seq
 230689799     gbest405.seq
 230689308     gbest406.seq
 230688582     gbest407.seq
 230687541     gbest408.seq
 230690458     gbest409.seq
 192034105     gbest41.seq
 230689103     gbest410.seq
 230690052     gbest411.seq
 230689560     gbest412.seq
 230689715     gbest413.seq
 230689929     gbest414.seq
 230689553     gbest415.seq
 230688782     gbest416.seq
 230691192     gbest417.seq
 225395160     gbest418.seq
 230689435     gbest419.seq
 200044510     gbest42.seq
 230688407     gbest420.seq
 230687904     gbest421.seq
 230688430     gbest422.seq
 230688329     gbest423.seq
 230689089     gbest424.seq
 230688839     gbest425.seq
 230690461     gbest426.seq
 230689666     gbest427.seq
 230688967     gbest428.seq
 230688306     gbest429.seq
 214974184     gbest43.seq
 230689307     gbest430.seq
 230689722     gbest431.seq
 230689819     gbest432.seq
 230690853     gbest433.seq
 230687501     gbest434.seq
 230691336     gbest435.seq
 230690222     gbest436.seq
 230691073     gbest437.seq
 230690449     gbest438.seq
 230689103     gbest439.seq
 216232330     gbest44.seq
 230687972     gbest440.seq
 230687867     gbest441.seq
 230689875     gbest442.seq
 230691379     gbest443.seq
 230690573     gbest444.seq
 230689090     gbest445.seq
 230687447     gbest446.seq
 230687894     gbest447.seq
 230688716     gbest448.seq
 230689993     gbest449.seq
 216248122     gbest45.seq
 230689550     gbest450.seq
 230690197     gbest451.seq
 230689311     gbest452.seq
 230687753     gbest453.seq
 230690307     gbest454.seq
 224617856     gbest455.seq
 228804614     gbest456.seq
 230688606     gbest457.seq
 230688195     gbest458.seq
 230689924     gbest459.seq
 216663421     gbest46.seq
 230687624     gbest460.seq
 230687536     gbest461.seq
 220205631     gbest462.seq
 230688087     gbest463.seq
 213404887     gbest464.seq
 230688689     gbest47.seq
 230689730     gbest48.seq
 223475887     gbest49.seq
 164063504     gbest5.seq
 230687975     gbest50.seq
 230690032     gbest51.seq
 230690201     gbest52.seq
 230689572     gbest53.seq
 230690914     gbest54.seq
 230687524     gbest55.seq
 230689686     gbest56.seq
 230689999     gbest57.seq
 230688944     gbest58.seq
 230689839     gbest59.seq
 178539313     gbest6.seq
 230687944     gbest60.seq
 230688843     gbest61.seq
 230688669     gbest62.seq
 230687955     gbest63.seq
 230688415     gbest64.seq
 230688767     gbest65.seq
 209676303     gbest66.seq
 209195309     gbest67.seq
 208803319     gbest68.seq
 209093427     gbest69.seq
 230688112     gbest7.seq
 210352828     gbest70.seq
 209752424     gbest71.seq
 208552019     gbest72.seq
 209469022     gbest73.seq
 210522632     gbest74.seq
 206250363     gbest75.seq
 206851300     gbest76.seq
 208134647     gbest77.seq
 208505425     gbest78.seq
 215975491     gbest79.seq
 230687894     gbest8.seq
 230692360     gbest80.seq
 230688587     gbest81.seq
 230689887     gbest82.seq
 215214582     gbest83.seq
 214828627     gbest84.seq
 218083541     gbest85.seq
 230691152     gbest86.seq
 230688014     gbest87.seq
 230688103     gbest88.seq
 230688974     gbest89.seq
 230689448     gbest9.seq
 230689843     gbest90.seq
 230689697     gbest91.seq
 230687546     gbest92.seq
 230689573     gbest93.seq
 230687620     gbest94.seq
 230690203     gbest95.seq
 230689029     gbest96.seq
 230688747     gbest97.seq
 230689794     gbest98.seq
 230690213     gbest99.seq
  50716047     gbgen.idx
 230688405     gbgss1.seq
 230689196     gbgss10.seq
 227335406     gbgss100.seq
 228266855     gbgss101.seq
 228745231     gbgss102.seq
 228629796     gbgss103.seq
 227929435     gbgss104.seq
 227460004     gbgss105.seq
 230689107     gbgss106.seq
 230687585     gbgss107.seq
 230688878     gbgss108.seq
 230687676     gbgss109.seq
 230690514     gbgss11.seq
 230689199     gbgss110.seq
 230688583     gbgss111.seq
 230688212     gbgss112.seq
 230688444     gbgss113.seq
 230690487     gbgss114.seq
 230688651     gbgss115.seq
 230687977     gbgss116.seq
 230691596     gbgss117.seq
 230689691     gbgss118.seq
 230688060     gbgss119.seq
 230689137     gbgss12.seq
 230687519     gbgss120.seq
 230688214     gbgss121.seq
 230689058     gbgss122.seq
 230687754     gbgss123.seq
 230687888     gbgss124.seq
 230688991     gbgss125.seq
 230690145     gbgss126.seq
 230689381     gbgss127.seq
 230688293     gbgss128.seq
 230688957     gbgss129.seq
 230570202     gbgss13.seq
 230689496     gbgss130.seq
 230687903     gbgss131.seq
 103550149     gbgss132.seq
 250000499     gbgss133.seq
 250002682     gbgss134.seq
 250001784     gbgss135.seq
 250001696     gbgss136.seq
 250002421     gbgss137.seq
 250002602     gbgss138.seq
 250001620     gbgss139.seq
 230689027     gbgss14.seq
 250002661     gbgss140.seq
 250002251     gbgss141.seq
 250000353     gbgss142.seq
 250001393     gbgss143.seq
 250001149     gbgss144.seq
 250001632     gbgss145.seq
 250000686     gbgss146.seq
 250001156     gbgss147.seq
 250001363     gbgss148.seq
 250001916     gbgss149.seq
 230688679     gbgss15.seq
 250001317     gbgss150.seq
 250000675     gbgss151.seq
 250001038     gbgss152.seq
 250001201     gbgss153.seq
 250000799     gbgss154.seq
 250000881     gbgss155.seq
 250000022     gbgss156.seq
 250002406     gbgss157.seq
 250001695     gbgss158.seq
 250002082     gbgss159.seq
 230689266     gbgss16.seq
 250000999     gbgss160.seq
 250000164     gbgss161.seq
 250001715     gbgss162.seq
 250000274     gbgss163.seq
  80209741     gbgss164.seq
 230687595     gbgss17.seq
 230690627     gbgss18.seq
 230687933     gbgss19.seq
 230688758     gbgss2.seq
 230687645     gbgss20.seq
 230688129     gbgss21.seq
 230688525     gbgss22.seq
 230690250     gbgss23.seq
 230687922     gbgss24.seq
 230688166     gbgss25.seq
 230690235     gbgss26.seq
 230690056     gbgss27.seq
 230688184     gbgss28.seq
 230687468     gbgss29.seq
 230689208     gbgss3.seq
 230688387     gbgss30.seq
 230689822     gbgss31.seq
 230690365     gbgss32.seq
 230690283     gbgss33.seq
 230689732     gbgss34.seq
 230688787     gbgss35.seq
 230688200     gbgss36.seq
 230687829     gbgss37.seq
 230687631     gbgss38.seq
 230689789     gbgss39.seq
 230688227     gbgss4.seq
 230689244     gbgss40.seq
 230689924     gbgss41.seq
 230688535     gbgss42.seq
 230688054     gbgss43.seq
 230690772     gbgss44.seq
 230689116     gbgss45.seq
 230690357     gbgss46.seq
 230688683     gbgss47.seq
 230688632     gbgss48.seq
 230689362     gbgss49.seq
 230687514     gbgss5.seq
 230688842     gbgss50.seq
 230688052     gbgss51.seq
 230689858     gbgss52.seq
 230689130     gbgss53.seq
 230687639     gbgss54.seq
 230689843     gbgss55.seq
 230689411     gbgss56.seq
 230689307     gbgss57.seq
 230689492     gbgss58.seq
 230687466     gbgss59.seq
 230690316     gbgss6.seq
 230687881     gbgss60.seq
 229354423     gbgss61.seq
 230689693     gbgss62.seq
 230689372     gbgss63.seq
 230688983     gbgss64.seq
 230689536     gbgss65.seq
 230689591     gbgss66.seq
 230688340     gbgss67.seq
 230689162     gbgss68.seq
 230688947     gbgss69.seq
 230691359     gbgss7.seq
 230689554     gbgss70.seq
 230689370     gbgss71.seq
 230688797     gbgss72.seq
 230687950     gbgss73.seq
 230689534     gbgss74.seq
 230687557     gbgss75.seq
 230689881     gbgss76.seq
 230689598     gbgss77.seq
 230687781     gbgss78.seq
 230689200     gbgss79.seq
 230688790     gbgss8.seq
 230689003     gbgss80.seq
 199279494     gbgss81.seq
 194742536     gbgss82.seq
 219954193     gbgss83.seq
 230688991     gbgss84.seq
 230690205     gbgss85.seq
 230688904     gbgss86.seq
 230689337     gbgss87.seq
 230688253     gbgss88.seq
 230687483     gbgss89.seq
 230688957     gbgss9.seq
 230689897     gbgss90.seq
 230690158     gbgss91.seq
 230688193     gbgss92.seq
 230688751     gbgss93.seq
 230688595     gbgss94.seq
 230688510     gbgss95.seq
 230687476     gbgss96.seq
 230687619     gbgss97.seq
 230689029     gbgss98.seq
 230689480     gbgss99.seq
 250002194     gbhtc1.seq
  60466769     gbhtc10.seq
 250003823     gbhtc2.seq
 250014377     gbhtc3.seq
 250007673     gbhtc4.seq
 250001305     gbhtc5.seq
 250002347     gbhtc6.seq
 250001291     gbhtc7.seq
 250003059     gbhtc8.seq
 250002500     gbhtc9.seq
 250063915     gbhtg1.seq
 250148884     gbhtg10.seq
 250075771     gbhtg11.seq
 250133576     gbhtg12.seq
 250462116     gbhtg13.seq
 250023369     gbhtg14.seq
 250223295     gbhtg15.seq
 250377741     gbhtg16.seq
 250503909     gbhtg17.seq
 250137427     gbhtg18.seq
 250066765     gbhtg19.seq
 250132476     gbhtg2.seq
 250264406     gbhtg20.seq
 250237613     gbhtg21.seq
 250281911     gbhtg22.seq
 250124630     gbhtg23.seq
 250026503     gbhtg24.seq
 250230814     gbhtg25.seq
 250217977     gbhtg26.seq
 250279040     gbhtg27.seq
 250204235     gbhtg28.seq
 250198752     gbhtg29.seq
 250131815     gbhtg3.seq
 250154689     gbhtg30.seq
 250321747     gbhtg31.seq
 250145306     gbhtg32.seq
 250123624     gbhtg33.seq
 250159801     gbhtg34.seq
 250271981     gbhtg35.seq
 250213998     gbhtg36.seq
 250215327     gbhtg37.seq
 250346681     gbhtg38.seq
 250147876     gbhtg39.seq
 250101071     gbhtg4.seq
 250242868     gbhtg40.seq
 250001782     gbhtg41.seq
 250147445     gbhtg42.seq
 250236285     gbhtg43.seq
 250043036     gbhtg44.seq
 250109030     gbhtg45.seq
 250055773     gbhtg46.seq
 250170310     gbhtg47.seq
 250267364     gbhtg48.seq
 250214823     gbhtg49.seq
 250181202     gbhtg5.seq
 250158074     gbhtg50.seq
 250102784     gbhtg51.seq
 250054162     gbhtg52.seq
 250102048     gbhtg53.seq
 250131438     gbhtg54.seq
 250267424     gbhtg55.seq
 250099546     gbhtg56.seq
 250186376     gbhtg57.seq
 250175238     gbhtg58.seq
 250083789     gbhtg59.seq
 250203910     gbhtg6.seq
 250013612     gbhtg60.seq
 250242158     gbhtg61.seq
 250369380     gbhtg62.seq
 250033213     gbhtg63.seq
 250312437     gbhtg64.seq
 250030216     gbhtg65.seq
 250008084     gbhtg66.seq
 250869173     gbhtg67.seq
 250217424     gbhtg68.seq
 152999622     gbhtg69.seq
 250012437     gbhtg7.seq
 250174040     gbhtg8.seq
 250101068     gbhtg9.seq
 250114621     gbinv1.seq
 250076862     gbinv2.seq
 250003308     gbinv3.seq
 250000314     gbinv4.seq
 250012493     gbinv5.seq
 250005905     gbinv6.seq
 250400869     gbinv7.seq
  97731994     gbinv8.seq
1334027974     gbjou.idx
 250001755     gbmam1.seq
 142765097     gbmam2.seq
  45552701     gbnew.txt
 250000409     gbpat1.seq
 250000859     gbpat10.seq
 250001835     gbpat11.seq
 250001030     gbpat12.seq
 250000338     gbpat13.seq
 250000038     gbpat14.seq
 250000941     gbpat15.seq
 250000755     gbpat16.seq
 250243023     gbpat17.seq
 250001185     gbpat18.seq
  94302750     gbpat19.seq
 250002254     gbpat2.seq
 250000558     gbpat3.seq
 250000141     gbpat4.seq
 250004690     gbpat5.seq
 250001033     gbpat6.seq
 250000468     gbpat7.seq
 250002725     gbpat8.seq
 250000901     gbpat9.seq
  44614623     gbphg.seq
 250036891     gbpln1.seq
 250001063     gbpln10.seq
 250002688     gbpln11.seq
 250002704     gbpln12.seq
 250000359     gbpln13.seq
 250027891     gbpln14.seq
 250026925     gbpln15.seq
 250002452     gbpln16.seq
  35131217     gbpln17.seq
 250138910     gbpln2.seq
 250006183     gbpln3.seq
 250002923     gbpln4.seq
 250003445     gbpln5.seq
 250001556     gbpln6.seq
 250137854     gbpln7.seq
 296942363     gbpln8.seq
 250570232     gbpln9.seq
 250109519     gbpri1.seq
 250003261     gbpri10.seq
 250093919     gbpri11.seq
 250196454     gbpri12.seq
 250019982     gbpri13.seq
 250121968     gbpri14.seq
 250002060     gbpri15.seq
 250001652     gbpri16.seq
 250086176     gbpri17.seq
 250043536     gbpri18.seq
 250073662     gbpri19.seq
 250049731     gbpri2.seq
 250072596     gbpri20.seq
 250083550     gbpri21.seq
 250001778     gbpri22.seq
 250004647     gbpri23.seq
 250116829     gbpri24.seq
 250059899     gbpri25.seq
 250000195     gbpri26.seq
 250096472     gbpri27.seq
 250067091     gbpri28.seq
 114200869     gbpri29.seq
 250045508     gbpri3.seq
 250004209     gbpri4.seq
 250189507     gbpri5.seq
 250157484     gbpri6.seq
 250100961     gbpri7.seq
 250132149     gbpri8.seq
 250018531     gbpri9.seq
    207108     gbrel.txt
 250189629     gbrod1.seq
 250030487     gbrod10.seq
 250012120     gbrod11.seq
 250172707     gbrod12.seq
 250278170     gbrod13.seq
 250239961     gbrod14.seq
 250143753     gbrod15.seq
 250001322     gbrod16.seq
 250134246     gbrod17.seq
 250035755     gbrod18.seq
 250084927     gbrod19.seq
 250229320     gbrod2.seq
 250003433     gbrod20.seq
 250167160     gbrod21.seq
 250000564     gbrod22.seq
  99945165     gbrod23.seq
 250152112     gbrod3.seq
 250219253     gbrod4.seq
 250159809     gbrod5.seq
 250048340     gbrod6.seq
 250152007     gbrod7.seq
 250015912     gbrod8.seq
 250145507     gbrod9.seq
4161396768     gbsdr.txt
   1565356     gbsec.idx
 250001655     gbsts1.seq
 250001489     gbsts10.seq
 250002724     gbsts11.seq
 250001345     gbsts12.seq
 250000881     gbsts13.seq
  27424122     gbsts14.seq
 250000995     gbsts2.seq
 250000633     gbsts3.seq
 250004419     gbsts4.seq
 250000963     gbsts5.seq
 250004581     gbsts6.seq
 250001855     gbsts7.seq
 250001611     gbsts8.seq
 250000223     gbsts9.seq
 103809857     gbsyn.seq
    407383     gbuna.seq
 250001080     gbvrl1.seq
 250002759     gbvrl2.seq
 250001723     gbvrl3.seq
 250001788     gbvrl4.seq
 136379518     gbvrl5.seq
 250003090     gbvrt1.seq
  98412680     gbvrt10.seq
 250048832     gbvrt2.seq
 250000776     gbvrt3.seq
 250001820     gbvrt4.seq
 250110351     gbvrt5.seq
 250178633     gbvrt6.seq
 250089837     gbvrt7.seq
 250017567     gbvrt8.seq
 250002127     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         25679      103291878
BCT10        50         113503858
BCT11        16933      101967672
BCT12        37591      90244334
BCT13        4830       17381756
BCT2         7477       107448276
BCT3         296        114226177
BCT4         27804      103087836
BCT5         31796      95734476
BCT6         48031      92949745
BCT7         20225      114423516
BCT8         6512       94114098
BCT9         2218       107567408
ENV1         96100      71329258
ENV2         93608      78940654
ENV3         10271      7181748
EST1         68272      26345057
EST10        76608      29877691
EST100       73482      36739019
EST101       72333      45486886
EST102       72370      45784991
EST103       70215      43318501
EST104       73104      33244405
EST105       69753      29572505
EST106       67546      38050114
EST107       68388      36450709
EST108       68581      41938268
EST109       72852      36488048
EST11        75489      28839244
EST110       75340      34709200
EST111       74883      27324314
EST112       73921      35662615
EST113       74681      34871226
EST114       64725      37593349
EST115       80911      44685897
EST116       77939      43924188
EST117       68592      47110350
EST118       67858      40680304
EST119       74695      50663189
EST12        77657      30904890
EST120       69406      41800452
EST121       75509      45002368
EST122       73889      46050242
EST123       71838      49345202
EST124       72771      48261256
EST125       78867      43107435
EST126       76163      31080052
EST127       79122      36835388
EST128       78141      44668650
EST129       75954      45666574
EST13        77681      29353177
EST130       62802      30938498
EST131       71389      37870457
EST132       68956      39589906
EST133       65658      36476674
EST134       72120      42549179
EST135       72202      45732031
EST136       68498      39813897
EST137       72362      39344519
EST138       70463      43848606
EST139       65670      39908212
EST14        79367      32313201
EST140       70093      39251368
EST141       99506      54024292
EST142       73218      41637498
EST143       96980      50730410
EST144       109611     57987759
EST145       102336     56432127
EST146       88872      52080454
EST147       84262      48643900
EST148       95008      56782099
EST149       98547      60013054
EST15        74083      31332890
EST150       81869      45575855
EST151       69570      39905328
EST152       66126      31227997
EST153       61938      28234545
EST154       56701      27164279
EST155       63208      31228508
EST156       54681      27527557
EST157       79244      52278698
EST158       68393      38132570
EST159       72301      52456970
EST16        75674      33292874
EST160       72841      41514758
EST161       60755      30534464
EST162       64537      38158451
EST163       66462      33102931
EST164       63482      45941176
EST165       64408      37031988
EST166       102154     45057000
EST167       87371      51851216
EST168       102211     59219620
EST169       105247     58428962
EST17        83306      34219503
EST170       90064      48175451
EST171       90334      36927329
EST172       94852      49348432
EST173       89790      38887811
EST174       94266      41027574
EST175       73752      37641853
EST176       67904      45029742
EST177       65992      37850639
EST178       64837      42557754
EST179       68196      31243160
EST18        80517      32335336
EST180       76240      31167578
EST181       70220      44436585
EST182       82867      41270951
EST183       61617      31975647
EST184       68677      48202924
EST185       70297      46346140
EST186       67767      36797984
EST187       67425      44752447
EST188       70611      54570792
EST189       69416      33344494
EST19        79349      32658101
EST190       72269      40666848
EST191       69959      59612763
EST192       66709      50282796
EST193       64627      46993548
EST194       64130      47553918
EST195       66054      46139862
EST196       65724      47456965
EST197       64139      47327645
EST198       62052      37605503
EST199       64201      34079405
EST2         74829      28715325
EST20        74072      29916822
EST200       63214      36961696
EST201       84928      47799297
EST202       83993      54824860
EST203       73005      43000583
EST204       106333     66540228
EST205       108539     65400670
EST206       108944     64430350
EST207       103347     66865519
EST208       107292     58859349
EST209       102893     54330222
EST21        73753      34240766
EST210       93969      50632733
EST211       97650      45116316
EST212       81876      49957188
EST213       68186      36850610
EST214       69862      53225673
EST215       68450      59133410
EST216       76299      47097281
EST217       81954      41054359
EST218       76219      52145035
EST219       71494      50820418
EST22        75977      30474854
EST220       59550      34494414
EST221       27785      10501180
EST222       27846      10384667
EST223       26671      9825929
EST224       26883      9373299
EST225       27070      9264570
EST226       27185      10213193
EST227       27180      9697030
EST228       27237      10166020
EST229       27198      11657579
EST23        77634      32429367
EST230       27196      11382221
EST231       27251      10491047
EST232       27542      9514867
EST233       27005      8993118
EST234       27518      11142541
EST235       27899      10759069
EST236       27399      11083113
EST237       26635      11766191
EST238       26890      11692977
EST239       27104      10663216
EST24        76038      34156616
EST240       26962      11482799
EST241       27115      11714749
EST242       27240      11281497
EST243       27270      10781508
EST244       27227      10756065
EST245       27181      10575387
EST246       25617      15803108
EST247       25098      16574968
EST248       30166      18313330
EST249       102617     35675031
EST25        72331      30679012
EST250       80804      41237475
EST251       68821      44378018
EST252       69202      44914042
EST253       69104      44290349
EST254       64525      40213065
EST255       80505      44459494
EST256       62059      42915329
EST257       68883      42865448
EST258       60979      30687187
EST259       102130     47834596
EST26        76029      31571940
EST260       84522      44043906
EST261       72316      38833755
EST262       64270      31049427
EST263       68112      40627938
EST264       71961      34940383
EST265       71398      33631566
EST266       74598      45952844
EST267       65028      36287078
EST268       67681      39389652
EST269       76422      37441693
EST27        76811      33254044
EST270       82388      45539203
EST271       74062      49212768
EST272       77817      53418244
EST273       100101     49815164
EST274       94243      45235524
EST275       77149      43656991
EST276       70290      46372559
EST277       75691      33431810
EST278       70176      31133244
EST279       72248      37119514
EST28        109249     52808593
EST280       64442      38110879
EST281       59642      38233217
EST282       73805      43573740
EST283       62652      42978759
EST284       61861      34212341
EST285       84183      44064753
EST286       83653      40884601
EST287       71781      46254332
EST288       103705     58458464
EST289       121218     47899356
EST29        97886      46436595
EST290       84036      38752907
EST291       65591      35518288
EST292       71717      45567248
EST293       80916      41107814
EST294       70921      42100892
EST295       70535      40855204
EST296       63716      35603238
EST297       61433      37276636
EST298       53194      30002297
EST299       71817      52022171
EST3         73902      29987952
EST30        94496      53110970
EST300       74468      44277659
EST301       71179      41694228
EST302       68623      36221789
EST303       76543      46978680
EST304       76422      34320079
EST305       74643      32477226
EST306       77397      33127039
EST307       81311      38479909
EST308       87955      60769425
EST309       74336      54600673
EST31        78219      40902226
EST310       75372      44702548
EST311       77625      41908706
EST312       65924      54837173
EST313       63669      47907487
EST314       64828      43728229
EST315       59067      31236353
EST316       75180      52310449
EST317       52673      30450090
EST318       53067      26210890
EST319       68261      37355699
EST32        67884      57845231
EST320       62809      33701556
EST321       64049      32250862
EST322       62923      40171408
EST323       85645      43637927
EST324       70669      42208545
EST325       68381      44109732
EST326       67587      37753007
EST327       65254      42767628
EST328       87752      50093408
EST329       84872      50429293
EST33        77656      51013803
EST330       78047      42438661
EST331       63167      37214850
EST332       65043      33507883
EST333       73609      40654843
EST334       47159      24158922
EST335       67389      38239605
EST336       71180      42805380
EST337       98795      46111726
EST338       74216      47934671
EST339       74581      48903491
EST34        91671      47084784
EST340       70344      45175414
EST341       63828      34704127
EST342       85074      37468733
EST343       71583      40210787
EST344       52779      37351855
EST345       62887      37901871
EST346       63619      41827219
EST347       100942     55425180
EST348       73990      40505293
EST349       77518      47919673
EST35        85567      44729458
EST350       67528      35149106
EST351       43630      26862325
EST352       50080      27557143
EST353       82020      53270524
EST354       82183      42982145
EST355       76051      44783991
EST356       70623      39568607
EST357       64185      40075895
EST358       69069      40403659
EST359       65141      38217465
EST36        90835      54876020
EST360       66880      33198786
EST361       79986      25691355
EST362       75184      40440938
EST363       67677      40005367
EST364       65307      32745150
EST365       75765      47035504
EST366       73144      49012551
EST367       66931      42276721
EST368       75209      45509508
EST369       59267      32990400
EST37        99136      45991857
EST370       67047      42403328
EST371       80077      50673874
EST372       85760      49452176
EST373       66020      40366226
EST374       58848      41207843
EST375       57177      40642470
EST376       57048      40782079
EST377       71446      43367101
EST378       62349      37093324
EST379       58870      37583797
EST38        95884      49686960
EST380       61930      39916206
EST381       57771      41071686
EST382       60601      41546076
EST383       57138      41490004
EST384       48033      32845670
EST385       93241      40390670
EST386       71326      39485972
EST387       71552      39066612
EST388       71348      39815783
EST389       71422      39214677
EST39        105432     47510694
EST390       71173      39898625
EST391       71040      39374155
EST392       70641      39383307
EST393       70520      39889458
EST394       70694      39558437
EST395       68729      38941821
EST396       70835      38767634
EST397       71140      40215911
EST398       71154      39499972
EST399       71107      38719747
EST4         74688      28363417
EST40        75239      25871701
EST400       71524      39319068
EST401       71349      39513048
EST402       70919      39498366
EST403       52272      40369343
EST404       59772      45123873
EST405       74067      40853349
EST406       53558      32413182
EST407       114601     58016270
EST408       83481      51559713
EST409       84733      56465818
EST41        68773      18332736
EST410       51287      32934534
EST411       49307      42168179
EST412       46667      58995840
EST413       68563      55845208
EST414       62506      37996048
EST415       71174      43755570
EST416       66577      41617694
EST417       69927      43291038
EST418       60513      52598374
EST419       64506      40943173
EST42        77634      22144086
EST420       55264      37814260
EST421       57526      41113383
EST422       59095      39150255
EST423       65929      51328037
EST424       63660      45503205
EST425       58398      40360832
EST426       51631      38562751
EST427       57639      39384336
EST428       57350      39933576
EST429       67472      37809256
EST43        46664      13354812
EST430       63444      43625432
EST431       57010      38290053
EST432       59137      42962355
EST433       58432      45675847
EST434       64477      45420997
EST435       50362      39860457
EST436       58822      41343864
EST437       52256      35467507
EST438       57958      40217173
EST439       57610      38453262
EST44        43620      11830225
EST440       73005      44824861
EST441       69908      59338715
EST442       69387      49683292
EST443       73198      51827851
EST444       46284      58267226
EST445       56904      49736015
EST446       66152      45641558
EST447       65191      40793210
EST448       77392      46273934
EST449       82501      53664845
EST45        43252      12134418
EST450       83666      51177449
EST451       63713      42185573
EST452       65853      43861200
EST453       81315      53459399
EST454       78982      61610883
EST455       70657      47248524
EST456       72729      51779328
EST457       68702      36432070
EST458       71644      25690088
EST459       72437      27062516
EST46        43232      11278737
EST460       73702      26232950
EST461       72341      26199933
EST462       77566      26117895
EST463       71633      29018293
EST464       69477      26136550
EST47        92858      40566912
EST48        95002      43811492
EST49        91747      47463127
EST5         48411      15354346
EST50        84561      39177009
EST51        107248     56805843
EST52        93924      45345491
EST53        75471      31964465
EST54        68796      30469295
EST55        71134      30902179
EST56        72224      30175231
EST57        83011      33618036
EST58        74386      28851109
EST59        64024      27774534
EST6         55463      17768277
EST60        71162      30950175
EST61        76724      36370113
EST62        72978      31853863
EST63        75506      27401994
EST64        79233      30255428
EST65        74223      32878516
EST66        40510      11549921
EST67        40346      11346822
EST68        40519      12712691
EST69        40763      12330501
EST7         74724      29408352
EST70        40868      12591207
EST71        40683      12964287
EST72        40619      12533326
EST73        40364      12160216
EST74        40258      12333268
EST75        41210      12227654
EST76        41162      12418277
EST77        41082      13059918
EST78        40930      12954248
EST79        43558      12403916
EST8         76223      30692191
EST80        46011      21970531
EST81        42296      24596775
EST82        43050      17848913
EST83        50224      22788732
EST84        50923      21064817
EST85        51014      22041756
EST86        82098      45858705
EST87        72743      27434329
EST88        74607      29391993
EST89        74819      40754179
EST9         77666      29936459
EST90        77835      40901436
EST91        77074      44135310
EST92        75245      35029578
EST93        75424      43078568
EST94        71020      36516655
EST95        74712      36763311
EST96        73209      40753593
EST97        74572      39354268
EST98        70727      39887423
EST99        68798      36921061
GSS1         90815      38834663
GSS10        75203      43827189
GSS100       75097      41360065
GSS101       74011      44077617
GSS102       73453      45482645
GSS103       73586      45146820
GSS104       73280      44990547
GSS105       73569      44051965
GSS106       78689      51613017
GSS107       85847      58043070
GSS108       81608      54440761
GSS109       82722      51681022
GSS11        70001      35690271
GSS110       87320      51684566
GSS111       79132      64666251
GSS112       84415      47755395
GSS113       94317      53662068
GSS114       78234      49174549
GSS115       83454      57173140
GSS116       85858      67688438
GSS117       74471      37418347
GSS118       81518      57287844
GSS119       93922      51631799
GSS12        73486      38640542
GSS120       86157      54738297
GSS121       85348      54173763
GSS122       84882      52968696
GSS123       76753      69554863
GSS124       76615      68364264
GSS125       79737      58748423
GSS126       78431      54495301
GSS127       78811      54475498
GSS128       79495      53457800
GSS129       78353      55223456
GSS13        76788      38737192
GSS130       80636      55110382
GSS131       85135      58507941
GSS132       41546      24211501
GSS133       87159      64705276
GSS134       83935      63021989
GSS135       101264     46857353
GSS136       68820      58611305
GSS137       68297      58744118
GSS138       69349      56613345
GSS139       69622      56082101
GSS14        71339      32038748
GSS140       70275      55423182
GSS141       85756      73227682
GSS142       85363      40231217
GSS143       71321      48764564
GSS144       109544     71260820
GSS145       85329      35937976
GSS146       91089      68083070
GSS147       73401      61030292
GSS148       70211      59202630
GSS149       66279      63207327
GSS15        70629      35225433
GSS150       74013      55848041
GSS151       120676     73154340
GSS152       118206     75695230
GSS153       104450     58972150
GSS154       88387      56126399
GSS155       93591      57404650
GSS156       106004     76932364
GSS157       108240     77633934
GSS158       106364     79712143
GSS159       105408     80736341
GSS16        77875      45870001
GSS160       91682      53766271
GSS161       90309      49809426
GSS162       79774      60053697
GSS163       106403     52903831
GSS164       31056      13805942
GSS17        70876      33350089
GSS18        58444      27834159
GSS19        56829      28974747
GSS2         89365      39527628
GSS20        57703      26616142
GSS21        61767      30355219
GSS22        64720      36908304
GSS23        57519      27108088
GSS24        67000      42438433
GSS25        67400      27855882
GSS26        58134      25469787
GSS27        66131      32318178
GSS28        64623      32377424
GSS29        79025      40128727
GSS3         87680      41929125
GSS30        82235      39870991
GSS31        74217      40362139
GSS32        70487      48483310
GSS33        79983      37653673
GSS34        75905      40291382
GSS35        74340      39417502
GSS36        87708      57647887
GSS37        87595      58177014
GSS38        85646      44903219
GSS39        85927      49630884
GSS4         79245      41177405
GSS40        87203      38956504
GSS41        82797      33814766
GSS42        81263      56907754
GSS43        79662      57693256
GSS44        72039      47484885
GSS45        72042      47419069
GSS46        77811      45501098
GSS47        78031      39332517
GSS48        83544      58272574
GSS49        86679      65820113
GSS5         79026      40721861
GSS50        82534      53583853
GSS51        93568      59637908
GSS52        88623      59010729
GSS53        75459      40364933
GSS54        74238      42424806
GSS55        86017      45654714
GSS56        88489      59152817
GSS57        76413      66811866
GSS58        72041      79217805
GSS59        88117      68596327
GSS6         78265      38902627
GSS60        87106      58023122
GSS61        63520      45303983
GSS62        69101      47565338
GSS63        89659      67263122
GSS64        86192      58170269
GSS65        87488      53899015
GSS66        87677      56809346
GSS67        97041      58012120
GSS68        100578     54572655
GSS69        100680     54443147
GSS7         77553      39404543
GSS70        101377     53560637
GSS71        102335     52344159
GSS72        102431     52222098
GSS73        102691     51891752
GSS74        102093     52651176
GSS75        98478      57266115
GSS76        90183      69696654
GSS77        89830      70785947
GSS78        88057      69611747
GSS79        87828      69672392
GSS8         76296      38105941
GSS80        89179      63409425
GSS81        80855      23963909
GSS82        77803      24487121
GSS83        87900      36287620
GSS84        84105      50245988
GSS85        80788      48954331
GSS86        89491      64547217
GSS87        78800      61945205
GSS88        78040      79495154
GSS89        76521      56256083
GSS9         72530      37270623
GSS90        94925      50985367
GSS91        76076      41193978
GSS92        85960      49622536
GSS93        69325      61701475
GSS94        85905      51766863
GSS95        82249      61153026
GSS96        85398      56126189
GSS97        82860      57409506
GSS98        90543      53378702
GSS99        80612      68811602
HTC1         31500      54333090
HTC10        13742      22639945
HTC2         28724      63888728
HTC3         17511      41047686
HTC4         16141      39813846
HTC5         40806      30691362
HTC6         68180      60336501
HTC7         79358      67445864
HTC8         67882      59739592
HTC9         63966      86882370
HTG1         1315       188873586
HTG10        1241       186655188
HTG11        1430       184186755
HTG12        876        191942874
HTG13        751        192581971
HTG14        741        192177383
HTG15        776        192310755
HTG16        803        192258670
HTG17        764        192565245
HTG18        2026       171661543
HTG19        1047       188018220
HTG2         2563       186100623
HTG20        1025       188850494
HTG21        775        192061902
HTG22        926        190515050
HTG23        878        190943046
HTG24        826        191129879
HTG25        772        192213127
HTG26        846        191454508
HTG27        852        191658232
HTG28        979        189575716
HTG29        909        190996110
HTG3         2453       185415926
HTG30        923        190509388
HTG31        877        191462035
HTG32        972        189663633
HTG33        870        191253555
HTG34        845        191603185
HTG35        835        191930960
HTG36        875        191186535
HTG37        978        190243776
HTG38        923        190693462
HTG39        996        190009121
HTG4         2524       188411486
HTG40        1158       187745376
HTG41        1227       187428628
HTG42        1261       188048137
HTG43        1147       187519437
HTG44        1103       190870586
HTG45        1214       190856016
HTG46        1239       191122603
HTG47        1164       191588556
HTG48        1092       191211261
HTG49        1040       190455526
HTG5         1281       185748619
HTG50        986        189540954
HTG51        1014       189655214
HTG52        952        189598511
HTG53        1059       189688650
HTG54        961        189980376
HTG55        994        189426796
HTG56        951        189079261
HTG57        1569       185625214
HTG58        1770       185205537
HTG59        1529       183625946
HTG6         1274       185374425
HTG60        2027       183806904
HTG61        2084       183060303
HTG62        1185       192243797
HTG63        1168       190734813
HTG64        1484       188924883
HTG65        1045       193930736
HTG66        1025       193974604
HTG67        1002       193714372
HTG68        909        182694787
HTG69        644        110520336
HTG7         1247       185472319
HTG8         1287       185088399
HTG9         1182       187153099
INV1         17762      161080728
INV2         1624       166901490
INV3         33413      116128677
INV4         78317      74508915
INV5         74670      73820555
INV6         58635      89937494
INV7         50844      99740374
INV8         13615      43460831
MAM1         52488      115017765
MAM2         33906      53225552
PAT1         222669     70172534
PAT10        140467     56018524
PAT11        102696     62154827
PAT12        111689     51361107
PAT13        146606     54653138
PAT14        153386     75551630
PAT15        104813     117875235
PAT16        142210     91826277
PAT17        111971     109364513
PAT18        125865     93490493
PAT19        82814      23628836
PAT2         194385     84711939
PAT3         172019     95882664
PAT4         153753     106055882
PAT5         153745     92495265
PAT6         146783     86027426
PAT7         113978     113621441
PAT8         133783     96905873
PAT9         130284     94221740
PHG          2812       17755472
PLN1         36662      119344805
PLN10        3186       174302807
PLN11        60657      63376943
PLN12        77264      78287499
PLN13        76039      79320396
PLN14        34146      116681070
PLN15        53005      99888017
PLN16        36856      113940968
PLN17        7264       13812970
PLN2         1377       175638183
PLN3         2678       166725027
PLN4         77145      78910138
PLN5         72880      69075734
PLN6         30494      52662016
PLN7         7906       152012572
PLN8         1575       207124589
PLN9         6          197759100
PRI1         21425      141150682
PRI10        1442       181514499
PRI11        1297       178964356
PRI12        1532       178200257
PRI13        1610       179647185
PRI14        1484       186407172
PRI15        17367      162746389
PRI16        43916      104726314
PRI17        22068      123533182
PRI18        1630       183464671
PRI19        1706       183537515
PRI2         1464       173041335
PRI20        2050       182481731
PRI21        2168       181559087
PRI22        15671      155132932
PRI23        53263      84315595
PRI24        31155      79712658
PRI25        5995       180571477
PRI26        21862      148798038
PRI27        50871      117804773
PRI28        37284      129052657
PRI29        28916      43027777
PRI3         1278       186256268
PRI4         1329       184239148
PRI5         1193       181228346
PRI6         1205       179199796
PRI7         1232       180205602
PRI8         1368       174688572
PRI9         1229       177773829
ROD1         9162       169560212
ROD10        978        182428889
ROD11        1016       187269376
ROD12        976        183805291
ROD13        1012       184682982
ROD14        955        182453468
ROD15        964        182555346
ROD16        6746       177642531
ROD17        22214      152826232
ROD18        1201       191364555
ROD19        1234       193893869
ROD2         925        174150862
ROD20        28286      141852055
ROD21        29609      77386875
ROD22        21290      157009936
ROD23        27098      33945103
ROD3         901        174176248
ROD4         906        174280563
ROD5         928        174016482
ROD6         981        181262085
ROD7         975        180093515
ROD8         984        181524905
ROD9         1018       183668708
STS1         82030      35188895
STS10        58191      44485563
STS11        58022      43669473
STS12        75307      38356946
STS13        87751      39064327
STS14        11935      4746633
STS2         84061      44752685
STS3         76460      30868762
STS4         66822      33901612
STS5         54867      31982409
STS6         54730      32222123
STS7         54692      32191782
STS8         56390      38743125
STS9         58081      44559565
SYN          23382      32944865
UNA          205        111605
VRL1         72334      65685832
VRL2         72349      65087207
VRL3         70407      70266210
VRL4         71413      66331336
VRL5         39265      37876436
VRT1         52706      113207473
VRT10        30540      28157263
VRT2         23701      154593115
VRT3         66460      91575303
VRT4         47644      65419796
VRT5         5113       179623036
VRT6         1291       193212946
VRT7         1336       192958549
VRT8         17119      168960985
VRT9         17642      168584689


2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 151.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries       Bases   Species

9899176 11953879540   Homo sapiens
6625240  7917536708   Mus musculus
1035223  5682651636   Rattus norvegicus
1356047  2424040780   Bos taurus
881280   2215171371   Danio rerio
2678230  1780527217   Zea mays
357923   1171720224   Oryza sativa (japonica cultivar-group)
1179107   954916818   Xenopus tropicalis
1409440   805877955   Canis familiaris
534811    785832602   Drosophila melanogaster
1120673   785475842   Sus scrofa
787971    684548519   Gallus gallus
981930    648235477   Arabidopsis thaliana
207825    533669351   Pan troglodytes
784734    463997658   Sorghum bicolor
68350     434454818   Macaca mulatta
695995    420688666   Ciona intestinalis
387953    420276295   Medicago truncatula
596255    404132383   Brassica oleracea
612712    349010415   Triticum aestivum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 December 2005

                NCBI-GenBank Flat File Release 151.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 151.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
	Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
	Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
	Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
	Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Tony Stearman

User Support
	Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
	Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
	Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
	David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center