Release Notes For GenBank Release 153

GBREL.TXT          Genetic Sequence Data Bank
                         April 15 2006

               NCBI-GenBank Flat File Release 153.0

                    Distribution Release Notes

 56620500 loci, 61582143971 bases, from 56620500 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource from which those other
efforts draw. For information about TPA and RefSeq, please refer to:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 153.0
1.2 Cutoff Date
1.3 Important Changes in Release 153.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 153.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 153.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.

1.2 Cutoff Date

  This full release, 153.0, incorporates data available to the collaborating
databases as of April 11, 2006 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 153.0

1.3.1 Changes in the content of index files

  The 'index' files which accompany GenBank releases (see Section 3.3) are
considered to be a legacy data product by NCBI, generated mostly for
historical reasons. FTP statistics since January 2005 seem to support this:
the index files are transferred only half as frequently as the files of
sequence records. The inherent inefficiencies of the index file format also
leads us to suspect that they have little serious use by the user community,
particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI. GenBank 153.0 thus contains these ten index
files:

	gbaut1.idx
	gbaut2.idx
	gbaut3.idx
	gbaut4.idx
	gbaut5.idx
	gbaut6.idx
	gbgen.idx
	gbjou.idx
	gbkey.idx
	gbsec.idx

  In addition, a version of gbacc.idx which encompasses the entirety of the
release was built manually, but note that the first field contains just an
accession number, rather than Accession.Version. We hope to have this last
discrepancy resolved by the June release.

  This current solution is likely to be only a stop-gap, and we will probably
pursue one of two options within the next year:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types index data.

  If you are a user of the 'index' files associated with GenBank files, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.2 Organizational changes

  The total number of sequence data files increased by 32 with this release:

  - the BCT division is now comprised of  14 files (+1)
  - the EST division is now comprised of 512 files (+25)
  - the GSS division is now comprised of 174 files (+2)
  - the HTG division is now comprised of  81 files (+2)
  - the PRI division is now comprised of  30 files (+1)
  - the ROD division is now comprised of  24 files (+1)

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
thirty-two of the GSS flatfiles in Release 153.0. Consider gbgss143.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                           April 15 2006

                NCBI-GenBank Flat File Release 153.0

                           GSS Sequences (Part 1)

   86907 loci,    64480328 bases, from    86907 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "143" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New JOURNAL token for Pre-Grant Patent Publications

  Sequences associated with granted patents from the US Patent and
Trademark Office (USPTO) typically have references that look like this:

  REFERENCE   1  (bases 1 to 22)
    AUTHORS   Stewart,L.J.
    TITLE     Screening methods for identifying ligands
    JOURNAL   Patent: US 6950757-A 2 27-SEP-2005;

The "Patent:" token indicates that the JOURNAL line pertains to a
patent document, as opposed to a published article in the scientific 
literature.

But sequence data can be available well in advance of the point at which
an actual patent has been granted. As of GenBank Release 153 in June 2006,
we will indicate that a patent sequence is associated with a "Pre-Grant
Publication" via a slight change to the JOURNAL line:

  REFERENCE   1  (bases 1 to 190)
    AUTHORS   Xu,M. and Humphreys,R.
      TITLE   Inhibition of li expression in mammalian cells
     JOURNAL  Pre-Grant Patent: US 20060008448A1 1 12-JAN-2006;
              ^^^^^^^^^^^^^^^^^

The introduction of "Pre-Grant Patent:" at the start of the JOURNAL
line will distinguish sequences associated with these two different
states in USPTO's patenting process.

Note that pre-grant identifiers from the USPTO are alphanumeric, and
lack a document-type suffix ("-A" in the granted-patent example above).

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 944 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut2.idx - Index of the entries according to accession number, part 2.
4. gbaut3.idx - Index of the entries according to accession number, part 3.
5. gbaut4.idx - Index of the entries according to accession number, part 4.
6. gbaut5.idx - Index of the entries according to accession number, part 5.
7. gbaut6.idx - Index of the entries according to accession number, part 6.
8. gbbct1.seq - Bacterial sequence entries, part 1.
9. gbbct10.seq - Bacterial sequence entries, part 10.
10. gbbct11.seq - Bacterial sequence entries, part 11.
11. gbbct12.seq - Bacterial sequence entries, part 12.
12. gbbct13.seq - Bacterial sequence entries, part 13.
13. gbbct14.seq - Bacterial sequence entries, part 14.
14. gbbct2.seq - Bacterial sequence entries, part 2.
15. gbbct3.seq - Bacterial sequence entries, part 3.
16. gbbct4.seq - Bacterial sequence entries, part 4.
17. gbbct5.seq - Bacterial sequence entries, part 5.
18. gbbct6.seq - Bacterial sequence entries, part 6.
19. gbbct7.seq - Bacterial sequence entries, part 7.
20. gbbct8.seq - Bacterial sequence entries, part 8.
21. gbbct9.seq - Bacterial sequence entries, part 9.
22. gbchg.txt - Accession numbers of entries updated since the previous release.
23. gbcon.seq - Constructed sequence entries.
24. gbdel.txt - Accession numbers of entries deleted since the previous release.
25. gbenv1.seq - Environmental sampling sequence entries, part 1.
26. gbenv2.seq - Environmental sampling sequence entries, part 2.
27. gbenv3.seq - Environmental sampling sequence entries, part 3.
28. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
29. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
30. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
31. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
32. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
33. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
34. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
35. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
36. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
37. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
38. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
39. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
40. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
41. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
42. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
43. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
44. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
45. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
46. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
47. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
48. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
49. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
50. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
51. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
52. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
53. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
54. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
55. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
56. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
57. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
58. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
59. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
60. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
61. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
62. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
63. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
64. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
65. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
66. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
67. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
68. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
69. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
70. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
71. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
72. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
73. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
74. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
75. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
76. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
77. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
78. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
79. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
80. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
81. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
82. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
83. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
84. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
85. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
86. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
87. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
88. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
89. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
90. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
91. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
92. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
93. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
94. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
95. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
96. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
97. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
98. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
99. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
100. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
101. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
102. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
103. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
104. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
105. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
106. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
107. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
108. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
109. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
110. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
111. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
112. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
113. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
114. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
115. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
116. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
117. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
118. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
119. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
120. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
121. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
122. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
123. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
124. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
125. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
126. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
127. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
128. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
129. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
130. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
131. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
132. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
133. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
134. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
135. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
136. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
137. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
138. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
139. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
140. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
141. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
142. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
143. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
144. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
145. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
146. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
147. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
148. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
149. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
150. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
151. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
152. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
153. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
154. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
155. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
156. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
157. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
158. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
159. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
160. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
161. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
162. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
163. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
164. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
165. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
166. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
167. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
168. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
169. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
170. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
171. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
172. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
173. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
174. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
175. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
176. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
177. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
178. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
179. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
180. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
181. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
182. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
183. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
184. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
185. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
186. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
187. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
188. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
189. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
190. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
191. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
192. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
193. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
194. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
195. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
196. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
197. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
198. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
199. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
200. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
201. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
202. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
203. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
204. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
205. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
206. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
207. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
208. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
209. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
210. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
211. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
212. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
213. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
214. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
215. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
216. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
217. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
218. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
219. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
220. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
221. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
222. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
223. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
224. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
225. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
226. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
227. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
228. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
229. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
230. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
231. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
232. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
233. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
234. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
235. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
236. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
237. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
238. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
239. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
240. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
241. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
242. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
243. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
244. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
245. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
246. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
247. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
248. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
249. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
250. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
251. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
252. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
253. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
254. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
255. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
256. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
257. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
258. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
259. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
260. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
261. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
262. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
263. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
264. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
265. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
266. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
267. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
268. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
269. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
270. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
271. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
272. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
273. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
274. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
275. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
276. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
277. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
278. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
279. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
280. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
281. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
282. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
283. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
284. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
285. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
286. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
287. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
288. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
289. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
290. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
291. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
292. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
293. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
294. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
295. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
296. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
297. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
298. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
299. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
300. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
301. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
302. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
303. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
304. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
305. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
306. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
307. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
308. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
309. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
310. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
311. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
312. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
313. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
314. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
315. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
316. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
317. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
318. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
319. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
320. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
321. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
322. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
323. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
324. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
325. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
326. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
327. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
328. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
329. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
330. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
331. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
332. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
333. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
334. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
335. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
336. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
337. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
338. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
339. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
340. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
341. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
342. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
343. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
344. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
345. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
346. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
347. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
348. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
349. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
350. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
351. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
352. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
353. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
354. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
355. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
356. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
357. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
358. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
359. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
360. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
361. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
362. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
363. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
364. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
365. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
366. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
367. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
368. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
369. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
370. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
371. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
372. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
373. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
374. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
375. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
376. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
377. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
378. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
379. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
380. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
381. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
382. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
383. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
384. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
385. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
386. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
387. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
388. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
389. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
390. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
391. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
392. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
393. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
394. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
395. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
396. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
397. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
398. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
399. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
400. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
401. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
402. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
403. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
404. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
405. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
406. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
407. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
408. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
409. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
410. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
411. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
412. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
413. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
414. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
415. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
416. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
417. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
418. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
419. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
420. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
421. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
422. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
423. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
424. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
425. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
426. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
427. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
428. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
429. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
430. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
431. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
432. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
433. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
434. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
435. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
436. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
437. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
438. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
439. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
440. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
441. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
442. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
443. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
444. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
445. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
446. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
447. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
448. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
449. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
450. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
451. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
452. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
453. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
454. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
455. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
456. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
457. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
458. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
459. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
460. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
461. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
462. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
463. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
464. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
465. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
466. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
467. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
468. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
469. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
470. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
471. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
472. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
473. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
474. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
475. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
476. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
477. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
478. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
479. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
480. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
481. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
482. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
483. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
484. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
485. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
486. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
487. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
488. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
489. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
490. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
491. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
492. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
493. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
494. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
495. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
496. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
497. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
498. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
499. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
500. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
501. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
502. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
503. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
504. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
505. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
506. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
507. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
508. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
509. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
510. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
511. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
512. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
513. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
514. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
515. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
516. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
517. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
518. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
519. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
520. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
521. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
522. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
523. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
524. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
525. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
526. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
527. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
528. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
529. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
530. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
531. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
532. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
533. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
534. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
535. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
536. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
537. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
538. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
539. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
540. gbgen.idx - Index of the entries according to gene symbols.
541. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
542. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
543. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
544. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
545. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
546. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
547. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
548. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
549. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
550. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
551. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
552. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
553. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
554. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
555. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
556. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
557. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
558. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
559. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
560. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
561. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
562. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
563. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
564. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
565. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
566. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
567. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
568. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
569. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
570. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
571. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
572. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
573. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
574. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
575. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
576. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
577. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
578. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
579. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
580. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
581. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
582. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
583. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
584. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
585. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
586. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
587. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
588. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
589. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
590. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
591. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
592. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
593. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
594. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
595. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
596. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
597. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
598. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
599. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
600. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
601. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
602. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
603. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
604. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
605. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
606. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
607. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
608. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
609. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
610. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
611. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
612. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
613. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
614. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
615. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
616. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
617. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
618. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
619. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
620. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
621. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
622. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
623. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
624. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
625. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
626. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
627. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
628. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
629. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
630. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
631. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
632. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
633. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
634. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
635. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
636. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
637. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
638. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
639. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
640. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
641. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
642. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
643. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
644. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
645. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
646. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
647. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
648. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
649. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
650. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
651. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
652. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
653. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
654. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
655. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
656. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
657. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
658. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
659. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
660. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
661. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
662. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
663. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
664. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
665. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
666. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
667. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
668. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
669. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
670. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
671. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
672. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
673. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
674. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
675. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
676. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
677. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
678. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
679. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
680. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
681. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
682. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
683. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
684. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
685. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
686. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
687. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
688. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
689. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
690. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
691. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
692. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
693. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
694. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
695. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
696. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
697. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
698. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
699. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
700. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
701. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
702. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
703. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
704. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
705. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
706. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
707. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
708. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
709. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
710. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
711. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
712. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
713. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
714. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
715. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
716. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
717. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
718. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
719. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
720. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
721. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
722. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
723. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
724. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
725. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
726. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
727. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
728. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
729. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
730. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
731. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
732. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
733. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
734. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
735. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
736. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
737. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
738. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
739. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
740. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
741. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
742. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
743. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
744. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
745. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
746. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
747. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
748. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
749. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
750. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
751. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
752. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
753. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
754. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
755. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
756. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
757. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
758. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
759. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
760. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
761. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
762. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
763. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
764. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
765. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
766. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
767. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
768. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
769. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
770. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
771. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
772. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
773. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
774. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
775. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
776. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
777. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
778. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
779. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
780. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
781. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
782. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
783. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
784. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
785. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
786. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
787. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
788. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
789. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
790. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
791. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
792. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
793. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
794. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
795. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
796. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
797. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
798. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
799. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
800. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
801. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
802. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
803. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
804. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
805. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
806. gbinv1.seq - Invertebrate sequence entries, part 1.
807. gbinv2.seq - Invertebrate sequence entries, part 2.
808. gbinv3.seq - Invertebrate sequence entries, part 3.
809. gbinv4.seq - Invertebrate sequence entries, part 4.
810. gbinv5.seq - Invertebrate sequence entries, part 5.
811. gbinv6.seq - Invertebrate sequence entries, part 6.
812. gbinv7.seq - Invertebrate sequence entries, part 7.
813. gbinv8.seq - Invertebrate sequence entries, part 8.
814. gbjou.idx - Index of the entries according to journal citation.
815. gbkey.idx - Index of the entries according to keyword phrase.
816. gbmam1.seq - Other mammalian sequence entries, part 1.
817. gbmam2.seq - Other mammalian sequence entries, part 2.
818. gbnew.txt - Accession numbers of entries new since the previous release.
819. gbpat1.seq - Patent sequence entries, part 1.
820. gbpat10.seq - Patent sequence entries, part 10.
821. gbpat11.seq - Patent sequence entries, part 11.
822. gbpat12.seq - Patent sequence entries, part 12.
823. gbpat13.seq - Patent sequence entries, part 13.
824. gbpat14.seq - Patent sequence entries, part 14.
825. gbpat15.seq - Patent sequence entries, part 15.
826. gbpat16.seq - Patent sequence entries, part 16.
827. gbpat17.seq - Patent sequence entries, part 17.
828. gbpat18.seq - Patent sequence entries, part 18.
829. gbpat19.seq - Patent sequence entries, part 19.
830. gbpat2.seq - Patent sequence entries, part 2.
831. gbpat20.seq - Patent sequence entries, part 20.
832. gbpat3.seq - Patent sequence entries, part 3.
833. gbpat4.seq - Patent sequence entries, part 4.
834. gbpat5.seq - Patent sequence entries, part 5.
835. gbpat6.seq - Patent sequence entries, part 6.
836. gbpat7.seq - Patent sequence entries, part 7.
837. gbpat8.seq - Patent sequence entries, part 8.
838. gbpat9.seq - Patent sequence entries, part 9.
839. gbphg.seq - Phage sequence entries.
840. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
841. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
842. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
843. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
844. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
845. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
846. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
847. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
848. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
849. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
850. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
851. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
852. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
853. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
854. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
855. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
856. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
857. gbpri1.seq - Primate sequence entries, part 1.
858. gbpri10.seq - Primate sequence entries, part 10.
859. gbpri11.seq - Primate sequence entries, part 11.
860. gbpri12.seq - Primate sequence entries, part 12.
861. gbpri13.seq - Primate sequence entries, part 13.
862. gbpri14.seq - Primate sequence entries, part 14.
863. gbpri15.seq - Primate sequence entries, part 15.
864. gbpri16.seq - Primate sequence entries, part 16.
865. gbpri17.seq - Primate sequence entries, part 17.
866. gbpri18.seq - Primate sequence entries, part 18.
867. gbpri19.seq - Primate sequence entries, part 19.
868. gbpri2.seq - Primate sequence entries, part 2.
869. gbpri20.seq - Primate sequence entries, part 20.
870. gbpri21.seq - Primate sequence entries, part 21.
871. gbpri22.seq - Primate sequence entries, part 22.
872. gbpri23.seq - Primate sequence entries, part 23.
873. gbpri24.seq - Primate sequence entries, part 24.
874. gbpri25.seq - Primate sequence entries, part 25.
875. gbpri26.seq - Primate sequence entries, part 26.
876. gbpri27.seq - Primate sequence entries, part 27.
877. gbpri28.seq - Primate sequence entries, part 28.
878. gbpri29.seq - Primate sequence entries, part 29.
879. gbpri3.seq - Primate sequence entries, part 3.
880. gbpri30.seq - Primate sequence entries, part 30.
881. gbpri4.seq - Primate sequence entries, part 4.
882. gbpri5.seq - Primate sequence entries, part 5.
883. gbpri6.seq - Primate sequence entries, part 6.
884. gbpri7.seq - Primate sequence entries, part 7.
885. gbpri8.seq - Primate sequence entries, part 8.
886. gbpri9.seq - Primate sequence entries, part 9.
887. gbrel.txt - Release notes (this document).
888. gbrod1.seq - Rodent sequence entries, part 1.
889. gbrod10.seq - Rodent sequence entries, part 10.
890. gbrod11.seq - Rodent sequence entries, part 11.
891. gbrod12.seq - Rodent sequence entries, part 12.
892. gbrod13.seq - Rodent sequence entries, part 13.
893. gbrod14.seq - Rodent sequence entries, part 14.
894. gbrod15.seq - Rodent sequence entries, part 15.
895. gbrod16.seq - Rodent sequence entries, part 16.
896. gbrod17.seq - Rodent sequence entries, part 17.
897. gbrod18.seq - Rodent sequence entries, part 18.
898. gbrod19.seq - Rodent sequence entries, part 19.
899. gbrod2.seq - Rodent sequence entries, part 2.
900. gbrod20.seq - Rodent sequence entries, part 20.
901. gbrod21.seq - Rodent sequence entries, part 21.
902. gbrod22.seq - Rodent sequence entries, part 22.
903. gbrod23.seq - Rodent sequence entries, part 23.
904. gbrod24.seq - Rodent sequence entries, part 24.
905. gbrod3.seq - Rodent sequence entries, part 3.
906. gbrod4.seq - Rodent sequence entries, part 4.
907. gbrod5.seq - Rodent sequence entries, part 5.
908. gbrod6.seq - Rodent sequence entries, part 6.
909. gbrod7.seq - Rodent sequence entries, part 7.
910. gbrod8.seq - Rodent sequence entries, part 8.
911. gbrod9.seq - Rodent sequence entries, part 9.
912. gbsdr.txt - Short directory of the data bank.
913. gbsec.idx - Index of the entries according to secondary accession number.
914. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
915. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
916. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
917. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
918. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
919. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
920. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
921. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
922. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
923. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
924. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
925. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
926. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
927. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
928. gbsyn.seq - Synthetic and chimeric sequence entries.
929. gbuna.seq - Unannotated sequence entries.
930. gbvrl1.seq - Viral sequence entries, part 1.
931. gbvrl2.seq - Viral sequence entries, part 2.
932. gbvrl3.seq - Viral sequence entries, part 3.
933. gbvrl4.seq - Viral sequence entries, part 4.
934. gbvrl5.seq - Viral sequence entries, part 5.
935. gbvrt1.seq - Other vertebrate sequence entries, part 1.
936. gbvrt10.seq - Other vertebrate sequence entries, part 10.
937. gbvrt2.seq - Other vertebrate sequence entries, part 2.
938. gbvrt3.seq - Other vertebrate sequence entries, part 3.
939. gbvrt4.seq - Other vertebrate sequence entries, part 4.
940. gbvrt5.seq - Other vertebrate sequence entries, part 5.
941. gbvrt6.seq - Other vertebrate sequence entries, part 6.
942. gbvrt7.seq - Other vertebrate sequence entries, part 7.
943. gbvrt8.seq - Other vertebrate sequence entries, part 8.
944. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 153.0 flatfiles require roughly 215 GB (sequence
files only) or 224 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1747858059     gbacc.idx
 500926801     gbaut1.idx
 500109516     gbaut2.idx
 500058372     gbaut3.idx
 500502837     gbaut4.idx
 500056882     gbaut5.idx
 267886592     gbaut6.idx
 250005701     gbbct1.seq
 252875878     gbbct10.seq
 256592994     gbbct11.seq
 253795540     gbbct12.seq
 250002352     gbbct13.seq
 192742689     gbbct14.seq
 250045941     gbbct2.seq
 258913272     gbbct3.seq
 250039938     gbbct4.seq
 258514676     gbbct5.seq
 250000557     gbbct6.seq
 257109012     gbbct7.seq
 250757122     gbbct8.seq
 251952277     gbbct9.seq
   7909779     gbchg.txt
1264481053     gbcon.seq
    128546     gbdel.txt
 250000429     gbenv1.seq
 250000087     gbenv2.seq
 125971283     gbenv3.seq
 230688413     gbest1.seq
 230689410     gbest10.seq
 230690830     gbest100.seq
 230689645     gbest101.seq
 230687526     gbest102.seq
 230688014     gbest103.seq
 230689733     gbest104.seq
 230688860     gbest105.seq
 230687499     gbest106.seq
 230689931     gbest107.seq
 230690581     gbest108.seq
 230687999     gbest109.seq
 230688482     gbest11.seq
 230688047     gbest110.seq
 230689539     gbest111.seq
 230688738     gbest112.seq
 230482191     gbest113.seq
 230689154     gbest114.seq
 230689328     gbest115.seq
 230689823     gbest116.seq
 230688298     gbest117.seq
 230688948     gbest118.seq
 230689331     gbest119.seq
 230688289     gbest12.seq
 230689913     gbest120.seq
 230688022     gbest121.seq
 230690553     gbest122.seq
 230688076     gbest123.seq
 230687643     gbest124.seq
 230689741     gbest125.seq
 230688561     gbest126.seq
 230688027     gbest127.seq
 230688309     gbest128.seq
 230687451     gbest129.seq
 230688229     gbest13.seq
 230687507     gbest130.seq
 230687701     gbest131.seq
 230689510     gbest132.seq
 230690492     gbest133.seq
 230687480     gbest134.seq
 230688340     gbest135.seq
 230687710     gbest136.seq
 230690124     gbest137.seq
 230690864     gbest138.seq
 230688406     gbest139.seq
 230689885     gbest14.seq
 230689511     gbest140.seq
 230689106     gbest141.seq
 230689060     gbest142.seq
 230688233     gbest143.seq
 230689748     gbest144.seq
 230688389     gbest145.seq
 230687782     gbest146.seq
 230687726     gbest147.seq
 230688638     gbest148.seq
 230689544     gbest149.seq
 230687647     gbest15.seq
 230689475     gbest150.seq
 230687514     gbest151.seq
 230690925     gbest152.seq
 230691390     gbest153.seq
 230689005     gbest154.seq
 230687926     gbest155.seq
 230687744     gbest156.seq
 230688949     gbest157.seq
 230689175     gbest158.seq
 230689984     gbest159.seq
 230687804     gbest16.seq
 230689544     gbest160.seq
 230687471     gbest161.seq
 230689093     gbest162.seq
 230688378     gbest163.seq
 230689084     gbest164.seq
 230688112     gbest165.seq
 230689970     gbest166.seq
 230688310     gbest167.seq
 230688923     gbest168.seq
 230687782     gbest169.seq
 230687861     gbest17.seq
 230688650     gbest170.seq
 230689363     gbest171.seq
 230688607     gbest172.seq
 227565550     gbest173.seq
 230688523     gbest174.seq
 230687637     gbest175.seq
 230688889     gbest176.seq
 230688680     gbest177.seq
 230689734     gbest178.seq
 230688365     gbest179.seq
 230690349     gbest18.seq
 230689540     gbest180.seq
 230687949     gbest181.seq
 228524454     gbest182.seq
 230687571     gbest183.seq
 230687785     gbest184.seq
 230688545     gbest185.seq
 230688084     gbest186.seq
 230689291     gbest187.seq
 230689703     gbest188.seq
 230687626     gbest189.seq
 230688584     gbest19.seq
 230688956     gbest190.seq
 230689266     gbest191.seq
 230687804     gbest192.seq
 230689339     gbest193.seq
 230688472     gbest194.seq
 230689665     gbest195.seq
 230690592     gbest196.seq
 230687986     gbest197.seq
 230688794     gbest198.seq
 230689915     gbest199.seq
 230688569     gbest2.seq
 230688607     gbest20.seq
 230688452     gbest200.seq
 230688401     gbest201.seq
 230690192     gbest202.seq
 230688440     gbest203.seq
 230688676     gbest204.seq
 230688919     gbest205.seq
 230687478     gbest206.seq
 230687997     gbest207.seq
 230689133     gbest208.seq
 230689768     gbest209.seq
 230689671     gbest21.seq
 230687542     gbest210.seq
 230689311     gbest211.seq
 230687446     gbest212.seq
 230687522     gbest213.seq
 230690472     gbest214.seq
 230688887     gbest215.seq
 230689909     gbest216.seq
 230690418     gbest217.seq
 230688698     gbest218.seq
 230688592     gbest219.seq
 230687697     gbest22.seq
 230690277     gbest220.seq
 230687990     gbest221.seq
 230688939     gbest222.seq
 168233411     gbest223.seq
 162493933     gbest224.seq
 165501026     gbest225.seq
 170456423     gbest226.seq
 169667721     gbest227.seq
 163814735     gbest228.seq
 165125582     gbest229.seq
 230690397     gbest23.seq
 164554951     gbest230.seq
 164281128     gbest231.seq
 164574389     gbest232.seq
 164139621     gbest233.seq
 164163652     gbest234.seq
 162949479     gbest235.seq
 168308204     gbest236.seq
 162240905     gbest237.seq
 163591936     gbest238.seq
 167950143     gbest239.seq
 230688995     gbest24.seq
 167384046     gbest240.seq
 165873282     gbest241.seq
 165724107     gbest242.seq
 165397201     gbest243.seq
 165184827     gbest244.seq
 164283699     gbest245.seq
 164285277     gbest246.seq
 165307626     gbest247.seq
 166256322     gbest248.seq
 180794100     gbest249.seq
 230689072     gbest25.seq
 171308553     gbest250.seq
 195957194     gbest251.seq
 230689377     gbest252.seq
 230688278     gbest253.seq
 230690235     gbest254.seq
 230689823     gbest255.seq
 230687728     gbest256.seq
 230689071     gbest257.seq
 230691398     gbest258.seq
 230690224     gbest259.seq
 230688276     gbest26.seq
 230688352     gbest260.seq
 230689076     gbest261.seq
 230689216     gbest262.seq
 230689076     gbest263.seq
 230689929     gbest264.seq
 230688346     gbest265.seq
 230687504     gbest266.seq
 230688475     gbest267.seq
 230688006     gbest268.seq
 230689085     gbest269.seq
 230687934     gbest27.seq
 230688558     gbest270.seq
 230690541     gbest271.seq
 230689494     gbest272.seq
 230689594     gbest273.seq
 230689019     gbest274.seq
 230688102     gbest275.seq
 230688276     gbest276.seq
 230690611     gbest277.seq
 230688748     gbest278.seq
 230688396     gbest279.seq
 230689476     gbest28.seq
 230687664     gbest280.seq
 207958757     gbest281.seq
 230690285     gbest282.seq
 230689534     gbest283.seq
 230689338     gbest284.seq
 230688863     gbest285.seq
 230688133     gbest286.seq
 230688270     gbest287.seq
 230689307     gbest288.seq
 230689469     gbest289.seq
 230688395     gbest29.seq
 230687767     gbest290.seq
 230688031     gbest291.seq
 230688578     gbest292.seq
 230688828     gbest293.seq
 230690402     gbest294.seq
 230688895     gbest295.seq
 230687546     gbest296.seq
 230690765     gbest297.seq
 230688670     gbest298.seq
 230687508     gbest299.seq
 230690160     gbest3.seq
 230688273     gbest30.seq
 230693025     gbest300.seq
 230688186     gbest301.seq
 230689054     gbest302.seq
 230690038     gbest303.seq
 230689515     gbest304.seq
 230688915     gbest305.seq
 230691335     gbest306.seq
 230691365     gbest307.seq
 230689003     gbest308.seq
 230690643     gbest309.seq
 230691317     gbest31.seq
 230689136     gbest310.seq
 230688205     gbest311.seq
 230691093     gbest312.seq
 230691656     gbest313.seq
 230691158     gbest314.seq
 230691172     gbest315.seq
 230689475     gbest316.seq
 230688021     gbest317.seq
 230690617     gbest318.seq
 230688306     gbest319.seq
 230688018     gbest32.seq
 230689311     gbest320.seq
 230689907     gbest321.seq
 230688514     gbest322.seq
 230688580     gbest323.seq
 230688091     gbest324.seq
 230688479     gbest325.seq
 230689116     gbest326.seq
 230689840     gbest327.seq
 212913732     gbest328.seq
 230688718     gbest329.seq
 230688069     gbest33.seq
 230687734     gbest330.seq
 230687947     gbest331.seq
 230687691     gbest332.seq
 230689537     gbest333.seq
 185508140     gbest334.seq
 144886702     gbest335.seq
 230691170     gbest336.seq
 230690665     gbest337.seq
 230688794     gbest338.seq
 230689151     gbest339.seq
 230688426     gbest34.seq
 230688127     gbest340.seq
 230689056     gbest341.seq
 230688143     gbest342.seq
 230688619     gbest343.seq
 230692415     gbest344.seq
 230689078     gbest345.seq
 230687664     gbest346.seq
 230690424     gbest347.seq
 230687440     gbest348.seq
 230687712     gbest349.seq
 230688769     gbest35.seq
 230692299     gbest350.seq
 230688573     gbest351.seq
 230687779     gbest352.seq
 230689644     gbest353.seq
 230687714     gbest354.seq
 230688636     gbest355.seq
 230688094     gbest356.seq
 230691189     gbest357.seq
 230689625     gbest358.seq
 230689091     gbest359.seq
 230688319     gbest36.seq
 230689069     gbest360.seq
 230688291     gbest361.seq
 230689633     gbest362.seq
 230688419     gbest363.seq
 230688154     gbest364.seq
 230689815     gbest365.seq
 230688061     gbest366.seq
 230693537     gbest367.seq
 230694656     gbest368.seq
 230692237     gbest369.seq
 230689218     gbest37.seq
 230688141     gbest370.seq
 230690111     gbest371.seq
 230688805     gbest372.seq
 230689093     gbest373.seq
 230689746     gbest374.seq
 230688113     gbest375.seq
 230689646     gbest376.seq
 230688934     gbest377.seq
 230688785     gbest378.seq
 230688139     gbest379.seq
 230688206     gbest38.seq
 222922939     gbest380.seq
 230690818     gbest381.seq
 230687631     gbest382.seq
 230690078     gbest383.seq
 230688887     gbest384.seq
 230690945     gbest385.seq
 230687738     gbest386.seq
 230688855     gbest387.seq
 222601597     gbest388.seq
 230689459     gbest389.seq
 229596183     gbest39.seq
 230688458     gbest390.seq
 230690151     gbest391.seq
 230689223     gbest392.seq
 230690241     gbest393.seq
 230688432     gbest394.seq
 230688118     gbest395.seq
 230688226     gbest396.seq
 230688271     gbest397.seq
 230688939     gbest398.seq
 230690887     gbest399.seq
 230687668     gbest4.seq
 230687487     gbest40.seq
 230691397     gbest400.seq
 230691449     gbest401.seq
 230689971     gbest402.seq
 230691922     gbest403.seq
 230687679     gbest404.seq
 223891731     gbest405.seq
 210456362     gbest406.seq
 210162107     gbest407.seq
 210325574     gbest408.seq
 210273372     gbest409.seq
 215149456     gbest41.seq
 210414696     gbest410.seq
 210410360     gbest411.seq
 211928381     gbest412.seq
 211492931     gbest413.seq
 211245847     gbest414.seq
 213608194     gbest415.seq
 212020456     gbest416.seq
 210899653     gbest417.seq
 210982264     gbest418.seq
 210847864     gbest419.seq
 192226798     gbest42.seq
 210128741     gbest420.seq
 210131547     gbest421.seq
 210300682     gbest422.seq
 210238194     gbest423.seq
 209855238     gbest424.seq
 225507459     gbest425.seq
 230690815     gbest426.seq
 230687465     gbest427.seq
 230688850     gbest428.seq
 230689472     gbest429.seq
 193193841     gbest43.seq
 230687452     gbest430.seq
 230687572     gbest431.seq
 230687988     gbest432.seq
 230690034     gbest433.seq
 230690591     gbest434.seq
 230691898     gbest435.seq
 230690096     gbest436.seq
 230689309     gbest437.seq
 230689245     gbest438.seq
 230690454     gbest439.seq
 217268289     gbest44.seq
 230688885     gbest440.seq
 230690939     gbest441.seq
 227505831     gbest442.seq
 230688155     gbest443.seq
 230688576     gbest444.seq
 230689077     gbest445.seq
 230687536     gbest446.seq
 230689065     gbest447.seq
 230689216     gbest448.seq
 230689235     gbest449.seq
 216179911     gbest45.seq
 230689519     gbest450.seq
 230688762     gbest451.seq
 230690647     gbest452.seq
 230690778     gbest453.seq
 230689811     gbest454.seq
 230691217     gbest455.seq
 230690735     gbest456.seq
 230689126     gbest457.seq
 230688473     gbest458.seq
 230691182     gbest459.seq
 215980609     gbest46.seq
 230687793     gbest460.seq
 230691614     gbest461.seq
 230689799     gbest462.seq
 230690683     gbest463.seq
 230689710     gbest464.seq
 230690831     gbest465.seq
 230691438     gbest466.seq
 230687501     gbest467.seq
 229785811     gbest468.seq
 230689998     gbest469.seq
 216899085     gbest47.seq
 230689240     gbest470.seq
 230691017     gbest471.seq
 230689689     gbest472.seq
 230687597     gbest473.seq
 230689417     gbest474.seq
 230688815     gbest475.seq
 230689238     gbest476.seq
 230689733     gbest477.seq
 230690463     gbest478.seq
 230688565     gbest479.seq
 230688530     gbest48.seq
 230689225     gbest480.seq
 229238653     gbest481.seq
 230690483     gbest482.seq
 230690080     gbest483.seq
 230688979     gbest484.seq
 230687667     gbest485.seq
 230688683     gbest486.seq
 230688042     gbest487.seq
 230689182     gbest488.seq
 230688054     gbest489.seq
 230687630     gbest49.seq
 230691680     gbest490.seq
 230690727     gbest491.seq
 198897290     gbest492.seq
 196053029     gbest493.seq
 230688977     gbest494.seq
 230687888     gbest495.seq
 230689411     gbest496.seq
 230689276     gbest497.seq
 230688954     gbest498.seq
 230687458     gbest499.seq
 164127827     gbest5.seq
 220068559     gbest50.seq
 230689460     gbest500.seq
 230688526     gbest501.seq
 230688252     gbest502.seq
 230688035     gbest503.seq
 230687499     gbest504.seq
 230688032     gbest505.seq
 230687995     gbest506.seq
 230690214     gbest507.seq
 230687739     gbest508.seq
 230690303     gbest509.seq
 230690321     gbest51.seq
 221037227     gbest510.seq
 230687592     gbest511.seq
 230459814     gbest512.seq
 230688393     gbest52.seq
 230690037     gbest53.seq
 230689613     gbest54.seq
 230688434     gbest55.seq
 230688148     gbest56.seq
 230689494     gbest57.seq
 230690848     gbest58.seq
 230689762     gbest59.seq
 177450586     gbest6.seq
 230689329     gbest60.seq
 230689681     gbest61.seq
 230688350     gbest62.seq
 230687621     gbest63.seq
 230690139     gbest64.seq
 230687973     gbest65.seq
 230690097     gbest66.seq
 209741833     gbest67.seq
 209415751     gbest68.seq
 208423798     gbest69.seq
 230687876     gbest7.seq
 209207231     gbest70.seq
 209990335     gbest71.seq
 210033283     gbest72.seq
 208861986     gbest73.seq
 209147005     gbest74.seq
 210332668     gbest75.seq
 207716496     gbest76.seq
 205746156     gbest77.seq
 208300405     gbest78.seq
 208572224     gbest79.seq
 230687875     gbest8.seq
 212691252     gbest80.seq
 228937791     gbest81.seq
 230689855     gbest82.seq
 230691322     gbest83.seq
 218451656     gbest84.seq
 214791330     gbest85.seq
 215729390     gbest86.seq
 230688966     gbest87.seq
 230690276     gbest88.seq
 230689924     gbest89.seq
 230688341     gbest9.seq
 230689788     gbest90.seq
 230689143     gbest91.seq
 230687948     gbest92.seq
 230689847     gbest93.seq
 230688620     gbest94.seq
 230688598     gbest95.seq
 230688533     gbest96.seq
 230690194     gbest97.seq
 230688429     gbest98.seq
 230688638     gbest99.seq
  52893874     gbgen.idx
 230688691     gbgss1.seq
 230691106     gbgss10.seq
 227385665     gbgss100.seq
 228219605     gbgss101.seq
 228748185     gbgss102.seq
 228611398     gbgss103.seq
 227950514     gbgss104.seq
 227521541     gbgss105.seq
 230689904     gbgss106.seq
 230689766     gbgss107.seq
 230688495     gbgss108.seq
 230689053     gbgss109.seq
 230690515     gbgss11.seq
 230689165     gbgss110.seq
 230688544     gbgss111.seq
 230689342     gbgss112.seq
 230687915     gbgss113.seq
 230689166     gbgss114.seq
 230688484     gbgss115.seq
 230690118     gbgss116.seq
 230691286     gbgss117.seq
 230689648     gbgss118.seq
 230688834     gbgss119.seq
 230688952     gbgss12.seq
 230687549     gbgss120.seq
 230689828     gbgss121.seq
 230688916     gbgss122.seq
 230688972     gbgss123.seq
 230688592     gbgss124.seq
 230689364     gbgss125.seq
 230690157     gbgss126.seq
 230689374     gbgss127.seq
 230688607     gbgss128.seq
 230689077     gbgss129.seq
 230689508     gbgss13.seq
 230689775     gbgss130.seq
 230688428     gbgss131.seq
 230689927     gbgss132.seq
 230690462     gbgss133.seq
 230690053     gbgss134.seq
 230690538     gbgss135.seq
 230689407     gbgss136.seq
 230689939     gbgss137.seq
 230687566     gbgss138.seq
 230687884     gbgss139.seq
 230689213     gbgss14.seq
 230688657     gbgss140.seq
 230689045     gbgss141.seq
  13990473     gbgss142.seq
 250001674     gbgss143.seq
 250002190     gbgss144.seq
 250002593     gbgss145.seq
 250000742     gbgss146.seq
 250002973     gbgss147.seq
 250000706     gbgss148.seq
 250001346     gbgss149.seq
 230689083     gbgss15.seq
 250000913     gbgss150.seq
 250000133     gbgss151.seq
 250001741     gbgss152.seq
 250004607     gbgss153.seq
 250000808     gbgss154.seq
 250001540     gbgss155.seq
 250001115     gbgss156.seq
 250000238     gbgss157.seq
 250001809     gbgss158.seq
 250001707     gbgss159.seq
 230687781     gbgss16.seq
 250001781     gbgss160.seq
 250001708     gbgss161.seq
 250000909     gbgss162.seq
 250000822     gbgss163.seq
 250002153     gbgss164.seq
 250000969     gbgss165.seq
 250001442     gbgss166.seq
 250002078     gbgss167.seq
 250002306     gbgss168.seq
 250001597     gbgss169.seq
 230689500     gbgss17.seq
 250000871     gbgss170.seq
 250000474     gbgss171.seq
 250001654     gbgss172.seq
 250002267     gbgss173.seq
 240054968     gbgss174.seq
 230689690     gbgss18.seq
 230689048     gbgss19.seq
 230688162     gbgss2.seq
 230689752     gbgss20.seq
 230688165     gbgss21.seq
 230690284     gbgss22.seq
 230689929     gbgss23.seq
 230687772     gbgss24.seq
 230688053     gbgss25.seq
 230689455     gbgss26.seq
 230688033     gbgss27.seq
 230689734     gbgss28.seq
 230687668     gbgss29.seq
 230691027     gbgss3.seq
 230689856     gbgss30.seq
 230688604     gbgss31.seq
 230689612     gbgss32.seq
 230687884     gbgss33.seq
 230690042     gbgss34.seq
 230688867     gbgss35.seq
 230689771     gbgss36.seq
 230689273     gbgss37.seq
 230687763     gbgss38.seq
 230688214     gbgss39.seq
 230689940     gbgss4.seq
 230688288     gbgss40.seq
 230689590     gbgss41.seq
 230689392     gbgss42.seq
 230689127     gbgss43.seq
 230689097     gbgss44.seq
 230687820     gbgss45.seq
 230689567     gbgss46.seq
 230690224     gbgss47.seq
 230688705     gbgss48.seq
 230689968     gbgss49.seq
 230688983     gbgss5.seq
 230687704     gbgss50.seq
 230687469     gbgss51.seq
 230688394     gbgss52.seq
 230689819     gbgss53.seq
 230688818     gbgss54.seq
 230689799     gbgss55.seq
 230688223     gbgss56.seq
 230689421     gbgss57.seq
 230689129     gbgss58.seq
 230689040     gbgss59.seq
 230689904     gbgss6.seq
 230691029     gbgss60.seq
 229189576     gbgss61.seq
 230689103     gbgss62.seq
 230687849     gbgss63.seq
 230687513     gbgss64.seq
 230689005     gbgss65.seq
 230687964     gbgss66.seq
 230688260     gbgss67.seq
 230689359     gbgss68.seq
 230689865     gbgss69.seq
 230689273     gbgss7.seq
 230689570     gbgss70.seq
 230688941     gbgss71.seq
 230687499     gbgss72.seq
 230689262     gbgss73.seq
 230688593     gbgss74.seq
 230687857     gbgss75.seq
 230689735     gbgss76.seq
 230689903     gbgss77.seq
 230687507     gbgss78.seq
 230688549     gbgss79.seq
 230688315     gbgss8.seq
 230688594     gbgss80.seq
 202445932     gbgss81.seq
 194697867     gbgss82.seq
 215356671     gbgss83.seq
 230689144     gbgss84.seq
 230688373     gbgss85.seq
 230688779     gbgss86.seq
 230690229     gbgss87.seq
 230688896     gbgss88.seq
 230689793     gbgss89.seq
 230690615     gbgss9.seq
 230687713     gbgss90.seq
 230689030     gbgss91.seq
 230688160     gbgss92.seq
 230688518     gbgss93.seq
 230687829     gbgss94.seq
 230690158     gbgss95.seq
 230689093     gbgss96.seq
 230689546     gbgss97.seq
 230689527     gbgss98.seq
 230687900     gbgss99.seq
 250003708     gbhtc1.seq
  83881505     gbhtc10.seq
 250000428     gbhtc2.seq
 250001165     gbhtc3.seq
 250014730     gbhtc4.seq
 250000019     gbhtc5.seq
 250001429     gbhtc6.seq
 250000815     gbhtc7.seq
 250001097     gbhtc8.seq
 250007360     gbhtc9.seq
 250076731     gbhtg1.seq
 250170810     gbhtg10.seq
 250074897     gbhtg11.seq
 250309759     gbhtg12.seq
 250291410     gbhtg13.seq
 250201751     gbhtg14.seq
 250130429     gbhtg15.seq
 250277646     gbhtg16.seq
 250067281     gbhtg17.seq
 250136554     gbhtg18.seq
 250262894     gbhtg19.seq
 250145747     gbhtg2.seq
 250105134     gbhtg20.seq
 250160047     gbhtg21.seq
 250203460     gbhtg22.seq
 250125533     gbhtg23.seq
 250257460     gbhtg24.seq
 250169267     gbhtg25.seq
 250162036     gbhtg26.seq
 250096919     gbhtg27.seq
 250214188     gbhtg28.seq
 250274109     gbhtg29.seq
 250025205     gbhtg3.seq
 250211798     gbhtg30.seq
 250195244     gbhtg31.seq
 250217524     gbhtg32.seq
 250059080     gbhtg33.seq
 250066003     gbhtg34.seq
 250114942     gbhtg35.seq
 250204228     gbhtg36.seq
 250023027     gbhtg37.seq
 250015042     gbhtg38.seq
 250126858     gbhtg39.seq
 250202359     gbhtg4.seq
 250061732     gbhtg40.seq
 250249112     gbhtg41.seq
 250049188     gbhtg42.seq
 250115526     gbhtg43.seq
 250084462     gbhtg44.seq
 250228478     gbhtg45.seq
 250072341     gbhtg46.seq
 250104718     gbhtg47.seq
 250244180     gbhtg48.seq
 250340540     gbhtg49.seq
 250083748     gbhtg5.seq
 250087316     gbhtg50.seq
 250333884     gbhtg51.seq
 250068930     gbhtg52.seq
 250276394     gbhtg53.seq
 250175248     gbhtg54.seq
 250166523     gbhtg55.seq
 250191030     gbhtg56.seq
 250220659     gbhtg57.seq
 250259075     gbhtg58.seq
 250191509     gbhtg59.seq
 250099103     gbhtg6.seq
 250006918     gbhtg60.seq
 250157462     gbhtg61.seq
 250249380     gbhtg62.seq
 250103348     gbhtg63.seq
 250199431     gbhtg64.seq
 250097685     gbhtg65.seq
 250115902     gbhtg66.seq
 250039126     gbhtg67.seq
 250192321     gbhtg68.seq
 250136056     gbhtg69.seq
 250027749     gbhtg7.seq
 250016830     gbhtg70.seq
 250132956     gbhtg71.seq
 250093200     gbhtg72.seq
 250181746     gbhtg73.seq
 250012968     gbhtg74.seq
 250083231     gbhtg75.seq
 250017896     gbhtg76.seq
 250142063     gbhtg77.seq
 250658269     gbhtg78.seq
 250118074     gbhtg79.seq
 250189742     gbhtg8.seq
 250094755     gbhtg80.seq
 105136607     gbhtg81.seq
 250112662     gbhtg9.seq
 250064665     gbinv1.seq
 250040931     gbinv2.seq
 250001279     gbinv3.seq
 250001685     gbinv4.seq
 250000527     gbinv5.seq
 250018055     gbinv6.seq
 250002531     gbinv7.seq
 209954935     gbinv8.seq
 371941508     gbjou.idx
 203444419     gbkey.idx
 250002712     gbmam1.seq
 182961877     gbmam2.seq
  32373306     gbnew.txt
 250000447     gbpat1.seq
 250001659     gbpat10.seq
 250003940     gbpat11.seq
 250002483     gbpat12.seq
 250001200     gbpat13.seq
 250001400     gbpat14.seq
 250001833     gbpat15.seq
 250000175     gbpat16.seq
 250000526     gbpat17.seq
 250072554     gbpat18.seq
 250002181     gbpat19.seq
 250000450     gbpat2.seq
 170640156     gbpat20.seq
 250002727     gbpat3.seq
 250000024     gbpat4.seq
 250000044     gbpat5.seq
 250000908     gbpat6.seq
 250000087     gbpat7.seq
 250000352     gbpat8.seq
 250001797     gbpat9.seq
  47717434     gbphg.seq
 250108923     gbpln1.seq
 278637362     gbpln10.seq
 250002620     gbpln11.seq
 250000574     gbpln12.seq
 250001923     gbpln13.seq
 250035886     gbpln14.seq
 250001855     gbpln15.seq
 250001271     gbpln16.seq
 198006629     gbpln17.seq
 250045979     gbpln2.seq
 251048544     gbpln3.seq
 250004911     gbpln4.seq
 250004952     gbpln5.seq
 250007879     gbpln6.seq
 250033535     gbpln7.seq
 250000121     gbpln8.seq
 276787184     gbpln9.seq
 250037534     gbpri1.seq
 250037301     gbpri10.seq
 250127134     gbpri11.seq
 250216187     gbpri12.seq
 250007233     gbpri13.seq
 250093523     gbpri14.seq
 250159257     gbpri15.seq
 250001873     gbpri16.seq
 250004800     gbpri17.seq
 250124544     gbpri18.seq
 250027099     gbpri19.seq
 250034133     gbpri2.seq
 250009796     gbpri20.seq
 250037630     gbpri21.seq
 250002783     gbpri22.seq
 250007967     gbpri23.seq
 250005093     gbpri24.seq
 250022675     gbpri25.seq
 250000639     gbpri26.seq
 250054742     gbpri27.seq
 250001714     gbpri28.seq
 250000959     gbpri29.seq
 250097675     gbpri3.seq
  73302474     gbpri30.seq
 250032773     gbpri4.seq
 250225271     gbpri5.seq
 250022247     gbpri6.seq
 250111548     gbpri7.seq
 250203317     gbpri8.seq
 250024145     gbpri9.seq
    214597     gbrel.txt
 250135428     gbrod1.seq
 250015183     gbrod10.seq
 250062558     gbrod11.seq
 250094983     gbrod12.seq
 250032134     gbrod13.seq
 250024354     gbrod14.seq
 250203427     gbrod15.seq
 250195553     gbrod16.seq
 250116107     gbrod17.seq
 250065397     gbrod18.seq
 250237380     gbrod19.seq
 250203118     gbrod2.seq
 250001817     gbrod20.seq
 250008068     gbrod21.seq
 250168390     gbrod22.seq
 250000519     gbrod23.seq
  37503583     gbrod24.seq
 250241028     gbrod3.seq
 250076298     gbrod4.seq
 250086166     gbrod5.seq
 250233243     gbrod6.seq
 250143897     gbrod7.seq
 250212311     gbrod8.seq
 250207358     gbrod9.seq
4529700926     gbsdr.txt
   1435247     gbsec.idx
 250001732     gbsts1.seq
 250000874     gbsts10.seq
 250002855     gbsts11.seq
 250004684     gbsts12.seq
 250002047     gbsts13.seq
  34705395     gbsts14.seq
 250000785     gbsts2.seq
 250001849     gbsts3.seq
 250004394     gbsts4.seq
 250002051     gbsts5.seq
 250001790     gbsts6.seq
 250003203     gbsts7.seq
 250000095     gbsts8.seq
 250001092     gbsts9.seq
 114972332     gbsyn.seq
    410741     gbuna.seq
 250655176     gbvrl1.seq
 250001163     gbvrl2.seq
 250001099     gbvrl3.seq
 250000494     gbvrl4.seq
 244620260     gbvrl5.seq
 250000403     gbvrt1.seq
 239397904     gbvrt10.seq
 250131231     gbvrt2.seq
 250000701     gbvrt3.seq
 250008996     gbvrt4.seq
 250132824     gbvrt5.seq
 250163094     gbvrt6.seq
 250005246     gbvrt7.seq
 250036492     gbvrt8.seq
 250100905     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         25048      102563859
BCT10        58         114535366
BCT11        57         113963856
BCT12        442        113659622
BCT13        46661      91451288
BCT14        25374      69931200
BCT2         5149       107222510
BCT3         94         115815866
BCT4         27037      102982493
BCT5         34860      97371513
BCT6         35760      99621388
BCT7         33778      103515659
BCT8         6446       102062031
BCT9         2274       101203356
ENV1         95884      71210475
ENV2         88775      80581123
ENV3         45649      42041830
EST1         68132      26291928
EST10        76538      29845881
EST100       67362      34995566
EST101       71961      36340475
EST102       72131      38738644
EST103       73332      43275794
EST104       67243      44896815
EST105       74919      43884921
EST106       70004      28552465
EST107       70962      32147812
EST108       64488      34402291
EST109       66489      39157445
EST11        75115      28773787
EST110       72228      48022697
EST111       75805      28667543
EST112       74563      33895263
EST113       74640      26927761
EST114       73624      35568798
EST115       68061      35106102
EST116       74131      41966402
EST117       79408      44266172
EST118       73941      47729424
EST119       67667      41050691
EST12        77707      30806669
EST120       70056      46581782
EST121       72158      45494824
EST122       70727      44887202
EST123       75148      41642795
EST124       74756      46696455
EST125       73956      50523535
EST126       70604      48295382
EST127       80042      41712093
EST128       75549      27314849
EST129       80647      44119710
EST13        77115      29303866
EST130       76214      42520206
EST131       75253      45067577
EST132       63293      30954503
EST133       70519      38171510
EST134       67087      37482905
EST135       68276      38056119
EST136       71058      43052818
EST137       73207      47169585
EST138       66821      38349728
EST139       72722      41363980
EST14        78371      31708207
EST140       69056      39986867
EST141       61727      39023753
EST142       83138      45199189
EST143       99191      55667071
EST144       65469      34740604
EST145       98202      52114601
EST146       109529     58244069
EST147       100138     55780077
EST148       81250      48042941
EST149       90699      50687699
EST15        74900      31655954
EST150       96513      59766738
EST151       98395      58953645
EST152       76218      44064483
EST153       69400      37321847
EST154       65703      29770421
EST155       59727      27745857
EST156       56742      27647971
EST157       62595      31026733
EST158       59402      30673409
EST159       78072      56357264
EST16        75781      33320508
EST160       67656      37646987
EST161       74867      49631037
EST162       68600      38008803
EST163       61552      30494676
EST164       64287      40448850
EST165       65478      30369047
EST166       62973      46843872
EST167       71622      40176784
EST168       101492     45071980
EST169       88597      52849834
EST17        82651      34110495
EST170       99519      57681196
EST171       103893     55533474
EST172       95575      52279988
EST173       91014      38551710
EST174       93104      47159999
EST175       92604      41841178
EST176       91142      38258137
EST177       81478      39446344
EST178       65067      44508650
EST179       71202      38785871
EST18        81110      32193573
EST180       58834      41632928
EST181       69967      34135520
EST182       73523      26261663
EST183       72231      46456993
EST184       80335      40537445
EST185       64303      32277851
EST186       68467      41374693
EST187       68350      53418517
EST188       69049      37051360
EST189       67941      36962397
EST19        78261      31897065
EST190       70268      57263979
EST191       68404      38753214
EST192       72138      36633806
EST193       69875      55007288
EST194       68808      54251712
EST195       64648      47464712
EST196       64422      47333122
EST197       64968      47426713
EST198       65167      45421048
EST199       63733      47830528
EST2         74651      28648243
EST20        74829      30661150
EST200       63980      40874695
EST201       63454      34337413
EST202       64626      38506018
EST203       80240      41426569
EST204       84953      55900368
EST205       68038      41462687
EST206       97999      60759307
EST207       107452     66382146
EST208       109093     64029315
EST209       105782     65754047
EST21        73380      34163353
EST210       104047     65466016
EST211       109979     51089572
EST212       90971      54900127
EST213       98685      43748906
EST214       90074      48910255
EST215       69664      43975472
EST216       67040      48311635
EST217       68564      58362090
EST218       72611      54844120
EST219       78134      39526421
EST22        75945      30472331
EST220       79702      49112680
EST221       73332      52592828
EST222       72336      51265159
EST223       29080      11088965
EST224       27806      10595964
EST225       27315      10137340
EST226       26460      9655453
EST227       26673      9005616
EST228       27572      10068973
EST229       27199      9837007
EST23        77287      32571370
EST230       27217      9774183
EST231       27268      10756615
EST232       27133      11889469
EST233       27226      11141001
EST234       27377      9866857
EST235       27624      9263941
EST236       26896      9508302
EST237       27831      11232101
EST238       27658      10961363
EST239       26895      11333438
EST24        75042      33179426
EST240       26709      12050181
EST241       27086      11192615
EST242       27035      10848005
EST243       27028      11796050
EST244       27168      11527906
EST245       27269      10874959
EST246       27259      10868052
EST247       27149      10426117
EST248       26968      12103943
EST249       24409      17100607
EST25        73459      31451628
EST250       25929      17431108
EST251       56083      24630530
EST252       110300     42875958
EST253       71249      39559784
EST254       68674      44507876
EST255       69318      44651153
EST256       69091      44389809
EST257       65922      38870862
EST258       76426      44077039
EST259       64076      46619257
EST26        75811      31340732
EST260       65662      36159522
EST261       72467      36347434
EST262       102104     47076504
EST263       77744      43441375
EST264       68179      34949557
EST265       67064      32527858
EST266       70836      42301084
EST267       72756      34464548
EST268       68660      33472523
EST269       75159      48135660
EST27        75436      32932267
EST270       63774      33892016
EST271       68062      38787677
EST272       80464      41656757
EST273       76638      43114249
EST274       77222      50773393
EST275       77559      54817851
EST276       108792     48965419
EST277       86194      43278194
EST278       74531      44956464
EST279       73364      41323652
EST28        108311     51506748
EST280       71652      38014317
EST281       70127      27881537
EST282       71073      39467031
EST283       62117      34180666
EST284       63449      42458433
EST285       72039      41169816
EST286       61770      44365465
EST287       62111      32282344
EST288       83302      43012078
EST289       84025      41592498
EST29        97600      46601101
EST290       75900      49228070
EST291       104058     57483940
EST292       123330     46828272
EST293       76781      38043913
EST294       68338      35150736
EST295       69698      46596513
EST296       81283      40071740
EST297       71222      41729404
EST298       71593      40944435
EST299       60125      34302236
EST3         73739      29916860
EST30        96614      53485174
EST300       58796      36283902
EST301       59398      35573262
EST302       70577      48458319
EST303       71556      43930586
EST304       71694      41801478
EST305       73217      37520174
EST306       59194      30972928
EST307       53837      27434214
EST308       52768      28189906
EST309       53028      28341323
EST31        79737      43891072
EST310       51914      26950072
EST311       53901      26474976
EST312       55692      24420881
EST313       55279      23394272
EST314       54450      22358171
EST315       55559      21432459
EST316       54962      22072254
EST317       56160      22370017
EST318       54997      21408226
EST319       56192      20116714
EST32        66074      52678009
EST320       65180      35978466
EST321       76496      35139326
EST322       74438      33219549
EST323       77253      33032510
EST324       76830      33674742
EST325       92767      61430777
EST326       68807      53147595
EST327       81670      49671982
EST328       75139      38878092
EST329       67875      53836646
EST33        75726      53253025
EST330       64873      49669149
EST331       59727      43821693
EST332       62578      33150768
EST333       72135      47833506
EST334       58971      36579062
EST335       48852      24046387
EST336       68053      36231095
EST337       65623      35211092
EST338       61476      29848750
EST339       63581      41176016
EST34        86955      46496287
EST340       81546      45210572
EST341       72410      40606776
EST342       68582      41446002
EST343       71244      40766354
EST344       62250      42843522
EST345       85034      48581931
EST346       84530      49819937
EST347       81190      44694719
EST348       64058      35560417
EST349       67584      37398455
EST35        87134      44745971
EST350       73053      39960246
EST351       48001      24311584
EST352       62502      35707618
EST353       69924      42046123
EST354       97716      45713585
EST355       75668      44794940
EST356       74268      50014222
EST357       74654      48516201
EST358       63284      35022615
EST359       77673      36975772
EST36        93611      52312695
EST360       79559      38384034
EST361       56256      39672617
EST362       58908      38870477
EST363       62280      38171791
EST364       91872      52989625
EST365       86468      46222607
EST366       67344      44948551
EST367       78769      40300179
EST368       48075      30058309
EST369       44251      23123016
EST37        78259      57916366
EST370       76268      50689070
EST371       80330      39622288
EST372       78292      47408512
EST373       77279      46671646
EST374       81510      51615663
EST375       76886      45470965
EST376       67606      39395861
EST377       64477      40813277
EST378       69790      39287462
EST379       59077      35744520
EST38        92759      46217663
EST380       81322      24928289
EST381       79610      37710717
EST382       65596      39509284
EST383       69234      36337393
EST384       70783      40834880
EST385       77243      48701733
EST386       64729      42641959
EST387       64456      41250609
EST388       71942      40981144
EST389       66582      39307102
EST39        86370      45552733
EST390       66278      43371380
EST391       80596      49293935
EST392       87648      49148772
EST393       61770      39385218
EST394       58819      41196179
EST395       57357      40398787
EST396       57687      40914507
EST397       76952      46885616
EST398       55670      33042502
EST399       56937      36639334
EST4         74569      28389457
EST40        104450     48148188
EST400       64510      40558741
EST401       57212      40824639
EST402       61015      42708250
EST403       53502      38433672
EST404       57330      38782808
EST405       91036      39746356
EST406       69604      38531467
EST407       69786      38206178
EST408       69670      38782602
EST409       69650      38358088
EST41        84105      31653446
EST410       69515      38749462
EST411       69517      38538153
EST412       68854      38303643
EST413       68854      39194129
EST414       69025      38497429
EST415       67412      37990098
EST416       68815      37803657
EST417       69439      39417654
EST418       69138      38427354
EST419       69427      37847177
EST42        68746      18295987
EST420       69843      38066266
EST421       69883      38121139
EST422       69618      38558049
EST423       69740      38291259
EST424       70306      37222664
EST425       79654      36507559
EST426       59948      38796003
EST427       51989      40802809
EST428       71119      44204784
EST429       62732      37551533
EST43        69696      18819521
EST430       72527      43034236
EST431       116013     58603322
EST432       79790      48852494
EST433       82780      58621172
EST434       50989      28961733
EST435       46796      45121819
EST436       46399      58907470
EST437       75560      55156364
EST438       63327      38104735
EST439       72680      43754669
EST44        59270      18150426
EST440       67339      42114687
EST441       70150      43053008
EST442       61238      52556041
EST443       83766      43667160
EST444       109160     47921213
EST445       81632      45419218
EST446       59891      40167201
EST447       57455      41204330
EST448       58866      38974408
EST449       66262      51465979
EST45        43730      11951685
EST450       63100      45429284
EST451       59576      40593817
EST452       51724      38510531
EST453       57136      38944628
EST454       55486      41147133
EST455       69522      37643883
EST456       65822      44070412
EST457       57080      38150021
EST458       58943      41938813
EST459       58419      45744708
EST46        43262      11896032
EST460       59830      45730200
EST461       56094      40266961
EST462       57789      41491261
EST463       53508      35685700
EST464       57216      40826178
EST465       56198      35372174
EST466       74025      46338999
EST467       67962      57562383
EST468       69753      50939362
EST469       75979      49877893
EST47        43171      11415185
EST470       45740      59697613
EST471       55811      49041004
EST472       66587      48070717
EST473       60391      40596014
EST474       77771      44611870
EST475       83437      53525456
EST476       82618      52420552
EST477       68889      43179621
EST478       64176      42136404
EST479       78460      51378894
EST48        84569      35463867
EST480       81412      50662962
EST481       73626      62370770
EST482       72704      50555188
EST483       64606      45164793
EST484       67340      52683981
EST485       65996      47389046
EST486       77345      45866931
EST487       74730      39618747
EST488       116450     45748196
EST489       100015     47931585
EST49        96754      44043616
EST490       54897      49811213
EST491       59329      49720681
EST492       86406      32369104
EST493       86989      31705624
EST494       78627      41480594
EST495       91160      55906069
EST496       87156      48015851
EST497       67233      45015418
EST498       72440      47165740
EST499       80089      53343743
EST5         48198      15295521
EST50        88388      46629034
EST500       79669      50440640
EST501       73117      55877062
EST502       68993      50858426
EST503       79938      57809810
EST504       89213      45562550
EST505       76027      37520504
EST506       72190      25589661
EST507       72155      26957404
EST508       73423      26059981
EST509       72073      26206322
EST51        87985      39681682
EST510       77484      25968509
EST511       71865      28823305
EST512       74246      28207975
EST52        104621     54789242
EST53        96511      47866527
EST54        77094      33226702
EST55        67383      29507130
EST56        73268      32220402
EST57        69687      29274004
EST58        82102      33039440
EST59        74680      29996309
EST6         54924      17445206
EST60        68919      28073343
EST61        66359      29440526
EST62        76488      35654533
EST63        74300      32815070
EST64        74975      28474548
EST65        77736      28467602
EST66        81327      37588328
EST67        40543      11642401
EST68        40419      11040417
EST69        40411      12538201
EST7         74544      29357938
EST70        40785      12688258
EST71        40859      12314855
EST72        40723      12895763
EST73        40601      12788335
EST74        40463      12131498
EST75        40167      12113326
EST76        41024      12663881
EST77        41321      11894842
EST78        41033      13046171
EST79        40847      13071963
EST8         75853      30597153
EST80        42725      12723571
EST81        46237      18208739
EST82        42486      26634541
EST83        42443      18908368
EST84        48926      20149587
EST85        50736      21845109
EST86        50378      21723826
EST87        85021      48200436
EST88        74956      32359656
EST89        73999      29189562
EST9         77568      29867722
EST90        73099      31558454
EST91        76297      44947783
EST92        77406      40955239
EST93        76503      40268078
EST94        77906      38351081
EST95        69355      40269222
EST96        74671      34592225
EST97        74644      37973392
EST98        69823      36728500
EST99        77166      50449385
GSS1         90450      38672414
GSS10        74868      43580609
GSS100       75040      41505573
GSS101       74065      43940994
GSS102       73453      45484810
GSS103       73607      45093800
GSS104       73294      44986862
GSS105       73497      44233181
GSS106       78368      51175001
GSS107       85847      58036599
GSS108       81615      54018366
GSS109       82799      51659074
GSS11        70614      35934959
GSS110       86839      51527421
GSS111       78902      64941881
GSS112       85549      47792226
GSS113       93994      54122061
GSS114       77396      48432317
GSS115       84983      58523832
GSS116       86109      68057140
GSS117       74920      38065293
GSS118       80074      54211167
GSS119       94128      51186077
GSS12        72883      38307710
GSS120       87194      54960792
GSS121       85362      54154060
GSS122       85914      54003531
GSS123       76470      67021283
GSS124       76599      68728732
GSS125       79637      59684783
GSS126       78579      54484029
GSS127       78635      54751669
GSS128       79398      53613313
GSS129       78594      54844917
GSS13        76712      38973405
GSS130       79902      54809221
GSS131       84038      59922501
GSS132       77153      54523723
GSS133       65337      55107269
GSS134       77216      64287707
GSS135       76733      69334984
GSS136       77006      52588539
GSS137       82355      51702512
GSS138       94202      58287401
GSS139       93921      59083830
GSS14        71295      32119321
GSS140       85423      58212484
GSS141       92308      49712027
GSS142       5173       2748275
GSS143       86907      64480328
GSS144       83571      62758490
GSS145       101033     46826737
GSS146       69092      58683337
GSS147       68304      58730702
GSS148       69356      56597327
GSS149       69630      56065886
GSS15        70061      34758033
GSS150       70234      55461010
GSS151       85660      73328264
GSS152       85291      39624263
GSS153       74859      32005545
GSS154       98956      75494229
GSS155       88932      41487845
GSS156       92353      63519870
GSS157       79567      63918162
GSS158       70332      58965012
GSS159       68347      62997835
GSS16        78470      46274903
GSS160       62347      54818862
GSS161       116957     70551452
GSS162       119091     74784740
GSS163       115118     73225294
GSS164       87488      48633323
GSS165       89584      55045970
GSS166       103141     71614572
GSS167       108134     77718626
GSS168       106266     79824323
GSS169       105859     80262451
GSS17        70905      33300657
GSS170       104250     67400258
GSS171       77443      44255432
GSS172       100161     49447012
GSS173       93023      63048781
GSS174       97495      46215167
GSS18        59062      27942630
GSS19        56793      29072434
GSS2         88929      39303378
GSS20        57668      26711906
GSS21        61486      29052584
GSS22        64940      38235590
GSS23        57529      27080993
GSS24        66163      42022846
GSS25        68215      28292021
GSS26        58177      25353626
GSS27        65303      31935015
GSS28        65533      32578450
GSS29        77221      39668357
GSS3         87388      41802586
GSS30        82956      39747846
GSS31        74190      40412543
GSS32        70581      48296646
GSS33        79812      37829763
GSS34        75889      40321727
GSS35        74119      40023146
GSS36        87371      56186685
GSS37        87598      58173505
GSS38        85546      44954893
GSS39        86859      50480576
GSS4         78882      41011199
GSS40        86286      39992538
GSS41        83183      31914607
GSS42        81247      56933168
GSS43        80139      58088355
GSS44        72025      47501834
GSS45        72037      47427902
GSS46        77683      45767671
GSS47        77859      38710101
GSS48        83238      58019902
GSS49        86699      64885609
GSS5         78791      40543412
GSS50        81905      54530046
GSS51        93846      59323892
GSS52        88566      58839736
GSS53        76495      42040692
GSS54        72975      40715765
GSS55        86447      46914768
GSS56        88282      58743978
GSS57        77260      65343087
GSS58        72013      79256426
GSS59        87088      69155367
GSS6         78148      38870302
GSS60        88519      59194207
GSS61        63443      45087309
GSS62        67685      46497227
GSS63        89660      67262449
GSS64        86159      58504701
GSS65        87569      54085328
GSS66        87649      56899105
GSS67        96392      58038644
GSS68        100550     54608335
GSS69        100637     54498232
GSS7         77728      39127765
GSS70        101405     53525007
GSS71        102362     52309686
GSS72        102466     52176833
GSS73        102688     51896518
GSS74        102076     52672367
GSS75        99000      56594325
GSS76        90231      69508092
GSS77        89827      70789823
GSS78        88177      69653521
GSS79        87827      69672500
GSS8         75724      38101435
GSS80        89383      63298775
GSS81        81589      26773168
GSS82        77838      24394043
GSS83        86630      35650083
GSS84        83481      48688583
GSS85        80986      48628680
GSS86        89558      63965827
GSS87        79582      61472545
GSS88        77636      79505010
GSS89        76510      57552274
GSS9         72106      37147821
GSS90        94797      50856064
GSS91        76896      42540177
GSS92        85032      48135021
GSS93        69586      63061248
GSS94        85696      50678914
GSS95        82388      60880044
GSS96        85200      56397181
GSS97        83188      57492514
GSS98        89951      53401297
GSS99        81258      68947776
HTC1         37149      54051784
HTC10        17865      32148327
HTC2         28558      64620954
HTC3         18492      42904958
HTC4         16114      39711689
HTC5         36448      32065315
HTC6         66355      56796071
HTC7         81641      68040984
HTC8         67518      60483257
HTC9         66857      82232592
HTG1         1315       188873586
HTG10        1242       186650227
HTG11        1431       184179327
HTG12        875        192064218
HTG13        750        192455777
HTG14        743        192298142
HTG15        781        192247981
HTG16        801        192186063
HTG17        766        192211152
HTG18        2043       171412466
HTG19        1056       188034536
HTG2         2563       186100623
HTG20        1000       189113368
HTG21        777        191991068
HTG22        926        190448250
HTG23        881        190926221
HTG24        828        191314624
HTG25        778        192125208
HTG26        846        191441567
HTG27        875        191108339
HTG28        958        189974782
HTG29        909        191026747
HTG3         2458       185319770
HTG30        924        190516800
HTG31        871        191439622
HTG32        972        189715284
HTG33        869        191203452
HTG34        856        191489179
HTG35        826        191877984
HTG36        883        191124325
HTG37        975        190065348
HTG38        950        190186224
HTG39        1009       189737123
HTG4         2519       188482648
HTG40        1190       187025697
HTG41        1216       188329039
HTG42        1216       188408474
HTG43        1168       186813826
HTG44        1100       191471422
HTG45        1216       191049857
HTG46        1249       190935240
HTG47        1135       191153168
HTG48        1040       191342649
HTG49        994        190223211
HTG5         1281       185650087
HTG50        1017       189460694
HTG51        986        190025758
HTG52        971        189624783
HTG53        1021       189815803
HTG54        984        189799145
HTG55        941        189154238
HTG56        930        189150491
HTG57        1113       188450224
HTG58        1003       189822039
HTG59        1029       187970436
HTG6         1273       185296258
HTG60        1100       187148633
HTG61        1053       188743415
HTG62        1032       189394811
HTG63        977        189107320
HTG64        1080       188590335
HTG65        1093       189255339
HTG66        1288       185359914
HTG67        1248       185575888
HTG68        1245       184624665
HTG69        1269       184637994
HTG7         1247       185472319
HTG70        1250       184724120
HTG71        1423       187755902
HTG72        1210       188536290
HTG73        1326       190031789
HTG74        1119       191316785
HTG75        1471       190062833
HTG76        1147       191226777
HTG77        1030       194139555
HTG78        1013       194690830
HTG79        911        181669135
HTG8         1287       185088399
HTG80        1167       193549679
HTG81        425        72724644
HTG9         1182       187153099
INV1         18589      159640493
INV2         1663       167763273
INV3         31034      118373115
INV4         80216      73998651
INV5         73119      73777025
INV6         67871      81973691
INV7         42977      108435977
INV8         46263      77382622
MAM1         50524      117877792
MAM2         44416      68006202
PAT1         222658     70174534
PAT10        141419     66377245
PAT11        108043     59111635
PAT12        104148     50126401
PAT13        143949     59030506
PAT14        153731     63207915
PAT15        113310     111971957
PAT16        135056     97897345
PAT17        111147     110006422
PAT18        133310     98348829
PAT19        109743     85242714
PAT2         194352     84724710
PAT20        116933     43404454
PAT3         172019     95884211
PAT4         153764     106049454
PAT5         160417     94241252
PAT6         149904     83291795
PAT7         106122     117785797
PAT8         145606     88613824
PAT9         126035     99775181
PHG          2983       19312487
PLN1         38878      116564385
PLN10        8          219884424
PLN11        38666      92362947
PLN12        74543      75342196
PLN13        76667      78688295
PLN14        55794      100602519
PLN15        35914      115966275
PLN16        49239      108562256
PLN17        36800      77371749
PLN2         1362       175094890
PLN3         2285       172053348
PLN4         69445      84961199
PLN5         74066      74125837
PLN6         30706      51851890
PLN7         11536      143299858
PLN8         1340       169669883
PLN9         448        201222619
PRI1         26761      125708376
PRI10        1449       182969149
PRI11        1282       179580593
PRI12        1531       177910610
PRI13        1596       179822119
PRI14        1558       183935603
PRI15        1226       192462039
PRI16        37452      129043891
PRI17        39951      83964844
PRI18        6205       172595206
PRI19        1655       184035289
PRI2         1561       172070707
PRI20        1808       183126764
PRI21        2977       180701978
PRI22        1334       183675641
PRI23        42327      109333303
PRI24        44240      72509594
PRI25        19487      124466622
PRI26        13131      165403989
PRI27        20266      154268182
PRI28        52093      114839589
PRI29        41903      122390043
PRI3         1310       186528867
PRI30        19741      26119917
PRI4         1310       183371515
PRI5         1191       181679460
PRI6         1208       178893695
PRI7         1229       181261074
PRI8         1358       174849086
PRI9         1210       175367676
ROD1         10261      167926123
ROD10        974        182231417
ROD11        1024       186826022
ROD12        969        183566938
ROD13        1017       186198234
ROD14        950        181245774
ROD15        963        182626599
ROD16        1054       186572876
ROD17        27928      143984023
ROD18        1162       190106690
ROD19        1213       193397925
ROD2         926        174045165
ROD20        4680       188238032
ROD21        43384      72606599
ROD22        13572      145805429
ROD23        38222      131418170
ROD24        9492       13641019
ROD3         904        173935314
ROD4         904        174048703
ROD5         928        173942945
ROD6         986        181467270
ROD7         970        179851482
ROD8         986        181596857
ROD9         1017       183467409
STS1         82037      35179831
STS10        58190      44487674
STS11        58023      43668346
STS12        74404      38649976
STS13        86885      38425370
STS14        15519      6078579
STS2         84081      44778319
STS3         76406      30850596
STS4         66887      33912765
STS5         54867      31983204
STS6         54730      32220183
STS7         54692      32192487
STS8         56387      38731734
STS9         58081      44560257
SYN          25918      37525798
UNA          207        112010
VRL1         72484      65894663
VRL2         72132      64894856
VRL3         69359      71005564
VRL4         66593      68788298
VRL5         71944      65867701
VRT1         41042      130913679
VRT10        48804      109174121
VRT2         37035      134204314
VRT3         52441      112434842
VRT4         59253      66328878
VRT5         12310      149682380
VRT6         1264       193151148
VRT7         1300       193056756
VRT8         14346      172980674
VRT9         13340      173821243

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 153.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries        Bases   Species

10232501 12158283745   Homo sapiens
6664504   8007185287   Mus musculus
1187583   5739315425   Rattus norvegicus
1560656   3441974419   Bos taurus
1049852   2414934924   Danio rerio
2740457   1904398496   Zea mays
1141026   1520160814   Oryza sativa (japonica cultivar-group)
215354    1244633980   Strongylocentrotus purpuratus
1179258    961507939   Xenopus tropicalis
1181222    903465758   Sus scrofa
1419254    827798107   Canis familiaris
536101     794653782   Drosophila melanogaster
1185506    739874683   Arabidopsis thaliana
787971     692393649   Gallus gallus
208532     611609739   Pan troglodytes
788133     466272907   Sorghum bicolor
397119     448061181   Medicago truncatula
69024      437325339   Macaca mulatta
696009     420715351   Ciona intestinalis
596267     406383159   Brassica oleracea

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 April 2006

                NCBI-GenBank Flat File Release 153.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 153.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
	Irene Fang, Linda Frisse, Michael Fetchko, Andrea Gocke, Amelie Gubitz
	Anjanette Johnston, Kellie Kelm, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
	Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
	Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Tony Stearman

User Support
	Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
	Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
	Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
	David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center