Release Notes For GenBank Release 153
GBREL.TXT Genetic Sequence Data Bank
April 15 2006
NCBI-GenBank Flat File Release 153.0
Distribution Release Notes
56620500 loci, 61582143971 bases, from 56620500 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource from which those other
efforts draw. For information about TPA and RefSeq, please refer to:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 153.0
1.2 Cutoff Date
1.3 Important Changes in Release 153.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 153.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
E-MAIL: update@ncbi.nlm.nih.gov
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 153.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.
1.2 Cutoff Date
This full release, 153.0, incorporates data available to the collaborating
databases as of April 11, 2006 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 153.0
1.3.1 Changes in the content of index files
The 'index' files which accompany GenBank releases (see Section 3.3) are
considered to be a legacy data product by NCBI, generated mostly for
historical reasons. FTP statistics since January 2005 seem to support this:
the index files are transferred only half as frequently as the files of
sequence records. The inherent inefficiencies of the index file format also
leads us to suspect that they have little serious use by the user community,
particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI. GenBank 153.0 thus contains these ten index
files:
gbaut1.idx
gbaut2.idx
gbaut3.idx
gbaut4.idx
gbaut5.idx
gbaut6.idx
gbgen.idx
gbjou.idx
gbkey.idx
gbsec.idx
In addition, a version of gbacc.idx which encompasses the entirety of the
release was built manually, but note that the first field contains just an
accession number, rather than Accession.Version. We hope to have this last
discrepancy resolved by the June release.
This current solution is likely to be only a stop-gap, and we will probably
pursue one of two options within the next year:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types index data.
If you are a user of the 'index' files associated with GenBank files, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
info@ncbi.nlm.nih.gov
Our apologies for any inconvenience that these changes may cause.
1.3.2 Organizational changes
The total number of sequence data files increased by 32 with this release:
- the BCT division is now comprised of 14 files (+1)
- the EST division is now comprised of 512 files (+25)
- the GSS division is now comprised of 174 files (+2)
- the HTG division is now comprised of 81 files (+2)
- the PRI division is now comprised of 30 files (+1)
- the ROD division is now comprised of 24 files (+1)
1.3.3 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
thirty-two of the GSS flatfiles in Release 153.0. Consider gbgss143.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
April 15 2006
NCBI-GenBank Flat File Release 153.0
GSS Sequences (Part 1)
86907 loci, 64480328 bases, from 86907 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "143" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New JOURNAL token for Pre-Grant Patent Publications
Sequences associated with granted patents from the US Patent and
Trademark Office (USPTO) typically have references that look like this:
REFERENCE 1 (bases 1 to 22)
AUTHORS Stewart,L.J.
TITLE Screening methods for identifying ligands
JOURNAL Patent: US 6950757-A 2 27-SEP-2005;
The "Patent:" token indicates that the JOURNAL line pertains to a
patent document, as opposed to a published article in the scientific
literature.
But sequence data can be available well in advance of the point at which
an actual patent has been granted. As of GenBank Release 153 in June 2006,
we will indicate that a patent sequence is associated with a "Pre-Grant
Publication" via a slight change to the JOURNAL line:
REFERENCE 1 (bases 1 to 190)
AUTHORS Xu,M. and Humphreys,R.
TITLE Inhibition of li expression in mammalian cells
JOURNAL Pre-Grant Patent: US 20060008448A1 1 12-JAN-2006;
^^^^^^^^^^^^^^^^^
The introduction of "Pre-Grant Patent:" at the start of the JOURNAL
line will distinguish sequences associated with these two different
states in USPTO's patenting process.
Note that pre-grant identifiers from the USPTO are alphanumeric, and
lack a document-type suffix ("-A" in the granted-patent example above).
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 944 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut2.idx - Index of the entries according to accession number, part 2.
4. gbaut3.idx - Index of the entries according to accession number, part 3.
5. gbaut4.idx - Index of the entries according to accession number, part 4.
6. gbaut5.idx - Index of the entries according to accession number, part 5.
7. gbaut6.idx - Index of the entries according to accession number, part 6.
8. gbbct1.seq - Bacterial sequence entries, part 1.
9. gbbct10.seq - Bacterial sequence entries, part 10.
10. gbbct11.seq - Bacterial sequence entries, part 11.
11. gbbct12.seq - Bacterial sequence entries, part 12.
12. gbbct13.seq - Bacterial sequence entries, part 13.
13. gbbct14.seq - Bacterial sequence entries, part 14.
14. gbbct2.seq - Bacterial sequence entries, part 2.
15. gbbct3.seq - Bacterial sequence entries, part 3.
16. gbbct4.seq - Bacterial sequence entries, part 4.
17. gbbct5.seq - Bacterial sequence entries, part 5.
18. gbbct6.seq - Bacterial sequence entries, part 6.
19. gbbct7.seq - Bacterial sequence entries, part 7.
20. gbbct8.seq - Bacterial sequence entries, part 8.
21. gbbct9.seq - Bacterial sequence entries, part 9.
22. gbchg.txt - Accession numbers of entries updated since the previous release.
23. gbcon.seq - Constructed sequence entries.
24. gbdel.txt - Accession numbers of entries deleted since the previous release.
25. gbenv1.seq - Environmental sampling sequence entries, part 1.
26. gbenv2.seq - Environmental sampling sequence entries, part 2.
27. gbenv3.seq - Environmental sampling sequence entries, part 3.
28. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
29. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
30. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
31. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
32. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
33. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
34. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
35. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
36. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
37. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
38. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
39. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
40. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
41. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
42. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
43. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
44. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
45. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
46. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
47. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
48. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
49. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
50. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
51. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
52. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
53. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
54. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
55. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
56. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
57. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
58. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
59. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
60. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
61. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
62. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
63. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
64. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
65. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
66. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
67. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
68. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
69. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
70. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
71. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
72. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
73. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
74. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
75. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
76. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
77. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
78. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
79. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
80. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
81. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
82. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
83. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
84. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
85. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
86. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
87. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
88. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
89. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
90. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
91. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
92. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
93. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
94. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
95. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
96. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
97. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
98. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
99. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
100. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
101. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
102. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
103. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
104. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
105. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
106. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
107. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
108. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
109. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
110. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
111. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
112. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
113. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
114. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
115. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
116. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
117. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
118. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
119. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
120. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
121. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
122. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
123. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
124. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
125. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
126. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
127. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
128. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
129. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
130. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
131. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
132. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
133. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
134. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
135. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
136. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
137. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
138. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
139. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
140. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
141. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
142. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
143. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
144. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
145. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
146. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
147. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
148. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
149. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
150. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
151. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
152. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
153. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
154. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
155. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
156. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
157. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
158. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
159. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
160. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
161. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
162. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
163. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
164. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
165. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
166. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
167. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
168. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
169. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
170. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
171. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
172. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
173. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
174. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
175. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
176. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
177. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
178. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
179. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
180. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
181. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
182. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
183. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
184. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
185. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
186. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
187. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
188. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
189. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
190. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
191. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
192. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
193. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
194. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
195. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
196. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
197. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
198. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
199. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
200. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
201. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
202. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
203. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
204. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
205. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
206. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
207. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
208. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
209. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
210. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
211. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
212. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
213. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
214. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
215. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
216. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
217. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
218. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
219. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
220. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
221. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
222. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
223. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
224. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
225. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
226. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
227. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
228. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
229. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
230. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
231. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
232. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
233. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
234. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
235. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
236. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
237. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
238. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
239. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
240. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
241. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
242. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
243. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
244. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
245. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
246. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
247. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
248. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
249. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
250. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
251. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
252. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
253. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
254. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
255. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
256. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
257. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
258. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
259. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
260. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
261. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
262. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
263. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
264. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
265. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
266. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
267. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
268. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
269. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
270. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
271. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
272. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
273. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
274. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
275. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
276. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
277. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
278. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
279. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
280. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
281. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
282. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
283. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
284. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
285. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
286. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
287. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
288. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
289. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
290. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
291. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
292. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
293. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
294. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
295. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
296. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
297. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
298. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
299. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
300. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
301. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
302. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
303. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
304. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
305. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
306. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
307. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
308. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
309. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
310. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
311. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
312. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
313. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
314. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
315. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
316. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
317. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
318. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
319. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
320. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
321. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
322. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
323. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
324. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
325. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
326. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
327. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
328. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
329. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
330. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
331. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
332. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
333. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
334. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
335. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
336. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
337. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
338. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
339. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
340. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
341. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
342. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
343. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
344. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
345. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
346. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
347. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
348. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
349. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
350. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
351. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
352. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
353. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
354. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
355. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
356. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
357. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
358. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
359. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
360. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
361. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
362. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
363. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
364. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
365. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
366. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
367. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
368. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
369. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
370. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
371. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
372. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
373. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
374. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
375. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
376. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
377. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
378. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
379. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
380. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
381. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
382. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
383. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
384. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
385. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
386. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
387. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
388. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
389. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
390. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
391. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
392. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
393. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
394. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
395. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
396. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
397. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
398. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
399. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
400. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
401. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
402. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
403. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
404. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
405. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
406. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
407. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
408. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
409. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
410. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
411. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
412. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
413. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
414. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
415. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
416. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
417. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
418. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
419. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
420. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
421. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
422. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
423. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
424. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
425. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
426. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
427. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
428. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
429. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
430. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
431. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
432. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
433. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
434. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
435. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
436. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
437. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
438. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
439. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
440. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
441. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
442. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
443. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
444. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
445. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
446. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
447. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
448. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
449. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
450. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
451. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
452. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
453. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
454. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
455. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
456. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
457. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
458. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
459. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
460. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
461. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
462. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
463. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
464. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
465. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
466. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
467. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
468. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
469. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
470. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
471. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
472. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
473. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
474. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
475. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
476. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
477. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
478. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
479. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
480. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
481. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
482. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
483. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
484. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
485. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
486. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
487. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
488. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
489. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
490. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
491. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
492. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
493. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
494. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
495. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
496. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
497. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
498. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
499. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
500. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
501. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
502. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
503. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
504. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
505. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
506. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
507. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
508. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
509. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
510. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
511. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
512. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
513. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
514. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
515. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
516. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
517. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
518. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
519. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
520. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
521. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
522. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
523. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
524. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
525. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
526. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
527. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
528. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
529. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
530. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
531. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
532. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
533. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
534. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
535. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
536. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
537. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
538. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
539. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
540. gbgen.idx - Index of the entries according to gene symbols.
541. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
542. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
543. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
544. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
545. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
546. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
547. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
548. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
549. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
550. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
551. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
552. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
553. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
554. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
555. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
556. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
557. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
558. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
559. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
560. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
561. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
562. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
563. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
564. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
565. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
566. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
567. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
568. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
569. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
570. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
571. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
572. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
573. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
574. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
575. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
576. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
577. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
578. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
579. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
580. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
581. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
582. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
583. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
584. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
585. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
586. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
587. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
588. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
589. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
590. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
591. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
592. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
593. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
594. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
595. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
596. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
597. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
598. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
599. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
600. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
601. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
602. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
603. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
604. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
605. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
606. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
607. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
608. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
609. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
610. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
611. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
612. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
613. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
614. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
615. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
616. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
617. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
618. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
619. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
620. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
621. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
622. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
623. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
624. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
625. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
626. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
627. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
628. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
629. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
630. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
631. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
632. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
633. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
634. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
635. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
636. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
637. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
638. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
639. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
640. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
641. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
642. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
643. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
644. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
645. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
646. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
647. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
648. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
649. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
650. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
651. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
652. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
653. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
654. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
655. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
656. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
657. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
658. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
659. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
660. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
661. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
662. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
663. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
664. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
665. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
666. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
667. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
668. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
669. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
670. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
671. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
672. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
673. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
674. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
675. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
676. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
677. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
678. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
679. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
680. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
681. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
682. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
683. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
684. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
685. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
686. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
687. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
688. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
689. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
690. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
691. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
692. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
693. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
694. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
695. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
696. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
697. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
698. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
699. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
700. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
701. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
702. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
703. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
704. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
705. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
706. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
707. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
708. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
709. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
710. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
711. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
712. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
713. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
714. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
715. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
716. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
717. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
718. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
719. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
720. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
721. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
722. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
723. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
724. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
725. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
726. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
727. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
728. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
729. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
730. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
731. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
732. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
733. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
734. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
735. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
736. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
737. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
738. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
739. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
740. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
741. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
742. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
743. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
744. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
745. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
746. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
747. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
748. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
749. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
750. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
751. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
752. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
753. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
754. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
755. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
756. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
757. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
758. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
759. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
760. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
761. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
762. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
763. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
764. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
765. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
766. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
767. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
768. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
769. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
770. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
771. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
772. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
773. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
774. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
775. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
776. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
777. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
778. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
779. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
780. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
781. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
782. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
783. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
784. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
785. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
786. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
787. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
788. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
789. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
790. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
791. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
792. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
793. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
794. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
795. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
796. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
797. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
798. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
799. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
800. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
801. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
802. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
803. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
804. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
805. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
806. gbinv1.seq - Invertebrate sequence entries, part 1.
807. gbinv2.seq - Invertebrate sequence entries, part 2.
808. gbinv3.seq - Invertebrate sequence entries, part 3.
809. gbinv4.seq - Invertebrate sequence entries, part 4.
810. gbinv5.seq - Invertebrate sequence entries, part 5.
811. gbinv6.seq - Invertebrate sequence entries, part 6.
812. gbinv7.seq - Invertebrate sequence entries, part 7.
813. gbinv8.seq - Invertebrate sequence entries, part 8.
814. gbjou.idx - Index of the entries according to journal citation.
815. gbkey.idx - Index of the entries according to keyword phrase.
816. gbmam1.seq - Other mammalian sequence entries, part 1.
817. gbmam2.seq - Other mammalian sequence entries, part 2.
818. gbnew.txt - Accession numbers of entries new since the previous release.
819. gbpat1.seq - Patent sequence entries, part 1.
820. gbpat10.seq - Patent sequence entries, part 10.
821. gbpat11.seq - Patent sequence entries, part 11.
822. gbpat12.seq - Patent sequence entries, part 12.
823. gbpat13.seq - Patent sequence entries, part 13.
824. gbpat14.seq - Patent sequence entries, part 14.
825. gbpat15.seq - Patent sequence entries, part 15.
826. gbpat16.seq - Patent sequence entries, part 16.
827. gbpat17.seq - Patent sequence entries, part 17.
828. gbpat18.seq - Patent sequence entries, part 18.
829. gbpat19.seq - Patent sequence entries, part 19.
830. gbpat2.seq - Patent sequence entries, part 2.
831. gbpat20.seq - Patent sequence entries, part 20.
832. gbpat3.seq - Patent sequence entries, part 3.
833. gbpat4.seq - Patent sequence entries, part 4.
834. gbpat5.seq - Patent sequence entries, part 5.
835. gbpat6.seq - Patent sequence entries, part 6.
836. gbpat7.seq - Patent sequence entries, part 7.
837. gbpat8.seq - Patent sequence entries, part 8.
838. gbpat9.seq - Patent sequence entries, part 9.
839. gbphg.seq - Phage sequence entries.
840. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
841. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
842. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
843. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
844. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
845. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
846. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
847. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
848. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
849. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
850. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
851. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
852. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
853. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
854. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
855. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
856. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
857. gbpri1.seq - Primate sequence entries, part 1.
858. gbpri10.seq - Primate sequence entries, part 10.
859. gbpri11.seq - Primate sequence entries, part 11.
860. gbpri12.seq - Primate sequence entries, part 12.
861. gbpri13.seq - Primate sequence entries, part 13.
862. gbpri14.seq - Primate sequence entries, part 14.
863. gbpri15.seq - Primate sequence entries, part 15.
864. gbpri16.seq - Primate sequence entries, part 16.
865. gbpri17.seq - Primate sequence entries, part 17.
866. gbpri18.seq - Primate sequence entries, part 18.
867. gbpri19.seq - Primate sequence entries, part 19.
868. gbpri2.seq - Primate sequence entries, part 2.
869. gbpri20.seq - Primate sequence entries, part 20.
870. gbpri21.seq - Primate sequence entries, part 21.
871. gbpri22.seq - Primate sequence entries, part 22.
872. gbpri23.seq - Primate sequence entries, part 23.
873. gbpri24.seq - Primate sequence entries, part 24.
874. gbpri25.seq - Primate sequence entries, part 25.
875. gbpri26.seq - Primate sequence entries, part 26.
876. gbpri27.seq - Primate sequence entries, part 27.
877. gbpri28.seq - Primate sequence entries, part 28.
878. gbpri29.seq - Primate sequence entries, part 29.
879. gbpri3.seq - Primate sequence entries, part 3.
880. gbpri30.seq - Primate sequence entries, part 30.
881. gbpri4.seq - Primate sequence entries, part 4.
882. gbpri5.seq - Primate sequence entries, part 5.
883. gbpri6.seq - Primate sequence entries, part 6.
884. gbpri7.seq - Primate sequence entries, part 7.
885. gbpri8.seq - Primate sequence entries, part 8.
886. gbpri9.seq - Primate sequence entries, part 9.
887. gbrel.txt - Release notes (this document).
888. gbrod1.seq - Rodent sequence entries, part 1.
889. gbrod10.seq - Rodent sequence entries, part 10.
890. gbrod11.seq - Rodent sequence entries, part 11.
891. gbrod12.seq - Rodent sequence entries, part 12.
892. gbrod13.seq - Rodent sequence entries, part 13.
893. gbrod14.seq - Rodent sequence entries, part 14.
894. gbrod15.seq - Rodent sequence entries, part 15.
895. gbrod16.seq - Rodent sequence entries, part 16.
896. gbrod17.seq - Rodent sequence entries, part 17.
897. gbrod18.seq - Rodent sequence entries, part 18.
898. gbrod19.seq - Rodent sequence entries, part 19.
899. gbrod2.seq - Rodent sequence entries, part 2.
900. gbrod20.seq - Rodent sequence entries, part 20.
901. gbrod21.seq - Rodent sequence entries, part 21.
902. gbrod22.seq - Rodent sequence entries, part 22.
903. gbrod23.seq - Rodent sequence entries, part 23.
904. gbrod24.seq - Rodent sequence entries, part 24.
905. gbrod3.seq - Rodent sequence entries, part 3.
906. gbrod4.seq - Rodent sequence entries, part 4.
907. gbrod5.seq - Rodent sequence entries, part 5.
908. gbrod6.seq - Rodent sequence entries, part 6.
909. gbrod7.seq - Rodent sequence entries, part 7.
910. gbrod8.seq - Rodent sequence entries, part 8.
911. gbrod9.seq - Rodent sequence entries, part 9.
912. gbsdr.txt - Short directory of the data bank.
913. gbsec.idx - Index of the entries according to secondary accession number.
914. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
915. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
916. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
917. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
918. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
919. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
920. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
921. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
922. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
923. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
924. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
925. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
926. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
927. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
928. gbsyn.seq - Synthetic and chimeric sequence entries.
929. gbuna.seq - Unannotated sequence entries.
930. gbvrl1.seq - Viral sequence entries, part 1.
931. gbvrl2.seq - Viral sequence entries, part 2.
932. gbvrl3.seq - Viral sequence entries, part 3.
933. gbvrl4.seq - Viral sequence entries, part 4.
934. gbvrl5.seq - Viral sequence entries, part 5.
935. gbvrt1.seq - Other vertebrate sequence entries, part 1.
936. gbvrt10.seq - Other vertebrate sequence entries, part 10.
937. gbvrt2.seq - Other vertebrate sequence entries, part 2.
938. gbvrt3.seq - Other vertebrate sequence entries, part 3.
939. gbvrt4.seq - Other vertebrate sequence entries, part 4.
940. gbvrt5.seq - Other vertebrate sequence entries, part 5.
941. gbvrt6.seq - Other vertebrate sequence entries, part 6.
942. gbvrt7.seq - Other vertebrate sequence entries, part 7.
943. gbvrt8.seq - Other vertebrate sequence entries, part 8.
944. gbvrt9.seq - Other vertebrate sequence entries, part 9.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 153.0 flatfiles require roughly 215 GB (sequence
files only) or 224 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1747858059 gbacc.idx
500926801 gbaut1.idx
500109516 gbaut2.idx
500058372 gbaut3.idx
500502837 gbaut4.idx
500056882 gbaut5.idx
267886592 gbaut6.idx
250005701 gbbct1.seq
252875878 gbbct10.seq
256592994 gbbct11.seq
253795540 gbbct12.seq
250002352 gbbct13.seq
192742689 gbbct14.seq
250045941 gbbct2.seq
258913272 gbbct3.seq
250039938 gbbct4.seq
258514676 gbbct5.seq
250000557 gbbct6.seq
257109012 gbbct7.seq
250757122 gbbct8.seq
251952277 gbbct9.seq
7909779 gbchg.txt
1264481053 gbcon.seq
128546 gbdel.txt
250000429 gbenv1.seq
250000087 gbenv2.seq
125971283 gbenv3.seq
230688413 gbest1.seq
230689410 gbest10.seq
230690830 gbest100.seq
230689645 gbest101.seq
230687526 gbest102.seq
230688014 gbest103.seq
230689733 gbest104.seq
230688860 gbest105.seq
230687499 gbest106.seq
230689931 gbest107.seq
230690581 gbest108.seq
230687999 gbest109.seq
230688482 gbest11.seq
230688047 gbest110.seq
230689539 gbest111.seq
230688738 gbest112.seq
230482191 gbest113.seq
230689154 gbest114.seq
230689328 gbest115.seq
230689823 gbest116.seq
230688298 gbest117.seq
230688948 gbest118.seq
230689331 gbest119.seq
230688289 gbest12.seq
230689913 gbest120.seq
230688022 gbest121.seq
230690553 gbest122.seq
230688076 gbest123.seq
230687643 gbest124.seq
230689741 gbest125.seq
230688561 gbest126.seq
230688027 gbest127.seq
230688309 gbest128.seq
230687451 gbest129.seq
230688229 gbest13.seq
230687507 gbest130.seq
230687701 gbest131.seq
230689510 gbest132.seq
230690492 gbest133.seq
230687480 gbest134.seq
230688340 gbest135.seq
230687710 gbest136.seq
230690124 gbest137.seq
230690864 gbest138.seq
230688406 gbest139.seq
230689885 gbest14.seq
230689511 gbest140.seq
230689106 gbest141.seq
230689060 gbest142.seq
230688233 gbest143.seq
230689748 gbest144.seq
230688389 gbest145.seq
230687782 gbest146.seq
230687726 gbest147.seq
230688638 gbest148.seq
230689544 gbest149.seq
230687647 gbest15.seq
230689475 gbest150.seq
230687514 gbest151.seq
230690925 gbest152.seq
230691390 gbest153.seq
230689005 gbest154.seq
230687926 gbest155.seq
230687744 gbest156.seq
230688949 gbest157.seq
230689175 gbest158.seq
230689984 gbest159.seq
230687804 gbest16.seq
230689544 gbest160.seq
230687471 gbest161.seq
230689093 gbest162.seq
230688378 gbest163.seq
230689084 gbest164.seq
230688112 gbest165.seq
230689970 gbest166.seq
230688310 gbest167.seq
230688923 gbest168.seq
230687782 gbest169.seq
230687861 gbest17.seq
230688650 gbest170.seq
230689363 gbest171.seq
230688607 gbest172.seq
227565550 gbest173.seq
230688523 gbest174.seq
230687637 gbest175.seq
230688889 gbest176.seq
230688680 gbest177.seq
230689734 gbest178.seq
230688365 gbest179.seq
230690349 gbest18.seq
230689540 gbest180.seq
230687949 gbest181.seq
228524454 gbest182.seq
230687571 gbest183.seq
230687785 gbest184.seq
230688545 gbest185.seq
230688084 gbest186.seq
230689291 gbest187.seq
230689703 gbest188.seq
230687626 gbest189.seq
230688584 gbest19.seq
230688956 gbest190.seq
230689266 gbest191.seq
230687804 gbest192.seq
230689339 gbest193.seq
230688472 gbest194.seq
230689665 gbest195.seq
230690592 gbest196.seq
230687986 gbest197.seq
230688794 gbest198.seq
230689915 gbest199.seq
230688569 gbest2.seq
230688607 gbest20.seq
230688452 gbest200.seq
230688401 gbest201.seq
230690192 gbest202.seq
230688440 gbest203.seq
230688676 gbest204.seq
230688919 gbest205.seq
230687478 gbest206.seq
230687997 gbest207.seq
230689133 gbest208.seq
230689768 gbest209.seq
230689671 gbest21.seq
230687542 gbest210.seq
230689311 gbest211.seq
230687446 gbest212.seq
230687522 gbest213.seq
230690472 gbest214.seq
230688887 gbest215.seq
230689909 gbest216.seq
230690418 gbest217.seq
230688698 gbest218.seq
230688592 gbest219.seq
230687697 gbest22.seq
230690277 gbest220.seq
230687990 gbest221.seq
230688939 gbest222.seq
168233411 gbest223.seq
162493933 gbest224.seq
165501026 gbest225.seq
170456423 gbest226.seq
169667721 gbest227.seq
163814735 gbest228.seq
165125582 gbest229.seq
230690397 gbest23.seq
164554951 gbest230.seq
164281128 gbest231.seq
164574389 gbest232.seq
164139621 gbest233.seq
164163652 gbest234.seq
162949479 gbest235.seq
168308204 gbest236.seq
162240905 gbest237.seq
163591936 gbest238.seq
167950143 gbest239.seq
230688995 gbest24.seq
167384046 gbest240.seq
165873282 gbest241.seq
165724107 gbest242.seq
165397201 gbest243.seq
165184827 gbest244.seq
164283699 gbest245.seq
164285277 gbest246.seq
165307626 gbest247.seq
166256322 gbest248.seq
180794100 gbest249.seq
230689072 gbest25.seq
171308553 gbest250.seq
195957194 gbest251.seq
230689377 gbest252.seq
230688278 gbest253.seq
230690235 gbest254.seq
230689823 gbest255.seq
230687728 gbest256.seq
230689071 gbest257.seq
230691398 gbest258.seq
230690224 gbest259.seq
230688276 gbest26.seq
230688352 gbest260.seq
230689076 gbest261.seq
230689216 gbest262.seq
230689076 gbest263.seq
230689929 gbest264.seq
230688346 gbest265.seq
230687504 gbest266.seq
230688475 gbest267.seq
230688006 gbest268.seq
230689085 gbest269.seq
230687934 gbest27.seq
230688558 gbest270.seq
230690541 gbest271.seq
230689494 gbest272.seq
230689594 gbest273.seq
230689019 gbest274.seq
230688102 gbest275.seq
230688276 gbest276.seq
230690611 gbest277.seq
230688748 gbest278.seq
230688396 gbest279.seq
230689476 gbest28.seq
230687664 gbest280.seq
207958757 gbest281.seq
230690285 gbest282.seq
230689534 gbest283.seq
230689338 gbest284.seq
230688863 gbest285.seq
230688133 gbest286.seq
230688270 gbest287.seq
230689307 gbest288.seq
230689469 gbest289.seq
230688395 gbest29.seq
230687767 gbest290.seq
230688031 gbest291.seq
230688578 gbest292.seq
230688828 gbest293.seq
230690402 gbest294.seq
230688895 gbest295.seq
230687546 gbest296.seq
230690765 gbest297.seq
230688670 gbest298.seq
230687508 gbest299.seq
230690160 gbest3.seq
230688273 gbest30.seq
230693025 gbest300.seq
230688186 gbest301.seq
230689054 gbest302.seq
230690038 gbest303.seq
230689515 gbest304.seq
230688915 gbest305.seq
230691335 gbest306.seq
230691365 gbest307.seq
230689003 gbest308.seq
230690643 gbest309.seq
230691317 gbest31.seq
230689136 gbest310.seq
230688205 gbest311.seq
230691093 gbest312.seq
230691656 gbest313.seq
230691158 gbest314.seq
230691172 gbest315.seq
230689475 gbest316.seq
230688021 gbest317.seq
230690617 gbest318.seq
230688306 gbest319.seq
230688018 gbest32.seq
230689311 gbest320.seq
230689907 gbest321.seq
230688514 gbest322.seq
230688580 gbest323.seq
230688091 gbest324.seq
230688479 gbest325.seq
230689116 gbest326.seq
230689840 gbest327.seq
212913732 gbest328.seq
230688718 gbest329.seq
230688069 gbest33.seq
230687734 gbest330.seq
230687947 gbest331.seq
230687691 gbest332.seq
230689537 gbest333.seq
185508140 gbest334.seq
144886702 gbest335.seq
230691170 gbest336.seq
230690665 gbest337.seq
230688794 gbest338.seq
230689151 gbest339.seq
230688426 gbest34.seq
230688127 gbest340.seq
230689056 gbest341.seq
230688143 gbest342.seq
230688619 gbest343.seq
230692415 gbest344.seq
230689078 gbest345.seq
230687664 gbest346.seq
230690424 gbest347.seq
230687440 gbest348.seq
230687712 gbest349.seq
230688769 gbest35.seq
230692299 gbest350.seq
230688573 gbest351.seq
230687779 gbest352.seq
230689644 gbest353.seq
230687714 gbest354.seq
230688636 gbest355.seq
230688094 gbest356.seq
230691189 gbest357.seq
230689625 gbest358.seq
230689091 gbest359.seq
230688319 gbest36.seq
230689069 gbest360.seq
230688291 gbest361.seq
230689633 gbest362.seq
230688419 gbest363.seq
230688154 gbest364.seq
230689815 gbest365.seq
230688061 gbest366.seq
230693537 gbest367.seq
230694656 gbest368.seq
230692237 gbest369.seq
230689218 gbest37.seq
230688141 gbest370.seq
230690111 gbest371.seq
230688805 gbest372.seq
230689093 gbest373.seq
230689746 gbest374.seq
230688113 gbest375.seq
230689646 gbest376.seq
230688934 gbest377.seq
230688785 gbest378.seq
230688139 gbest379.seq
230688206 gbest38.seq
222922939 gbest380.seq
230690818 gbest381.seq
230687631 gbest382.seq
230690078 gbest383.seq
230688887 gbest384.seq
230690945 gbest385.seq
230687738 gbest386.seq
230688855 gbest387.seq
222601597 gbest388.seq
230689459 gbest389.seq
229596183 gbest39.seq
230688458 gbest390.seq
230690151 gbest391.seq
230689223 gbest392.seq
230690241 gbest393.seq
230688432 gbest394.seq
230688118 gbest395.seq
230688226 gbest396.seq
230688271 gbest397.seq
230688939 gbest398.seq
230690887 gbest399.seq
230687668 gbest4.seq
230687487 gbest40.seq
230691397 gbest400.seq
230691449 gbest401.seq
230689971 gbest402.seq
230691922 gbest403.seq
230687679 gbest404.seq
223891731 gbest405.seq
210456362 gbest406.seq
210162107 gbest407.seq
210325574 gbest408.seq
210273372 gbest409.seq
215149456 gbest41.seq
210414696 gbest410.seq
210410360 gbest411.seq
211928381 gbest412.seq
211492931 gbest413.seq
211245847 gbest414.seq
213608194 gbest415.seq
212020456 gbest416.seq
210899653 gbest417.seq
210982264 gbest418.seq
210847864 gbest419.seq
192226798 gbest42.seq
210128741 gbest420.seq
210131547 gbest421.seq
210300682 gbest422.seq
210238194 gbest423.seq
209855238 gbest424.seq
225507459 gbest425.seq
230690815 gbest426.seq
230687465 gbest427.seq
230688850 gbest428.seq
230689472 gbest429.seq
193193841 gbest43.seq
230687452 gbest430.seq
230687572 gbest431.seq
230687988 gbest432.seq
230690034 gbest433.seq
230690591 gbest434.seq
230691898 gbest435.seq
230690096 gbest436.seq
230689309 gbest437.seq
230689245 gbest438.seq
230690454 gbest439.seq
217268289 gbest44.seq
230688885 gbest440.seq
230690939 gbest441.seq
227505831 gbest442.seq
230688155 gbest443.seq
230688576 gbest444.seq
230689077 gbest445.seq
230687536 gbest446.seq
230689065 gbest447.seq
230689216 gbest448.seq
230689235 gbest449.seq
216179911 gbest45.seq
230689519 gbest450.seq
230688762 gbest451.seq
230690647 gbest452.seq
230690778 gbest453.seq
230689811 gbest454.seq
230691217 gbest455.seq
230690735 gbest456.seq
230689126 gbest457.seq
230688473 gbest458.seq
230691182 gbest459.seq
215980609 gbest46.seq
230687793 gbest460.seq
230691614 gbest461.seq
230689799 gbest462.seq
230690683 gbest463.seq
230689710 gbest464.seq
230690831 gbest465.seq
230691438 gbest466.seq
230687501 gbest467.seq
229785811 gbest468.seq
230689998 gbest469.seq
216899085 gbest47.seq
230689240 gbest470.seq
230691017 gbest471.seq
230689689 gbest472.seq
230687597 gbest473.seq
230689417 gbest474.seq
230688815 gbest475.seq
230689238 gbest476.seq
230689733 gbest477.seq
230690463 gbest478.seq
230688565 gbest479.seq
230688530 gbest48.seq
230689225 gbest480.seq
229238653 gbest481.seq
230690483 gbest482.seq
230690080 gbest483.seq
230688979 gbest484.seq
230687667 gbest485.seq
230688683 gbest486.seq
230688042 gbest487.seq
230689182 gbest488.seq
230688054 gbest489.seq
230687630 gbest49.seq
230691680 gbest490.seq
230690727 gbest491.seq
198897290 gbest492.seq
196053029 gbest493.seq
230688977 gbest494.seq
230687888 gbest495.seq
230689411 gbest496.seq
230689276 gbest497.seq
230688954 gbest498.seq
230687458 gbest499.seq
164127827 gbest5.seq
220068559 gbest50.seq
230689460 gbest500.seq
230688526 gbest501.seq
230688252 gbest502.seq
230688035 gbest503.seq
230687499 gbest504.seq
230688032 gbest505.seq
230687995 gbest506.seq
230690214 gbest507.seq
230687739 gbest508.seq
230690303 gbest509.seq
230690321 gbest51.seq
221037227 gbest510.seq
230687592 gbest511.seq
230459814 gbest512.seq
230688393 gbest52.seq
230690037 gbest53.seq
230689613 gbest54.seq
230688434 gbest55.seq
230688148 gbest56.seq
230689494 gbest57.seq
230690848 gbest58.seq
230689762 gbest59.seq
177450586 gbest6.seq
230689329 gbest60.seq
230689681 gbest61.seq
230688350 gbest62.seq
230687621 gbest63.seq
230690139 gbest64.seq
230687973 gbest65.seq
230690097 gbest66.seq
209741833 gbest67.seq
209415751 gbest68.seq
208423798 gbest69.seq
230687876 gbest7.seq
209207231 gbest70.seq
209990335 gbest71.seq
210033283 gbest72.seq
208861986 gbest73.seq
209147005 gbest74.seq
210332668 gbest75.seq
207716496 gbest76.seq
205746156 gbest77.seq
208300405 gbest78.seq
208572224 gbest79.seq
230687875 gbest8.seq
212691252 gbest80.seq
228937791 gbest81.seq
230689855 gbest82.seq
230691322 gbest83.seq
218451656 gbest84.seq
214791330 gbest85.seq
215729390 gbest86.seq
230688966 gbest87.seq
230690276 gbest88.seq
230689924 gbest89.seq
230688341 gbest9.seq
230689788 gbest90.seq
230689143 gbest91.seq
230687948 gbest92.seq
230689847 gbest93.seq
230688620 gbest94.seq
230688598 gbest95.seq
230688533 gbest96.seq
230690194 gbest97.seq
230688429 gbest98.seq
230688638 gbest99.seq
52893874 gbgen.idx
230688691 gbgss1.seq
230691106 gbgss10.seq
227385665 gbgss100.seq
228219605 gbgss101.seq
228748185 gbgss102.seq
228611398 gbgss103.seq
227950514 gbgss104.seq
227521541 gbgss105.seq
230689904 gbgss106.seq
230689766 gbgss107.seq
230688495 gbgss108.seq
230689053 gbgss109.seq
230690515 gbgss11.seq
230689165 gbgss110.seq
230688544 gbgss111.seq
230689342 gbgss112.seq
230687915 gbgss113.seq
230689166 gbgss114.seq
230688484 gbgss115.seq
230690118 gbgss116.seq
230691286 gbgss117.seq
230689648 gbgss118.seq
230688834 gbgss119.seq
230688952 gbgss12.seq
230687549 gbgss120.seq
230689828 gbgss121.seq
230688916 gbgss122.seq
230688972 gbgss123.seq
230688592 gbgss124.seq
230689364 gbgss125.seq
230690157 gbgss126.seq
230689374 gbgss127.seq
230688607 gbgss128.seq
230689077 gbgss129.seq
230689508 gbgss13.seq
230689775 gbgss130.seq
230688428 gbgss131.seq
230689927 gbgss132.seq
230690462 gbgss133.seq
230690053 gbgss134.seq
230690538 gbgss135.seq
230689407 gbgss136.seq
230689939 gbgss137.seq
230687566 gbgss138.seq
230687884 gbgss139.seq
230689213 gbgss14.seq
230688657 gbgss140.seq
230689045 gbgss141.seq
13990473 gbgss142.seq
250001674 gbgss143.seq
250002190 gbgss144.seq
250002593 gbgss145.seq
250000742 gbgss146.seq
250002973 gbgss147.seq
250000706 gbgss148.seq
250001346 gbgss149.seq
230689083 gbgss15.seq
250000913 gbgss150.seq
250000133 gbgss151.seq
250001741 gbgss152.seq
250004607 gbgss153.seq
250000808 gbgss154.seq
250001540 gbgss155.seq
250001115 gbgss156.seq
250000238 gbgss157.seq
250001809 gbgss158.seq
250001707 gbgss159.seq
230687781 gbgss16.seq
250001781 gbgss160.seq
250001708 gbgss161.seq
250000909 gbgss162.seq
250000822 gbgss163.seq
250002153 gbgss164.seq
250000969 gbgss165.seq
250001442 gbgss166.seq
250002078 gbgss167.seq
250002306 gbgss168.seq
250001597 gbgss169.seq
230689500 gbgss17.seq
250000871 gbgss170.seq
250000474 gbgss171.seq
250001654 gbgss172.seq
250002267 gbgss173.seq
240054968 gbgss174.seq
230689690 gbgss18.seq
230689048 gbgss19.seq
230688162 gbgss2.seq
230689752 gbgss20.seq
230688165 gbgss21.seq
230690284 gbgss22.seq
230689929 gbgss23.seq
230687772 gbgss24.seq
230688053 gbgss25.seq
230689455 gbgss26.seq
230688033 gbgss27.seq
230689734 gbgss28.seq
230687668 gbgss29.seq
230691027 gbgss3.seq
230689856 gbgss30.seq
230688604 gbgss31.seq
230689612 gbgss32.seq
230687884 gbgss33.seq
230690042 gbgss34.seq
230688867 gbgss35.seq
230689771 gbgss36.seq
230689273 gbgss37.seq
230687763 gbgss38.seq
230688214 gbgss39.seq
230689940 gbgss4.seq
230688288 gbgss40.seq
230689590 gbgss41.seq
230689392 gbgss42.seq
230689127 gbgss43.seq
230689097 gbgss44.seq
230687820 gbgss45.seq
230689567 gbgss46.seq
230690224 gbgss47.seq
230688705 gbgss48.seq
230689968 gbgss49.seq
230688983 gbgss5.seq
230687704 gbgss50.seq
230687469 gbgss51.seq
230688394 gbgss52.seq
230689819 gbgss53.seq
230688818 gbgss54.seq
230689799 gbgss55.seq
230688223 gbgss56.seq
230689421 gbgss57.seq
230689129 gbgss58.seq
230689040 gbgss59.seq
230689904 gbgss6.seq
230691029 gbgss60.seq
229189576 gbgss61.seq
230689103 gbgss62.seq
230687849 gbgss63.seq
230687513 gbgss64.seq
230689005 gbgss65.seq
230687964 gbgss66.seq
230688260 gbgss67.seq
230689359 gbgss68.seq
230689865 gbgss69.seq
230689273 gbgss7.seq
230689570 gbgss70.seq
230688941 gbgss71.seq
230687499 gbgss72.seq
230689262 gbgss73.seq
230688593 gbgss74.seq
230687857 gbgss75.seq
230689735 gbgss76.seq
230689903 gbgss77.seq
230687507 gbgss78.seq
230688549 gbgss79.seq
230688315 gbgss8.seq
230688594 gbgss80.seq
202445932 gbgss81.seq
194697867 gbgss82.seq
215356671 gbgss83.seq
230689144 gbgss84.seq
230688373 gbgss85.seq
230688779 gbgss86.seq
230690229 gbgss87.seq
230688896 gbgss88.seq
230689793 gbgss89.seq
230690615 gbgss9.seq
230687713 gbgss90.seq
230689030 gbgss91.seq
230688160 gbgss92.seq
230688518 gbgss93.seq
230687829 gbgss94.seq
230690158 gbgss95.seq
230689093 gbgss96.seq
230689546 gbgss97.seq
230689527 gbgss98.seq
230687900 gbgss99.seq
250003708 gbhtc1.seq
83881505 gbhtc10.seq
250000428 gbhtc2.seq
250001165 gbhtc3.seq
250014730 gbhtc4.seq
250000019 gbhtc5.seq
250001429 gbhtc6.seq
250000815 gbhtc7.seq
250001097 gbhtc8.seq
250007360 gbhtc9.seq
250076731 gbhtg1.seq
250170810 gbhtg10.seq
250074897 gbhtg11.seq
250309759 gbhtg12.seq
250291410 gbhtg13.seq
250201751 gbhtg14.seq
250130429 gbhtg15.seq
250277646 gbhtg16.seq
250067281 gbhtg17.seq
250136554 gbhtg18.seq
250262894 gbhtg19.seq
250145747 gbhtg2.seq
250105134 gbhtg20.seq
250160047 gbhtg21.seq
250203460 gbhtg22.seq
250125533 gbhtg23.seq
250257460 gbhtg24.seq
250169267 gbhtg25.seq
250162036 gbhtg26.seq
250096919 gbhtg27.seq
250214188 gbhtg28.seq
250274109 gbhtg29.seq
250025205 gbhtg3.seq
250211798 gbhtg30.seq
250195244 gbhtg31.seq
250217524 gbhtg32.seq
250059080 gbhtg33.seq
250066003 gbhtg34.seq
250114942 gbhtg35.seq
250204228 gbhtg36.seq
250023027 gbhtg37.seq
250015042 gbhtg38.seq
250126858 gbhtg39.seq
250202359 gbhtg4.seq
250061732 gbhtg40.seq
250249112 gbhtg41.seq
250049188 gbhtg42.seq
250115526 gbhtg43.seq
250084462 gbhtg44.seq
250228478 gbhtg45.seq
250072341 gbhtg46.seq
250104718 gbhtg47.seq
250244180 gbhtg48.seq
250340540 gbhtg49.seq
250083748 gbhtg5.seq
250087316 gbhtg50.seq
250333884 gbhtg51.seq
250068930 gbhtg52.seq
250276394 gbhtg53.seq
250175248 gbhtg54.seq
250166523 gbhtg55.seq
250191030 gbhtg56.seq
250220659 gbhtg57.seq
250259075 gbhtg58.seq
250191509 gbhtg59.seq
250099103 gbhtg6.seq
250006918 gbhtg60.seq
250157462 gbhtg61.seq
250249380 gbhtg62.seq
250103348 gbhtg63.seq
250199431 gbhtg64.seq
250097685 gbhtg65.seq
250115902 gbhtg66.seq
250039126 gbhtg67.seq
250192321 gbhtg68.seq
250136056 gbhtg69.seq
250027749 gbhtg7.seq
250016830 gbhtg70.seq
250132956 gbhtg71.seq
250093200 gbhtg72.seq
250181746 gbhtg73.seq
250012968 gbhtg74.seq
250083231 gbhtg75.seq
250017896 gbhtg76.seq
250142063 gbhtg77.seq
250658269 gbhtg78.seq
250118074 gbhtg79.seq
250189742 gbhtg8.seq
250094755 gbhtg80.seq
105136607 gbhtg81.seq
250112662 gbhtg9.seq
250064665 gbinv1.seq
250040931 gbinv2.seq
250001279 gbinv3.seq
250001685 gbinv4.seq
250000527 gbinv5.seq
250018055 gbinv6.seq
250002531 gbinv7.seq
209954935 gbinv8.seq
371941508 gbjou.idx
203444419 gbkey.idx
250002712 gbmam1.seq
182961877 gbmam2.seq
32373306 gbnew.txt
250000447 gbpat1.seq
250001659 gbpat10.seq
250003940 gbpat11.seq
250002483 gbpat12.seq
250001200 gbpat13.seq
250001400 gbpat14.seq
250001833 gbpat15.seq
250000175 gbpat16.seq
250000526 gbpat17.seq
250072554 gbpat18.seq
250002181 gbpat19.seq
250000450 gbpat2.seq
170640156 gbpat20.seq
250002727 gbpat3.seq
250000024 gbpat4.seq
250000044 gbpat5.seq
250000908 gbpat6.seq
250000087 gbpat7.seq
250000352 gbpat8.seq
250001797 gbpat9.seq
47717434 gbphg.seq
250108923 gbpln1.seq
278637362 gbpln10.seq
250002620 gbpln11.seq
250000574 gbpln12.seq
250001923 gbpln13.seq
250035886 gbpln14.seq
250001855 gbpln15.seq
250001271 gbpln16.seq
198006629 gbpln17.seq
250045979 gbpln2.seq
251048544 gbpln3.seq
250004911 gbpln4.seq
250004952 gbpln5.seq
250007879 gbpln6.seq
250033535 gbpln7.seq
250000121 gbpln8.seq
276787184 gbpln9.seq
250037534 gbpri1.seq
250037301 gbpri10.seq
250127134 gbpri11.seq
250216187 gbpri12.seq
250007233 gbpri13.seq
250093523 gbpri14.seq
250159257 gbpri15.seq
250001873 gbpri16.seq
250004800 gbpri17.seq
250124544 gbpri18.seq
250027099 gbpri19.seq
250034133 gbpri2.seq
250009796 gbpri20.seq
250037630 gbpri21.seq
250002783 gbpri22.seq
250007967 gbpri23.seq
250005093 gbpri24.seq
250022675 gbpri25.seq
250000639 gbpri26.seq
250054742 gbpri27.seq
250001714 gbpri28.seq
250000959 gbpri29.seq
250097675 gbpri3.seq
73302474 gbpri30.seq
250032773 gbpri4.seq
250225271 gbpri5.seq
250022247 gbpri6.seq
250111548 gbpri7.seq
250203317 gbpri8.seq
250024145 gbpri9.seq
214597 gbrel.txt
250135428 gbrod1.seq
250015183 gbrod10.seq
250062558 gbrod11.seq
250094983 gbrod12.seq
250032134 gbrod13.seq
250024354 gbrod14.seq
250203427 gbrod15.seq
250195553 gbrod16.seq
250116107 gbrod17.seq
250065397 gbrod18.seq
250237380 gbrod19.seq
250203118 gbrod2.seq
250001817 gbrod20.seq
250008068 gbrod21.seq
250168390 gbrod22.seq
250000519 gbrod23.seq
37503583 gbrod24.seq
250241028 gbrod3.seq
250076298 gbrod4.seq
250086166 gbrod5.seq
250233243 gbrod6.seq
250143897 gbrod7.seq
250212311 gbrod8.seq
250207358 gbrod9.seq
4529700926 gbsdr.txt
1435247 gbsec.idx
250001732 gbsts1.seq
250000874 gbsts10.seq
250002855 gbsts11.seq
250004684 gbsts12.seq
250002047 gbsts13.seq
34705395 gbsts14.seq
250000785 gbsts2.seq
250001849 gbsts3.seq
250004394 gbsts4.seq
250002051 gbsts5.seq
250001790 gbsts6.seq
250003203 gbsts7.seq
250000095 gbsts8.seq
250001092 gbsts9.seq
114972332 gbsyn.seq
410741 gbuna.seq
250655176 gbvrl1.seq
250001163 gbvrl2.seq
250001099 gbvrl3.seq
250000494 gbvrl4.seq
244620260 gbvrl5.seq
250000403 gbvrt1.seq
239397904 gbvrt10.seq
250131231 gbvrt2.seq
250000701 gbvrt3.seq
250008996 gbvrt4.seq
250132824 gbvrt5.seq
250163094 gbvrt6.seq
250005246 gbvrt7.seq
250036492 gbvrt8.seq
250100905 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 25048 102563859
BCT10 58 114535366
BCT11 57 113963856
BCT12 442 113659622
BCT13 46661 91451288
BCT14 25374 69931200
BCT2 5149 107222510
BCT3 94 115815866
BCT4 27037 102982493
BCT5 34860 97371513
BCT6 35760 99621388
BCT7 33778 103515659
BCT8 6446 102062031
BCT9 2274 101203356
ENV1 95884 71210475
ENV2 88775 80581123
ENV3 45649 42041830
EST1 68132 26291928
EST10 76538 29845881
EST100 67362 34995566
EST101 71961 36340475
EST102 72131 38738644
EST103 73332 43275794
EST104 67243 44896815
EST105 74919 43884921
EST106 70004 28552465
EST107 70962 32147812
EST108 64488 34402291
EST109 66489 39157445
EST11 75115 28773787
EST110 72228 48022697
EST111 75805 28667543
EST112 74563 33895263
EST113 74640 26927761
EST114 73624 35568798
EST115 68061 35106102
EST116 74131 41966402
EST117 79408 44266172
EST118 73941 47729424
EST119 67667 41050691
EST12 77707 30806669
EST120 70056 46581782
EST121 72158 45494824
EST122 70727 44887202
EST123 75148 41642795
EST124 74756 46696455
EST125 73956 50523535
EST126 70604 48295382
EST127 80042 41712093
EST128 75549 27314849
EST129 80647 44119710
EST13 77115 29303866
EST130 76214 42520206
EST131 75253 45067577
EST132 63293 30954503
EST133 70519 38171510
EST134 67087 37482905
EST135 68276 38056119
EST136 71058 43052818
EST137 73207 47169585
EST138 66821 38349728
EST139 72722 41363980
EST14 78371 31708207
EST140 69056 39986867
EST141 61727 39023753
EST142 83138 45199189
EST143 99191 55667071
EST144 65469 34740604
EST145 98202 52114601
EST146 109529 58244069
EST147 100138 55780077
EST148 81250 48042941
EST149 90699 50687699
EST15 74900 31655954
EST150 96513 59766738
EST151 98395 58953645
EST152 76218 44064483
EST153 69400 37321847
EST154 65703 29770421
EST155 59727 27745857
EST156 56742 27647971
EST157 62595 31026733
EST158 59402 30673409
EST159 78072 56357264
EST16 75781 33320508
EST160 67656 37646987
EST161 74867 49631037
EST162 68600 38008803
EST163 61552 30494676
EST164 64287 40448850
EST165 65478 30369047
EST166 62973 46843872
EST167 71622 40176784
EST168 101492 45071980
EST169 88597 52849834
EST17 82651 34110495
EST170 99519 57681196
EST171 103893 55533474
EST172 95575 52279988
EST173 91014 38551710
EST174 93104 47159999
EST175 92604 41841178
EST176 91142 38258137
EST177 81478 39446344
EST178 65067 44508650
EST179 71202 38785871
EST18 81110 32193573
EST180 58834 41632928
EST181 69967 34135520
EST182 73523 26261663
EST183 72231 46456993
EST184 80335 40537445
EST185 64303 32277851
EST186 68467 41374693
EST187 68350 53418517
EST188 69049 37051360
EST189 67941 36962397
EST19 78261 31897065
EST190 70268 57263979
EST191 68404 38753214
EST192 72138 36633806
EST193 69875 55007288
EST194 68808 54251712
EST195 64648 47464712
EST196 64422 47333122
EST197 64968 47426713
EST198 65167 45421048
EST199 63733 47830528
EST2 74651 28648243
EST20 74829 30661150
EST200 63980 40874695
EST201 63454 34337413
EST202 64626 38506018
EST203 80240 41426569
EST204 84953 55900368
EST205 68038 41462687
EST206 97999 60759307
EST207 107452 66382146
EST208 109093 64029315
EST209 105782 65754047
EST21 73380 34163353
EST210 104047 65466016
EST211 109979 51089572
EST212 90971 54900127
EST213 98685 43748906
EST214 90074 48910255
EST215 69664 43975472
EST216 67040 48311635
EST217 68564 58362090
EST218 72611 54844120
EST219 78134 39526421
EST22 75945 30472331
EST220 79702 49112680
EST221 73332 52592828
EST222 72336 51265159
EST223 29080 11088965
EST224 27806 10595964
EST225 27315 10137340
EST226 26460 9655453
EST227 26673 9005616
EST228 27572 10068973
EST229 27199 9837007
EST23 77287 32571370
EST230 27217 9774183
EST231 27268 10756615
EST232 27133 11889469
EST233 27226 11141001
EST234 27377 9866857
EST235 27624 9263941
EST236 26896 9508302
EST237 27831 11232101
EST238 27658 10961363
EST239 26895 11333438
EST24 75042 33179426
EST240 26709 12050181
EST241 27086 11192615
EST242 27035 10848005
EST243 27028 11796050
EST244 27168 11527906
EST245 27269 10874959
EST246 27259 10868052
EST247 27149 10426117
EST248 26968 12103943
EST249 24409 17100607
EST25 73459 31451628
EST250 25929 17431108
EST251 56083 24630530
EST252 110300 42875958
EST253 71249 39559784
EST254 68674 44507876
EST255 69318 44651153
EST256 69091 44389809
EST257 65922 38870862
EST258 76426 44077039
EST259 64076 46619257
EST26 75811 31340732
EST260 65662 36159522
EST261 72467 36347434
EST262 102104 47076504
EST263 77744 43441375
EST264 68179 34949557
EST265 67064 32527858
EST266 70836 42301084
EST267 72756 34464548
EST268 68660 33472523
EST269 75159 48135660
EST27 75436 32932267
EST270 63774 33892016
EST271 68062 38787677
EST272 80464 41656757
EST273 76638 43114249
EST274 77222 50773393
EST275 77559 54817851
EST276 108792 48965419
EST277 86194 43278194
EST278 74531 44956464
EST279 73364 41323652
EST28 108311 51506748
EST280 71652 38014317
EST281 70127 27881537
EST282 71073 39467031
EST283 62117 34180666
EST284 63449 42458433
EST285 72039 41169816
EST286 61770 44365465
EST287 62111 32282344
EST288 83302 43012078
EST289 84025 41592498
EST29 97600 46601101
EST290 75900 49228070
EST291 104058 57483940
EST292 123330 46828272
EST293 76781 38043913
EST294 68338 35150736
EST295 69698 46596513
EST296 81283 40071740
EST297 71222 41729404
EST298 71593 40944435
EST299 60125 34302236
EST3 73739 29916860
EST30 96614 53485174
EST300 58796 36283902
EST301 59398 35573262
EST302 70577 48458319
EST303 71556 43930586
EST304 71694 41801478
EST305 73217 37520174
EST306 59194 30972928
EST307 53837 27434214
EST308 52768 28189906
EST309 53028 28341323
EST31 79737 43891072
EST310 51914 26950072
EST311 53901 26474976
EST312 55692 24420881
EST313 55279 23394272
EST314 54450 22358171
EST315 55559 21432459
EST316 54962 22072254
EST317 56160 22370017
EST318 54997 21408226
EST319 56192 20116714
EST32 66074 52678009
EST320 65180 35978466
EST321 76496 35139326
EST322 74438 33219549
EST323 77253 33032510
EST324 76830 33674742
EST325 92767 61430777
EST326 68807 53147595
EST327 81670 49671982
EST328 75139 38878092
EST329 67875 53836646
EST33 75726 53253025
EST330 64873 49669149
EST331 59727 43821693
EST332 62578 33150768
EST333 72135 47833506
EST334 58971 36579062
EST335 48852 24046387
EST336 68053 36231095
EST337 65623 35211092
EST338 61476 29848750
EST339 63581 41176016
EST34 86955 46496287
EST340 81546 45210572
EST341 72410 40606776
EST342 68582 41446002
EST343 71244 40766354
EST344 62250 42843522
EST345 85034 48581931
EST346 84530 49819937
EST347 81190 44694719
EST348 64058 35560417
EST349 67584 37398455
EST35 87134 44745971
EST350 73053 39960246
EST351 48001 24311584
EST352 62502 35707618
EST353 69924 42046123
EST354 97716 45713585
EST355 75668 44794940
EST356 74268 50014222
EST357 74654 48516201
EST358 63284 35022615
EST359 77673 36975772
EST36 93611 52312695
EST360 79559 38384034
EST361 56256 39672617
EST362 58908 38870477
EST363 62280 38171791
EST364 91872 52989625
EST365 86468 46222607
EST366 67344 44948551
EST367 78769 40300179
EST368 48075 30058309
EST369 44251 23123016
EST37 78259 57916366
EST370 76268 50689070
EST371 80330 39622288
EST372 78292 47408512
EST373 77279 46671646
EST374 81510 51615663
EST375 76886 45470965
EST376 67606 39395861
EST377 64477 40813277
EST378 69790 39287462
EST379 59077 35744520
EST38 92759 46217663
EST380 81322 24928289
EST381 79610 37710717
EST382 65596 39509284
EST383 69234 36337393
EST384 70783 40834880
EST385 77243 48701733
EST386 64729 42641959
EST387 64456 41250609
EST388 71942 40981144
EST389 66582 39307102
EST39 86370 45552733
EST390 66278 43371380
EST391 80596 49293935
EST392 87648 49148772
EST393 61770 39385218
EST394 58819 41196179
EST395 57357 40398787
EST396 57687 40914507
EST397 76952 46885616
EST398 55670 33042502
EST399 56937 36639334
EST4 74569 28389457
EST40 104450 48148188
EST400 64510 40558741
EST401 57212 40824639
EST402 61015 42708250
EST403 53502 38433672
EST404 57330 38782808
EST405 91036 39746356
EST406 69604 38531467
EST407 69786 38206178
EST408 69670 38782602
EST409 69650 38358088
EST41 84105 31653446
EST410 69515 38749462
EST411 69517 38538153
EST412 68854 38303643
EST413 68854 39194129
EST414 69025 38497429
EST415 67412 37990098
EST416 68815 37803657
EST417 69439 39417654
EST418 69138 38427354
EST419 69427 37847177
EST42 68746 18295987
EST420 69843 38066266
EST421 69883 38121139
EST422 69618 38558049
EST423 69740 38291259
EST424 70306 37222664
EST425 79654 36507559
EST426 59948 38796003
EST427 51989 40802809
EST428 71119 44204784
EST429 62732 37551533
EST43 69696 18819521
EST430 72527 43034236
EST431 116013 58603322
EST432 79790 48852494
EST433 82780 58621172
EST434 50989 28961733
EST435 46796 45121819
EST436 46399 58907470
EST437 75560 55156364
EST438 63327 38104735
EST439 72680 43754669
EST44 59270 18150426
EST440 67339 42114687
EST441 70150 43053008
EST442 61238 52556041
EST443 83766 43667160
EST444 109160 47921213
EST445 81632 45419218
EST446 59891 40167201
EST447 57455 41204330
EST448 58866 38974408
EST449 66262 51465979
EST45 43730 11951685
EST450 63100 45429284
EST451 59576 40593817
EST452 51724 38510531
EST453 57136 38944628
EST454 55486 41147133
EST455 69522 37643883
EST456 65822 44070412
EST457 57080 38150021
EST458 58943 41938813
EST459 58419 45744708
EST46 43262 11896032
EST460 59830 45730200
EST461 56094 40266961
EST462 57789 41491261
EST463 53508 35685700
EST464 57216 40826178
EST465 56198 35372174
EST466 74025 46338999
EST467 67962 57562383
EST468 69753 50939362
EST469 75979 49877893
EST47 43171 11415185
EST470 45740 59697613
EST471 55811 49041004
EST472 66587 48070717
EST473 60391 40596014
EST474 77771 44611870
EST475 83437 53525456
EST476 82618 52420552
EST477 68889 43179621
EST478 64176 42136404
EST479 78460 51378894
EST48 84569 35463867
EST480 81412 50662962
EST481 73626 62370770
EST482 72704 50555188
EST483 64606 45164793
EST484 67340 52683981
EST485 65996 47389046
EST486 77345 45866931
EST487 74730 39618747
EST488 116450 45748196
EST489 100015 47931585
EST49 96754 44043616
EST490 54897 49811213
EST491 59329 49720681
EST492 86406 32369104
EST493 86989 31705624
EST494 78627 41480594
EST495 91160 55906069
EST496 87156 48015851
EST497 67233 45015418
EST498 72440 47165740
EST499 80089 53343743
EST5 48198 15295521
EST50 88388 46629034
EST500 79669 50440640
EST501 73117 55877062
EST502 68993 50858426
EST503 79938 57809810
EST504 89213 45562550
EST505 76027 37520504
EST506 72190 25589661
EST507 72155 26957404
EST508 73423 26059981
EST509 72073 26206322
EST51 87985 39681682
EST510 77484 25968509
EST511 71865 28823305
EST512 74246 28207975
EST52 104621 54789242
EST53 96511 47866527
EST54 77094 33226702
EST55 67383 29507130
EST56 73268 32220402
EST57 69687 29274004
EST58 82102 33039440
EST59 74680 29996309
EST6 54924 17445206
EST60 68919 28073343
EST61 66359 29440526
EST62 76488 35654533
EST63 74300 32815070
EST64 74975 28474548
EST65 77736 28467602
EST66 81327 37588328
EST67 40543 11642401
EST68 40419 11040417
EST69 40411 12538201
EST7 74544 29357938
EST70 40785 12688258
EST71 40859 12314855
EST72 40723 12895763
EST73 40601 12788335
EST74 40463 12131498
EST75 40167 12113326
EST76 41024 12663881
EST77 41321 11894842
EST78 41033 13046171
EST79 40847 13071963
EST8 75853 30597153
EST80 42725 12723571
EST81 46237 18208739
EST82 42486 26634541
EST83 42443 18908368
EST84 48926 20149587
EST85 50736 21845109
EST86 50378 21723826
EST87 85021 48200436
EST88 74956 32359656
EST89 73999 29189562
EST9 77568 29867722
EST90 73099 31558454
EST91 76297 44947783
EST92 77406 40955239
EST93 76503 40268078
EST94 77906 38351081
EST95 69355 40269222
EST96 74671 34592225
EST97 74644 37973392
EST98 69823 36728500
EST99 77166 50449385
GSS1 90450 38672414
GSS10 74868 43580609
GSS100 75040 41505573
GSS101 74065 43940994
GSS102 73453 45484810
GSS103 73607 45093800
GSS104 73294 44986862
GSS105 73497 44233181
GSS106 78368 51175001
GSS107 85847 58036599
GSS108 81615 54018366
GSS109 82799 51659074
GSS11 70614 35934959
GSS110 86839 51527421
GSS111 78902 64941881
GSS112 85549 47792226
GSS113 93994 54122061
GSS114 77396 48432317
GSS115 84983 58523832
GSS116 86109 68057140
GSS117 74920 38065293
GSS118 80074 54211167
GSS119 94128 51186077
GSS12 72883 38307710
GSS120 87194 54960792
GSS121 85362 54154060
GSS122 85914 54003531
GSS123 76470 67021283
GSS124 76599 68728732
GSS125 79637 59684783
GSS126 78579 54484029
GSS127 78635 54751669
GSS128 79398 53613313
GSS129 78594 54844917
GSS13 76712 38973405
GSS130 79902 54809221
GSS131 84038 59922501
GSS132 77153 54523723
GSS133 65337 55107269
GSS134 77216 64287707
GSS135 76733 69334984
GSS136 77006 52588539
GSS137 82355 51702512
GSS138 94202 58287401
GSS139 93921 59083830
GSS14 71295 32119321
GSS140 85423 58212484
GSS141 92308 49712027
GSS142 5173 2748275
GSS143 86907 64480328
GSS144 83571 62758490
GSS145 101033 46826737
GSS146 69092 58683337
GSS147 68304 58730702
GSS148 69356 56597327
GSS149 69630 56065886
GSS15 70061 34758033
GSS150 70234 55461010
GSS151 85660 73328264
GSS152 85291 39624263
GSS153 74859 32005545
GSS154 98956 75494229
GSS155 88932 41487845
GSS156 92353 63519870
GSS157 79567 63918162
GSS158 70332 58965012
GSS159 68347 62997835
GSS16 78470 46274903
GSS160 62347 54818862
GSS161 116957 70551452
GSS162 119091 74784740
GSS163 115118 73225294
GSS164 87488 48633323
GSS165 89584 55045970
GSS166 103141 71614572
GSS167 108134 77718626
GSS168 106266 79824323
GSS169 105859 80262451
GSS17 70905 33300657
GSS170 104250 67400258
GSS171 77443 44255432
GSS172 100161 49447012
GSS173 93023 63048781
GSS174 97495 46215167
GSS18 59062 27942630
GSS19 56793 29072434
GSS2 88929 39303378
GSS20 57668 26711906
GSS21 61486 29052584
GSS22 64940 38235590
GSS23 57529 27080993
GSS24 66163 42022846
GSS25 68215 28292021
GSS26 58177 25353626
GSS27 65303 31935015
GSS28 65533 32578450
GSS29 77221 39668357
GSS3 87388 41802586
GSS30 82956 39747846
GSS31 74190 40412543
GSS32 70581 48296646
GSS33 79812 37829763
GSS34 75889 40321727
GSS35 74119 40023146
GSS36 87371 56186685
GSS37 87598 58173505
GSS38 85546 44954893
GSS39 86859 50480576
GSS4 78882 41011199
GSS40 86286 39992538
GSS41 83183 31914607
GSS42 81247 56933168
GSS43 80139 58088355
GSS44 72025 47501834
GSS45 72037 47427902
GSS46 77683 45767671
GSS47 77859 38710101
GSS48 83238 58019902
GSS49 86699 64885609
GSS5 78791 40543412
GSS50 81905 54530046
GSS51 93846 59323892
GSS52 88566 58839736
GSS53 76495 42040692
GSS54 72975 40715765
GSS55 86447 46914768
GSS56 88282 58743978
GSS57 77260 65343087
GSS58 72013 79256426
GSS59 87088 69155367
GSS6 78148 38870302
GSS60 88519 59194207
GSS61 63443 45087309
GSS62 67685 46497227
GSS63 89660 67262449
GSS64 86159 58504701
GSS65 87569 54085328
GSS66 87649 56899105
GSS67 96392 58038644
GSS68 100550 54608335
GSS69 100637 54498232
GSS7 77728 39127765
GSS70 101405 53525007
GSS71 102362 52309686
GSS72 102466 52176833
GSS73 102688 51896518
GSS74 102076 52672367
GSS75 99000 56594325
GSS76 90231 69508092
GSS77 89827 70789823
GSS78 88177 69653521
GSS79 87827 69672500
GSS8 75724 38101435
GSS80 89383 63298775
GSS81 81589 26773168
GSS82 77838 24394043
GSS83 86630 35650083
GSS84 83481 48688583
GSS85 80986 48628680
GSS86 89558 63965827
GSS87 79582 61472545
GSS88 77636 79505010
GSS89 76510 57552274
GSS9 72106 37147821
GSS90 94797 50856064
GSS91 76896 42540177
GSS92 85032 48135021
GSS93 69586 63061248
GSS94 85696 50678914
GSS95 82388 60880044
GSS96 85200 56397181
GSS97 83188 57492514
GSS98 89951 53401297
GSS99 81258 68947776
HTC1 37149 54051784
HTC10 17865 32148327
HTC2 28558 64620954
HTC3 18492 42904958
HTC4 16114 39711689
HTC5 36448 32065315
HTC6 66355 56796071
HTC7 81641 68040984
HTC8 67518 60483257
HTC9 66857 82232592
HTG1 1315 188873586
HTG10 1242 186650227
HTG11 1431 184179327
HTG12 875 192064218
HTG13 750 192455777
HTG14 743 192298142
HTG15 781 192247981
HTG16 801 192186063
HTG17 766 192211152
HTG18 2043 171412466
HTG19 1056 188034536
HTG2 2563 186100623
HTG20 1000 189113368
HTG21 777 191991068
HTG22 926 190448250
HTG23 881 190926221
HTG24 828 191314624
HTG25 778 192125208
HTG26 846 191441567
HTG27 875 191108339
HTG28 958 189974782
HTG29 909 191026747
HTG3 2458 185319770
HTG30 924 190516800
HTG31 871 191439622
HTG32 972 189715284
HTG33 869 191203452
HTG34 856 191489179
HTG35 826 191877984
HTG36 883 191124325
HTG37 975 190065348
HTG38 950 190186224
HTG39 1009 189737123
HTG4 2519 188482648
HTG40 1190 187025697
HTG41 1216 188329039
HTG42 1216 188408474
HTG43 1168 186813826
HTG44 1100 191471422
HTG45 1216 191049857
HTG46 1249 190935240
HTG47 1135 191153168
HTG48 1040 191342649
HTG49 994 190223211
HTG5 1281 185650087
HTG50 1017 189460694
HTG51 986 190025758
HTG52 971 189624783
HTG53 1021 189815803
HTG54 984 189799145
HTG55 941 189154238
HTG56 930 189150491
HTG57 1113 188450224
HTG58 1003 189822039
HTG59 1029 187970436
HTG6 1273 185296258
HTG60 1100 187148633
HTG61 1053 188743415
HTG62 1032 189394811
HTG63 977 189107320
HTG64 1080 188590335
HTG65 1093 189255339
HTG66 1288 185359914
HTG67 1248 185575888
HTG68 1245 184624665
HTG69 1269 184637994
HTG7 1247 185472319
HTG70 1250 184724120
HTG71 1423 187755902
HTG72 1210 188536290
HTG73 1326 190031789
HTG74 1119 191316785
HTG75 1471 190062833
HTG76 1147 191226777
HTG77 1030 194139555
HTG78 1013 194690830
HTG79 911 181669135
HTG8 1287 185088399
HTG80 1167 193549679
HTG81 425 72724644
HTG9 1182 187153099
INV1 18589 159640493
INV2 1663 167763273
INV3 31034 118373115
INV4 80216 73998651
INV5 73119 73777025
INV6 67871 81973691
INV7 42977 108435977
INV8 46263 77382622
MAM1 50524 117877792
MAM2 44416 68006202
PAT1 222658 70174534
PAT10 141419 66377245
PAT11 108043 59111635
PAT12 104148 50126401
PAT13 143949 59030506
PAT14 153731 63207915
PAT15 113310 111971957
PAT16 135056 97897345
PAT17 111147 110006422
PAT18 133310 98348829
PAT19 109743 85242714
PAT2 194352 84724710
PAT20 116933 43404454
PAT3 172019 95884211
PAT4 153764 106049454
PAT5 160417 94241252
PAT6 149904 83291795
PAT7 106122 117785797
PAT8 145606 88613824
PAT9 126035 99775181
PHG 2983 19312487
PLN1 38878 116564385
PLN10 8 219884424
PLN11 38666 92362947
PLN12 74543 75342196
PLN13 76667 78688295
PLN14 55794 100602519
PLN15 35914 115966275
PLN16 49239 108562256
PLN17 36800 77371749
PLN2 1362 175094890
PLN3 2285 172053348
PLN4 69445 84961199
PLN5 74066 74125837
PLN6 30706 51851890
PLN7 11536 143299858
PLN8 1340 169669883
PLN9 448 201222619
PRI1 26761 125708376
PRI10 1449 182969149
PRI11 1282 179580593
PRI12 1531 177910610
PRI13 1596 179822119
PRI14 1558 183935603
PRI15 1226 192462039
PRI16 37452 129043891
PRI17 39951 83964844
PRI18 6205 172595206
PRI19 1655 184035289
PRI2 1561 172070707
PRI20 1808 183126764
PRI21 2977 180701978
PRI22 1334 183675641
PRI23 42327 109333303
PRI24 44240 72509594
PRI25 19487 124466622
PRI26 13131 165403989
PRI27 20266 154268182
PRI28 52093 114839589
PRI29 41903 122390043
PRI3 1310 186528867
PRI30 19741 26119917
PRI4 1310 183371515
PRI5 1191 181679460
PRI6 1208 178893695
PRI7 1229 181261074
PRI8 1358 174849086
PRI9 1210 175367676
ROD1 10261 167926123
ROD10 974 182231417
ROD11 1024 186826022
ROD12 969 183566938
ROD13 1017 186198234
ROD14 950 181245774
ROD15 963 182626599
ROD16 1054 186572876
ROD17 27928 143984023
ROD18 1162 190106690
ROD19 1213 193397925
ROD2 926 174045165
ROD20 4680 188238032
ROD21 43384 72606599
ROD22 13572 145805429
ROD23 38222 131418170
ROD24 9492 13641019
ROD3 904 173935314
ROD4 904 174048703
ROD5 928 173942945
ROD6 986 181467270
ROD7 970 179851482
ROD8 986 181596857
ROD9 1017 183467409
STS1 82037 35179831
STS10 58190 44487674
STS11 58023 43668346
STS12 74404 38649976
STS13 86885 38425370
STS14 15519 6078579
STS2 84081 44778319
STS3 76406 30850596
STS4 66887 33912765
STS5 54867 31983204
STS6 54730 32220183
STS7 54692 32192487
STS8 56387 38731734
STS9 58081 44560257
SYN 25918 37525798
UNA 207 112010
VRL1 72484 65894663
VRL2 72132 64894856
VRL3 69359 71005564
VRL4 66593 68788298
VRL5 71944 65867701
VRT1 41042 130913679
VRT10 48804 109174121
VRT2 37035 134204314
VRT3 52441 112434842
VRT4 59253 66328878
VRT5 12310 149682380
VRT6 1264 193151148
VRT7 1300 193056756
VRT8 14346 172980674
VRT9 13340 173821243
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 153.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
10232501 12158283745 Homo sapiens
6664504 8007185287 Mus musculus
1187583 5739315425 Rattus norvegicus
1560656 3441974419 Bos taurus
1049852 2414934924 Danio rerio
2740457 1904398496 Zea mays
1141026 1520160814 Oryza sativa (japonica cultivar-group)
215354 1244633980 Strongylocentrotus purpuratus
1179258 961507939 Xenopus tropicalis
1181222 903465758 Sus scrofa
1419254 827798107 Canis familiaris
536101 794653782 Drosophila melanogaster
1185506 739874683 Arabidopsis thaliana
787971 692393649 Gallus gallus
208532 611609739 Pan troglodytes
788133 466272907 Sorghum bicolor
397119 448061181 Medicago truncatula
69024 437325339 Macaca mulatta
696009 420715351 Ciona intestinalis
596267 406383159 Brassica oleracea
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 April 2006
NCBI-GenBank Flat File Release 153.0
Bacterial Sequences (Part 1)
37811 loci, 97585608 bases, from 37811 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
bits-request@ncbi.nlm.nih.gov
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to
indicate the GenBank release number (e.g., Release 153.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Irene Fang, Linda Frisse, Michael Fetchko, Andrea Gocke, Amelie Gubitz
Anjanette Johnston, Kellie Kelm, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
