Release Notes For GenBank Release 155

GBREL.TXT          Genetic Sequence Data Bank
                         August 15 2006

               NCBI-GenBank Flat File Release 155.0

                    Distribution Release Notes

 61132599 loci, 65369091950 bases, from 61132599 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 155.0
1.2 Cutoff Date
1.3 Important Changes in Release 155.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 155.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 155.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.

1.2 Cutoff Date

  This full release, 155.0, incorporates data available to the collaborating
databases as of August 21, 2006 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 155.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 31 with this release:

  - the BCT division is now comprised of  16 files (+1)
  - the EST division is now comprised of 546 files (+18)
  - the ENV division is now comprised of   4 files (+1)
  - the GSS division is now comprised of 181 files (+4)
  - the HTC division is now comprised of  12 files (+2)
  - the HTG division is now comprised of  84 files (+1)
  - the MAM division is now comprised of   3 files (+1)
  - the PAT division is now comprised of  25 files (+1)
  - the PRI division is now comprised of  31 files (+1)
  - the ROD division is now comprised of  25 files (+1)

  Reminder: the Short-Directory 'index' file is now split into
  three pieces, as of GB 154 :

  gbsdr1.txt : non-EST and non-GSS short directory entries
  gbsdr2.txt : EST short directory entries
  gbsdr3.txt : GSS short directory entries

1.3.2 Index files gbjou.idx and gbkey.idx not available.

  Problems were encountered generating the journal and keyword 'index' files,
in spite of the recent changes which limit their content to non-EST and non-GSS
records (see Section 1.3.3 for a description of those changes).

  Because Release 155.0 was already late due to other (unrelated) issues, we
are making this release available without gbjou.idx and gbkey.idx . If possible,
we will provide them within a few days of 155.0's availability, and let users
know via the GenBank listserv.

1.3.3 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics since January 2005
seem to support this: the index files are transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI. GenBank 155.0 thus contains these ten index
files, which lack all EST and most GSS content:

	gbaut1.idx
	gbaut2.idx
	gbaut3.idx
	gbaut4.idx
	gbaut5.idx
	gbaut6.idx
	gbgen.idx
	gbjou.idx
	gbkey.idx
	gbsec.idx

  In addition, a version of gbacc.idx which encompasses the entirety of the
release was built manually, but note that the first field contains just an
accession number, rather than Accession.Version, and that the file is unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options within the next year:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank files, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
thirty-three of the GSS flatfiles in Release 155.0. Consider gbgss149.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                           August 15 2006

                NCBI-GenBank Flat File Release 155.0

                           GSS Sequences (Part 1)

   86836 loci,    64404216 bases, from    86836 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "149" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New protein residue abbreviation for Pyrrolysine

  Sequence databases use single-letter amino acid abbreviations to
record the primary structure (sequence) of amino acids in a polypeptide.
The table of abbreviations includes only those amino acids that are
encoded in the genetic code and directly inserted by a tRNA during the
process of protein translation.  Post-translational modifications are
not represented in the sequence data itself, but may be described by
features annotated on the sequence.

  The discovery of the 22nd naturally encoded amino acid, pyrrolysine,
and the recent submission of sequence records that should contain
this residue, require the adoption of a new amino acid abbreviation.
Because several letters are assigned to represent different experimental
ambiguities, the only letter still available for use is O (uppercase
letter o).  Scientists working in the field have independently suggested
use of this letter, and it has a reasonable mnemonic, pyrrOlysine.

  The IUPAC-IUBMB Joint Commission on Biochemical Nomenclature has agreed
that Pyl/O will be recommended for this amino acid.

  The consequences for flatfile users are that O will appear in CDS
/translation qualifiers, and that Pyl (the three-letter abbreviation)
will appear in CDS /transl_except qualifiers and in the /product and
/anticodon qualifiers of tRNA features. These changes will take effect
as of the October 2006 GenBank release.

  Sample records in ASN.1, FASTA, GenBank flatfile, and INSDSeq XML
formats will be made available on the NCBI ftp site for the purpose of
testing software prior to the public introduction of 'O' in protein
sequences.

  For BLAST and other sequence similarity search tools, we expect to map
pyrrolysine (O) to unknown (X), as is already done with selenocysteine
(U), the 21st naturally encoded amino acid.  One reason is that the PAM
and BLOSUM substitution matrices do not accommodate these more recently
discovered amino acids.  The other reason is that selenocysteine and
pyrrolysine both appear to be used as active sites in certain enzymes,
and thus do not simply substitute for cysteine or lysine.

  Here are a few literature references which provide more information
about pyrrolysine :

  G. Srinivasan, C. M. James, J. A. Krzycki.  Pyrrolysine encoded by
  UAG in Archaea: charging of a UAG-decoding specialized tRNA.  Science
  2002, 296:1459-1462.

  B. Hao, W. Gong, T.K. Ferguson, C.M. James, J.A. Krzycki, M.K.
  Chan.  A new UAG-encoded residue in the structure of a methanogen
  methyltransferase.  Science 2002, 296:1462-1466.

  C. Polycarpo, A. Ambrogelly, A. Berube, S.M. Winbush, J.A.
  McCloskey, P. F. Crain, J. L. Wood, D. Soll.  An aminoacyl-tRNA
  synthetase that specifically activates pyrrolysine.  Proc. Natl. Acad.
  Sci. (USA) 2004, 101:12450-12454.

  C. Fenske, G.J. Palm, W. Hinrichs.  How unique is the genetic code?
  Agnew. Chem. Int. Ed. 2003, 42:606-610.

1.4.2 Protein residue J for leucine/isoleucine ambiguities

  The residue abbreviation J is reserved for mass spectrometry experiments that
cannot distinguish leucine from isoleucine. Although this abbreviation has
been part of the IUPAC recommendations for some time, it has not previously
appeared in protein sequences in the GenBank database.

  As of October 2006, abbreviation J will be legal in CDS /translation
qualifiers, and Xle (the three-letter abbreviation) will be allowed in CDS
/transl_except qualifiers and in the /product and /anticodon qualifiers of
tRNA features.

  J will also be mapped to unknown (X) for the purpose of BLAST and other
sequence similarity search tools.

1.4.3 /PCR_primers and modified bases

  PCR primers are sometimes constructed which utilize modified bases,
such as those listed in the table of modified bases included in the
Feature Table document:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html#7.5.2

In October 2006, it will be legal to use modified-base abbreviations
for the /PCR_primers qualifier. For example:

         /PCR_primers="fwd_seq: gcagtt<i>caag<gal q>tggagtgaa, rev_seq:
         gcaacgtatcctccagagtgatcgb

Here, modified bases inosine and beta,D-galactosylqueosine are included
in the forward sequence of the primer pair, and enclosed between angle
brackets ( <...> ) .

Each pair of angle brackets will include only a single modified base
abbreviation.

1.4.4 Introduction of /mobile_element qualifier

  For repeat_region features, the /transposon and /insertion_seq
qualifiers can be used to describe two specific classes of mobile
elements. But not all mobile elements fall into these two categories,
so a new structured /mobile_element qualifier will be introduced
as of GenBank 155.0 in December 2006. The preliminary description
of the new qualifier is as follows:

  Qualifer: /mobile_element

  Description: Type, and name (or identifier), of the mobile element
  which is described by the parent feature.

  Value format: <mobile_element_type>:<mobile_element_id>
  Where mobile element type is one of the following: transposon,
  integron, insertion_sequence, other .

  Example: /mobile_element="transposon:Tnp9"

  Further details about this new qualifier, the domain of mobile element
types in particular, will be provided in these release notes and via the
GenBank newsgroup as they become available.

1.4.5 New /mol_type value

  A new legal molecule type value for viral cRNA sequences will be
introduced as of October 2006:

	/mol_type="viral cRNA"

  This value will also be legal for the molecule type field on the
LOCUS line of the GenBank flatfile format. Additional details about
the usage of this new molecule type value will be provided via
these release notes and the GenBank newsgroup.

1.4.6 Feature location syntax X.Y to be discontinued

  The Feature Table currently supports feature locations of the
format X.Y, to represent a base position which is greater or
equal to X, and less than or equal to Y. For example:

	misc_feature    1.10..20
	misc_feature    join(100..150,200.210..250)

  In the first example, the misc_feature starts somewhere between
bases 1 and 10 (inclusive), and ends at basepair 20. In the second,
the 51 bases from 100..150 are joined together with a second basepair
interval, which could be anywhere from 200..250 to 210..250 .

  Although this syntax seems like a reasonable way to capture an
uncertain interval, it is used for features on a vanishingly small
number of sequence records, most database submission mechanisms
don't support it, and the meaning of its use in a join() context
is not entirely clear.

  As of October 2006, this type of location will no longer be 
supported. Those records with features which utilize X.Y locations
will be reviewed and converted to a non-uncertain format prior to
that date.

1.4.7 /operon to become legal for rRNA features

  With the October 2006 GenBank release, the /operon qualifier will
be legal for use on rRNA features.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1010 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut2.idx - Index of the entries according to accession number, part 2.
4. gbaut3.idx - Index of the entries according to accession number, part 3.
5. gbaut4.idx - Index of the entries according to accession number, part 4.
6. gbaut5.idx - Index of the entries according to accession number, part 5.
7. gbaut6.idx - Index of the entries according to accession number, part 6.
8. gbaut7.idx - Index of the entries according to accession number, part 7.
9. gbbct1.seq - Bacterial sequence entries, part 1.
10. gbbct10.seq - Bacterial sequence entries, part 10.
11. gbbct11.seq - Bacterial sequence entries, part 11.
12. gbbct12.seq - Bacterial sequence entries, part 12.
13. gbbct13.seq - Bacterial sequence entries, part 13.
14. gbbct14.seq - Bacterial sequence entries, part 14.
15. gbbct15.seq - Bacterial sequence entries, part 15.
16. gbbct16.seq - Bacterial sequence entries, part 16.
17. gbbct2.seq - Bacterial sequence entries, part 2.
18. gbbct3.seq - Bacterial sequence entries, part 3.
19. gbbct4.seq - Bacterial sequence entries, part 4.
20. gbbct5.seq - Bacterial sequence entries, part 5.
21. gbbct6.seq - Bacterial sequence entries, part 6.
22. gbbct7.seq - Bacterial sequence entries, part 7.
23. gbbct8.seq - Bacterial sequence entries, part 8.
24. gbbct9.seq - Bacterial sequence entries, part 9.
25. gbchg.txt - Accession numbers of entries updated since the previous release.
26. gbcon1.seq - Constructed sequence entries, part 1.
27. gbcon2.seq - Constructed sequence entries, part 2.
28. gbcon3.seq - Constructed sequence entries, part 3.
29. gbdel.txt - Accession numbers of entries deleted since the previous release.
30. gbenv1.seq - Environmental sampling sequence entries, part 1.
31. gbenv2.seq - Environmental sampling sequence entries, part 2.
32. gbenv3.seq - Environmental sampling sequence entries, part 3.
33. gbenv4.seq - Environmental sampling sequence entries, part 4.
34. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
35. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
36. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
37. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
38. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
39. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
40. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
41. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
42. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
43. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
44. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
45. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
46. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
47. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
48. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
49. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
50. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
51. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
52. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
53. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
54. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
55. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
56. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
57. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
58. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
59. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
60. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
61. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
62. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
63. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
64. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
65. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
66. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
67. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
68. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
69. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
70. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
71. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
72. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
73. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
74. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
75. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
76. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
77. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
78. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
79. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
80. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
81. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
82. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
83. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
84. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
85. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
86. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
87. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
88. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
89. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
90. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
91. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
92. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
93. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
94. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
95. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
96. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
97. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
98. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
99. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
100. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
101. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
102. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
103. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
104. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
105. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
106. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
107. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
108. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
109. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
110. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
111. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
112. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
113. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
114. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
115. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
116. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
117. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
118. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
119. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
120. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
121. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
122. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
123. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
124. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
125. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
126. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
127. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
128. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
129. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
130. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
131. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
132. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
133. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
134. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
135. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
136. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
137. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
138. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
139. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
140. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
141. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
142. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
143. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
144. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
145. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
146. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
147. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
148. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
149. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
150. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
151. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
152. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
153. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
154. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
155. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
156. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
157. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
158. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
159. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
160. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
161. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
162. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
163. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
164. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
165. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
166. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
167. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
168. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
169. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
170. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
171. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
172. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
173. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
174. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
175. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
176. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
177. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
178. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
179. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
180. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
181. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
182. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
183. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
184. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
185. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
186. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
187. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
188. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
189. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
190. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
191. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
192. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
193. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
194. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
195. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
196. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
197. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
198. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
199. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
200. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
201. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
202. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
203. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
204. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
205. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
206. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
207. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
208. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
209. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
210. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
211. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
212. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
213. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
214. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
215. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
216. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
217. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
218. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
219. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
220. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
221. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
222. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
223. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
224. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
225. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
226. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
227. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
228. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
229. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
230. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
231. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
232. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
233. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
234. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
235. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
236. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
237. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
238. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
239. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
240. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
241. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
242. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
243. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
244. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
245. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
246. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
247. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
248. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
249. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
250. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
251. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
252. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
253. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
254. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
255. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
256. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
257. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
258. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
259. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
260. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
261. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
262. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
263. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
264. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
265. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
266. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
267. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
268. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
269. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
270. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
271. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
272. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
273. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
274. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
275. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
276. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
277. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
278. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
279. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
280. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
281. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
282. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
283. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
284. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
285. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
286. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
287. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
288. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
289. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
290. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
291. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
292. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
293. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
294. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
295. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
296. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
297. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
298. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
299. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
300. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
301. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
302. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
303. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
304. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
305. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
306. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
307. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
308. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
309. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
310. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
311. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
312. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
313. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
314. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
315. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
316. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
317. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
318. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
319. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
320. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
321. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
322. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
323. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
324. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
325. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
326. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
327. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
328. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
329. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
330. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
331. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
332. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
333. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
334. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
335. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
336. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
337. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
338. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
339. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
340. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
341. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
342. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
343. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
344. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
345. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
346. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
347. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
348. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
349. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
350. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
351. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
352. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
353. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
354. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
355. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
356. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
357. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
358. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
359. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
360. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
361. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
362. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
363. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
364. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
365. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
366. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
367. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
368. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
369. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
370. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
371. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
372. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
373. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
374. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
375. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
376. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
377. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
378. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
379. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
380. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
381. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
382. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
383. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
384. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
385. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
386. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
387. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
388. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
389. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
390. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
391. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
392. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
393. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
394. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
395. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
396. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
397. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
398. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
399. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
400. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
401. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
402. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
403. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
404. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
405. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
406. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
407. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
408. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
409. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
410. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
411. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
412. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
413. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
414. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
415. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
416. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
417. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
418. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
419. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
420. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
421. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
422. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
423. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
424. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
425. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
426. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
427. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
428. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
429. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
430. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
431. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
432. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
433. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
434. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
435. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
436. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
437. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
438. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
439. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
440. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
441. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
442. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
443. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
444. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
445. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
446. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
447. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
448. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
449. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
450. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
451. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
452. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
453. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
454. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
455. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
456. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
457. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
458. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
459. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
460. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
461. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
462. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
463. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
464. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
465. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
466. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
467. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
468. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
469. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
470. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
471. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
472. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
473. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
474. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
475. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
476. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
477. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
478. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
479. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
480. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
481. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
482. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
483. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
484. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
485. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
486. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
487. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
488. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
489. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
490. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
491. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
492. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
493. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
494. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
495. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
496. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
497. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
498. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
499. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
500. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
501. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
502. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
503. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
504. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
505. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
506. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
507. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
508. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
509. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
510. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
511. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
512. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
513. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
514. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
515. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
516. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
517. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
518. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
519. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
520. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
521. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
522. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
523. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
524. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
525. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
526. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
527. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
528. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
529. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
530. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
531. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
532. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
533. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
534. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
535. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
536. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
537. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
538. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
539. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
540. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
541. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
542. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
543. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
544. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
545. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
546. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
547. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
548. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
549. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
550. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
551. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
552. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
553. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
554. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
555. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
556. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
557. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
558. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
559. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
560. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
561. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
562. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
563. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
564. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
565. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
566. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
567. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
568. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
569. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
570. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
571. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
572. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
573. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
574. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
575. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
576. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
577. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
578. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
579. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
580. gbgen.idx - Index of the entries according to gene symbols.
581. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
582. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
583. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
584. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
585. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
586. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
587. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
588. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
589. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
590. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
591. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
592. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
593. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
594. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
595. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
596. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
597. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
598. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
599. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
600. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
601. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
602. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
603. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
604. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
605. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
606. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
607. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
608. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
609. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
610. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
611. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
612. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
613. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
614. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
615. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
616. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
617. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
618. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
619. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
620. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
621. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
622. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
623. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
624. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
625. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
626. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
627. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
628. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
629. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
630. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
631. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
632. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
633. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
634. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
635. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
636. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
637. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
638. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
639. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
640. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
641. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
642. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
643. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
644. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
645. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
646. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
647. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
648. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
649. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
650. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
651. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
652. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
653. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
654. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
655. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
656. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
657. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
658. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
659. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
660. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
661. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
662. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
663. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
664. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
665. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
666. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
667. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
668. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
669. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
670. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
671. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
672. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
673. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
674. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
675. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
676. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
677. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
678. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
679. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
680. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
681. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
682. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
683. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
684. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
685. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
686. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
687. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
688. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
689. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
690. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
691. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
692. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
693. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
694. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
695. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
696. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
697. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
698. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
699. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
700. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
701. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
702. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
703. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
704. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
705. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
706. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
707. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
708. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
709. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
710. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
711. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
712. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
713. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
714. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
715. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
716. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
717. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
718. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
719. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
720. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
721. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
722. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
723. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
724. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
725. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
726. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
727. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
728. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
729. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
730. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
731. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
732. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
733. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
734. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
735. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
736. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
737. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
738. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
739. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
740. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
741. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
742. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
743. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
744. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
745. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
746. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
747. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
748. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
749. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
750. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
751. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
752. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
753. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
754. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
755. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
756. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
757. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
758. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
759. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
760. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
761. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
762. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
763. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
764. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
765. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
766. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
767. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
768. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
769. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
770. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
771. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
772. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
773. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
774. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
775. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
776. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
777. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
778. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
779. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
780. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
781. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
782. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
783. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
784. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
785. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
786. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
787. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
788. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
789. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
790. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
791. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
792. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
793. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
794. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
795. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
796. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
797. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
798. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
799. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
800. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
801. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
802. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
803. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
804. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
805. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
806. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
807. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
808. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
809. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
810. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
811. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
812. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
813. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
814. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
815. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
816. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
817. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
818. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
819. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
820. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
821. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
822. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
823. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
824. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
825. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
826. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
827. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
828. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
829. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
830. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
831. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
832. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
833. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
834. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
835. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
836. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
837. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
838. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
839. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
840. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
841. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
842. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
843. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
844. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
845. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
846. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
847. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
848. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
849. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
850. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
851. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
852. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
853. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
854. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
855. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
856. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
857. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
858. gbinv1.seq - Invertebrate sequence entries, part 1.
859. gbinv2.seq - Invertebrate sequence entries, part 2.
860. gbinv3.seq - Invertebrate sequence entries, part 3.
861. gbinv4.seq - Invertebrate sequence entries, part 4.
862. gbinv5.seq - Invertebrate sequence entries, part 5.
863. gbinv6.seq - Invertebrate sequence entries, part 6.
864. gbinv7.seq - Invertebrate sequence entries, part 7.
865. gbinv8.seq - Invertebrate sequence entries, part 8.
866. gbinv9.seq - Invertebrate sequence entries, part 9.
867. gbjou.idx - Index of the entries according to journal citation.
868. gbkey.idx - Index of the entries according to keyword phrase.
869. gbmam1.seq - Other mammalian sequence entries, part 1.
870. gbmam2.seq - Other mammalian sequence entries, part 2.
871. gbmam3.seq - Other mammalian sequence entries, part 3.
872. gbnew.txt - Accession numbers of entries new since the previous release.
873. gbpat1.seq - Patent sequence entries, part 1.
874. gbpat10.seq - Patent sequence entries, part 10.
875. gbpat11.seq - Patent sequence entries, part 11.
876. gbpat12.seq - Patent sequence entries, part 12.
877. gbpat13.seq - Patent sequence entries, part 13.
878. gbpat14.seq - Patent sequence entries, part 14.
879. gbpat15.seq - Patent sequence entries, part 15.
880. gbpat16.seq - Patent sequence entries, part 16.
881. gbpat17.seq - Patent sequence entries, part 17.
882. gbpat18.seq - Patent sequence entries, part 18.
883. gbpat19.seq - Patent sequence entries, part 19.
884. gbpat2.seq - Patent sequence entries, part 2.
885. gbpat20.seq - Patent sequence entries, part 20.
886. gbpat21.seq - Patent sequence entries, part 21.
887. gbpat22.seq - Patent sequence entries, part 22.
888. gbpat23.seq - Patent sequence entries, part 23.
889. gbpat24.seq - Patent sequence entries, part 24.
890. gbpat25.seq - Patent sequence entries, part 25.
891. gbpat3.seq - Patent sequence entries, part 3.
892. gbpat4.seq - Patent sequence entries, part 4.
893. gbpat5.seq - Patent sequence entries, part 5.
894. gbpat6.seq - Patent sequence entries, part 6.
895. gbpat7.seq - Patent sequence entries, part 7.
896. gbpat8.seq - Patent sequence entries, part 8.
897. gbpat9.seq - Patent sequence entries, part 9.
898. gbphg.seq - Phage sequence entries.
899. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
900. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
901. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
902. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
903. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
904. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
905. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
906. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
907. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
908. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
909. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
910. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
911. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
912. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
913. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
914. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
915. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
916. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
917. gbpri1.seq - Primate sequence entries, part 1.
918. gbpri10.seq - Primate sequence entries, part 10.
919. gbpri11.seq - Primate sequence entries, part 11.
920. gbpri12.seq - Primate sequence entries, part 12.
921. gbpri13.seq - Primate sequence entries, part 13.
922. gbpri14.seq - Primate sequence entries, part 14.
923. gbpri15.seq - Primate sequence entries, part 15.
924. gbpri16.seq - Primate sequence entries, part 16.
925. gbpri17.seq - Primate sequence entries, part 17.
926. gbpri18.seq - Primate sequence entries, part 18.
927. gbpri19.seq - Primate sequence entries, part 19.
928. gbpri2.seq - Primate sequence entries, part 2.
929. gbpri20.seq - Primate sequence entries, part 20.
930. gbpri21.seq - Primate sequence entries, part 21.
931. gbpri22.seq - Primate sequence entries, part 22.
932. gbpri23.seq - Primate sequence entries, part 23.
933. gbpri24.seq - Primate sequence entries, part 24.
934. gbpri25.seq - Primate sequence entries, part 25.
935. gbpri26.seq - Primate sequence entries, part 26.
936. gbpri27.seq - Primate sequence entries, part 27.
937. gbpri28.seq - Primate sequence entries, part 28.
938. gbpri29.seq - Primate sequence entries, part 29.
939. gbpri3.seq - Primate sequence entries, part 3.
940. gbpri30.seq - Primate sequence entries, part 30.
941. gbpri31.seq - Primate sequence entries, part 31.
942. gbpri4.seq - Primate sequence entries, part 4.
943. gbpri5.seq - Primate sequence entries, part 5.
944. gbpri6.seq - Primate sequence entries, part 6.
945. gbpri7.seq - Primate sequence entries, part 7.
946. gbpri8.seq - Primate sequence entries, part 8.
947. gbpri9.seq - Primate sequence entries, part 9.
948. gbrel.txt - Release notes (this document).
949. gbrod1.seq - Rodent sequence entries, part 1.
950. gbrod10.seq - Rodent sequence entries, part 10.
951. gbrod11.seq - Rodent sequence entries, part 11.
952. gbrod12.seq - Rodent sequence entries, part 12.
953. gbrod13.seq - Rodent sequence entries, part 13.
954. gbrod14.seq - Rodent sequence entries, part 14.
955. gbrod15.seq - Rodent sequence entries, part 15.
956. gbrod16.seq - Rodent sequence entries, part 16.
957. gbrod17.seq - Rodent sequence entries, part 17.
958. gbrod18.seq - Rodent sequence entries, part 18.
959. gbrod19.seq - Rodent sequence entries, part 19.
960. gbrod2.seq - Rodent sequence entries, part 2.
961. gbrod20.seq - Rodent sequence entries, part 20.
962. gbrod21.seq - Rodent sequence entries, part 21.
963. gbrod22.seq - Rodent sequence entries, part 22.
964. gbrod23.seq - Rodent sequence entries, part 23.
965. gbrod24.seq - Rodent sequence entries, part 24.
966. gbrod25.seq - Rodent sequence entries, part 25.
967. gbrod3.seq - Rodent sequence entries, part 3.
968. gbrod4.seq - Rodent sequence entries, part 4.
969. gbrod5.seq - Rodent sequence entries, part 5.
970. gbrod6.seq - Rodent sequence entries, part 6.
971. gbrod7.seq - Rodent sequence entries, part 7.
972. gbrod8.seq - Rodent sequence entries, part 8.
973. gbrod9.seq - Rodent sequence entries, part 9.
974. gbsdr1.txt - Short directory of the data bank, part 1.
975. gbsdr2.txt - Short directory of the data bank, part 2.
976. gbsdr3.txt - Short directory of the data bank, part 3.
977. gbsec.idx - Index of the entries according to secondary accession number.
978. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
979. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
980. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
981. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
982. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
983. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
984. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
985. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
986. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
987. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
988. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
989. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
990. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
991. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
992. gbsyn.seq - Synthetic and chimeric sequence entries.
993. gbuna.seq - Unannotated sequence entries.
994. gbvrl1.seq - Viral sequence entries, part 1.
995. gbvrl2.seq - Viral sequence entries, part 2.
996. gbvrl3.seq - Viral sequence entries, part 3.
997. gbvrl4.seq - Viral sequence entries, part 4.
998. gbvrl5.seq - Viral sequence entries, part 5.
999. gbvrl6.seq - Viral sequence entries, part 6.
1000. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1001. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1002. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1003. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1004. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1005. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1006. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1007. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1008. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1009. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1010. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 155.0 flatfiles require roughly 230 GB (sequence
files only) or 240 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1887731942     gbacc.idx
 500333738     gbaut1.idx
 511473313     gbaut2.idx
 500888300     gbaut3.idx
 500085819     gbaut4.idx
 500926572     gbaut5.idx
 501697876     gbaut6.idx
 464881798     gbaut7.idx
 250005208     gbbct1.seq
 252636586     gbbct10.seq
 250750358     gbbct11.seq
 254860814     gbbct12.seq
 252021125     gbbct13.seq
 250000733     gbbct14.seq
 250244200     gbbct15.seq
 106147831     gbbct16.seq
 250032879     gbbct2.seq
 250892678     gbbct3.seq
 250001152     gbbct4.seq
 253715156     gbbct5.seq
 250001840     gbbct6.seq
 257552911     gbbct7.seq
 255533949     gbbct8.seq
 252700943     gbbct9.seq
  46250949     gbchg.txt
  95263511     gbcon1.seq
 870177754     gbcon2.seq
1325786804     gbcon3.seq
     15578     gbdel.txt
 250075599     gbenv1.seq
 250002071     gbenv2.seq
 250000546     gbenv3.seq
   5761912     gbenv4.seq
 230688413     gbest1.seq
 230689410     gbest10.seq
 230688905     gbest100.seq
 230688543     gbest101.seq
 230687636     gbest102.seq
 230689741     gbest103.seq
 230689191     gbest104.seq
 230688498     gbest105.seq
 230691053     gbest106.seq
 230688247     gbest107.seq
 230687791     gbest108.seq
 230688102     gbest109.seq
 230688482     gbest11.seq
 230687960     gbest110.seq
 230687758     gbest111.seq
 230689636     gbest112.seq
 230689934     gbest113.seq
 230673277     gbest114.seq
 230690249     gbest115.seq
 230689811     gbest116.seq
 230687809     gbest117.seq
 230688359     gbest118.seq
 230688542     gbest119.seq
 230688289     gbest12.seq
 230687844     gbest120.seq
 230689035     gbest121.seq
 230690496     gbest122.seq
 230688849     gbest123.seq
 230688644     gbest124.seq
 230689415     gbest125.seq
 230687834     gbest126.seq
 230690709     gbest127.seq
 230688858     gbest128.seq
 230689937     gbest129.seq
 230688229     gbest13.seq
 230689204     gbest130.seq
 230687786     gbest131.seq
 230689089     gbest132.seq
 230688884     gbest133.seq
 230691153     gbest134.seq
 230689024     gbest135.seq
 230689286     gbest136.seq
 230688951     gbest137.seq
 230689243     gbest138.seq
 230688534     gbest139.seq
 230688619     gbest14.seq
 230688156     gbest140.seq
 230689017     gbest141.seq
 230687539     gbest142.seq
 230689487     gbest143.seq
 230687991     gbest144.seq
 230688726     gbest145.seq
 230689056     gbest146.seq
 230688008     gbest147.seq
 230687844     gbest148.seq
 230689654     gbest149.seq
 230687763     gbest15.seq
 230687539     gbest150.seq
 230689541     gbest151.seq
 230688143     gbest152.seq
 230690166     gbest153.seq
 230689383     gbest154.seq
 230689758     gbest155.seq
 230687655     gbest156.seq
 230690362     gbest157.seq
 230688123     gbest158.seq
 230689293     gbest159.seq
 230689014     gbest16.seq
 230689760     gbest160.seq
 230687512     gbest161.seq
 230690759     gbest162.seq
 230689014     gbest163.seq
 230691267     gbest164.seq
 230689961     gbest165.seq
 230689170     gbest166.seq
 230690316     gbest167.seq
 230687566     gbest168.seq
 230687507     gbest169.seq
 230687500     gbest17.seq
 230688168     gbest170.seq
 230688667     gbest171.seq
 230687906     gbest172.seq
 230688024     gbest173.seq
 230687569     gbest174.seq
 222017943     gbest175.seq
 230689999     gbest176.seq
 230688856     gbest177.seq
 230687532     gbest178.seq
 230687953     gbest179.seq
 230689139     gbest18.seq
 230689260     gbest180.seq
 230690812     gbest181.seq
 230690430     gbest182.seq
 230690225     gbest183.seq
 230689723     gbest184.seq
 230689568     gbest185.seq
 230690047     gbest186.seq
 230689311     gbest187.seq
 230689628     gbest188.seq
 230689799     gbest189.seq
 230689779     gbest19.seq
 230687876     gbest190.seq
 230688577     gbest191.seq
 230689052     gbest192.seq
 230687507     gbest193.seq
 230688913     gbest194.seq
 230688516     gbest195.seq
 230690441     gbest196.seq
 230688293     gbest197.seq
 230690669     gbest198.seq
 230687790     gbest199.seq
 230688569     gbest2.seq
 230689756     gbest20.seq
 230688382     gbest200.seq
 230688638     gbest201.seq
 230687790     gbest202.seq
 230689941     gbest203.seq
 230689207     gbest204.seq
 230689599     gbest205.seq
 230690893     gbest206.seq
 230688902     gbest207.seq
 230687967     gbest208.seq
 230688555     gbest209.seq
 230692076     gbest21.seq
 230687899     gbest210.seq
 230687773     gbest211.seq
 230689207     gbest212.seq
 230690052     gbest213.seq
 230688250     gbest214.seq
 230687785     gbest215.seq
 230687963     gbest216.seq
 230689220     gbest217.seq
 230689676     gbest218.seq
 230690682     gbest219.seq
 230688204     gbest22.seq
 230689991     gbest220.seq
 230688495     gbest221.seq
 230689630     gbest222.seq
 230688797     gbest223.seq
 230689350     gbest224.seq
 189561650     gbest225.seq
 162774211     gbest226.seq
 163214480     gbest227.seq
 171090759     gbest228.seq
 169739615     gbest229.seq
 230689102     gbest23.seq
 164352081     gbest230.seq
 165266653     gbest231.seq
 164833201     gbest232.seq
 164067230     gbest233.seq
 164689983     gbest234.seq
 164220339     gbest235.seq
 164236015     gbest236.seq
 163123971     gbest237.seq
 168251233     gbest238.seq
 162715224     gbest239.seq
 230689793     gbest24.seq
 162788262     gbest240.seq
 166800921     gbest241.seq
 168128455     gbest242.seq
 165991590     gbest243.seq
 165786203     gbest244.seq
 165484964     gbest245.seq
 165250992     gbest246.seq
 164411328     gbest247.seq
 164262934     gbest248.seq
 165001350     gbest249.seq
 230690001     gbest25.seq
 164754116     gbest250.seq
 179104346     gbest251.seq
 173541220     gbest252.seq
 180130580     gbest253.seq
 230689352     gbest254.seq
 230688522     gbest255.seq
 230688707     gbest256.seq
 230687850     gbest257.seq
 230689057     gbest258.seq
 230690361     gbest259.seq
 230689694     gbest26.seq
 230689851     gbest260.seq
 230688939     gbest261.seq
 230688168     gbest262.seq
 230691078     gbest263.seq
 230689791     gbest264.seq
 230688308     gbest265.seq
 230688281     gbest266.seq
 230687533     gbest267.seq
 230691543     gbest268.seq
 230689116     gbest269.seq
 230688899     gbest27.seq
 230687910     gbest270.seq
 230689202     gbest271.seq
 230688579     gbest272.seq
 230689175     gbest273.seq
 230689826     gbest274.seq
 230689348     gbest275.seq
 230689481     gbest276.seq
 230689410     gbest277.seq
 230687552     gbest278.seq
 230688725     gbest279.seq
 230688835     gbest28.seq
 230688274     gbest280.seq
 230688270     gbest281.seq
 230690338     gbest282.seq
 230688244     gbest283.seq
 230689447     gbest284.seq
 207575484     gbest285.seq
 230691279     gbest286.seq
 230690139     gbest287.seq
 230688058     gbest288.seq
 230690155     gbest289.seq
 230689662     gbest29.seq
 230689152     gbest290.seq
 230687898     gbest291.seq
 230689427     gbest292.seq
 230690385     gbest293.seq
 230688195     gbest294.seq
 230688335     gbest295.seq
 230689484     gbest296.seq
 230688628     gbest297.seq
 230688677     gbest298.seq
 230688023     gbest299.seq
 230690160     gbest3.seq
 230688091     gbest30.seq
 230688944     gbest300.seq
 230688942     gbest301.seq
 230688526     gbest302.seq
 230689704     gbest303.seq
 230689546     gbest304.seq
 230689985     gbest305.seq
 230688060     gbest306.seq
 230688454     gbest307.seq
 230689889     gbest308.seq
 230689239     gbest309.seq
 230690812     gbest31.seq
 230687541     gbest310.seq
 230691177     gbest311.seq
 230687576     gbest312.seq
 230691361     gbest313.seq
 230691519     gbest314.seq
 230691141     gbest315.seq
 230690267     gbest316.seq
 230688465     gbest317.seq
 230688072     gbest318.seq
 230689538     gbest319.seq
 230689150     gbest32.seq
 230688792     gbest320.seq
 230688606     gbest321.seq
 230687855     gbest322.seq
 230688693     gbest323.seq
 230688316     gbest324.seq
 230689015     gbest325.seq
 230689406     gbest326.seq
 230688748     gbest327.seq
 230689641     gbest328.seq
 230690887     gbest329.seq
 230687535     gbest33.seq
 230688563     gbest330.seq
 230688802     gbest331.seq
 230688963     gbest332.seq
 230690491     gbest333.seq
 230687497     gbest334.seq
 216211708     gbest335.seq
 230690947     gbest336.seq
 230689324     gbest337.seq
 230690221     gbest338.seq
 230690628     gbest339.seq
 230688817     gbest34.seq
 230689367     gbest340.seq
 180532185     gbest341.seq
 150735750     gbest342.seq
 230689653     gbest343.seq
 230691584     gbest344.seq
 230688383     gbest345.seq
 230689954     gbest346.seq
 230689633     gbest347.seq
 230687555     gbest348.seq
 230687856     gbest349.seq
 230688019     gbest35.seq
 230691425     gbest350.seq
 230687533     gbest351.seq
 230689127     gbest352.seq
 230688308     gbest353.seq
 230691075     gbest354.seq
 230689304     gbest355.seq
 230691046     gbest356.seq
 230691081     gbest357.seq
 230688573     gbest358.seq
 230688369     gbest359.seq
 230687884     gbest36.seq
 230687554     gbest360.seq
 230689721     gbest361.seq
 230687689     gbest362.seq
 230690380     gbest363.seq
 229631944     gbest364.seq
 230690633     gbest365.seq
 230687749     gbest366.seq
 230688079     gbest367.seq
 230688031     gbest368.seq
 230690078     gbest369.seq
 230687807     gbest37.seq
 230689942     gbest370.seq
 230689299     gbest371.seq
 230690344     gbest372.seq
 230690631     gbest373.seq
 230689001     gbest374.seq
 230689115     gbest375.seq
 230690400     gbest376.seq
 230689647     gbest377.seq
 230691592     gbest378.seq
 230688129     gbest379.seq
 230689002     gbest38.seq
 230690309     gbest380.seq
 230689000     gbest381.seq
 230687718     gbest382.seq
 230688820     gbest383.seq
 230690701     gbest384.seq
 230688944     gbest385.seq
 230691405     gbest386.seq
 230688272     gbest387.seq
 222715625     gbest388.seq
 230688050     gbest389.seq
 230689121     gbest39.seq
 230691224     gbest390.seq
 230689335     gbest391.seq
 230688109     gbest392.seq
 230688621     gbest393.seq
 230688074     gbest394.seq
 223670963     gbest395.seq
 230689143     gbest396.seq
 230691268     gbest397.seq
 230687661     gbest398.seq
 230687527     gbest399.seq
 230687668     gbest4.seq
 230688548     gbest40.seq
 230690280     gbest400.seq
 230690675     gbest401.seq
 230690582     gbest402.seq
 230690585     gbest403.seq
 230691463     gbest404.seq
 230687519     gbest405.seq
 230692408     gbest406.seq
 230688171     gbest407.seq
 230688823     gbest408.seq
 230690884     gbest409.seq
 230687945     gbest41.seq
 230690807     gbest410.seq
 230689144     gbest411.seq
 230690032     gbest412.seq
 210684913     gbest413.seq
 210256761     gbest414.seq
 210153345     gbest415.seq
 210337454     gbest416.seq
 210296682     gbest417.seq
 210482207     gbest418.seq
 211094549     gbest419.seq
 222732251     gbest42.seq
 211667313     gbest420.seq
 211449139     gbest421.seq
 211546077     gbest422.seq
 213966179     gbest423.seq
 211533486     gbest424.seq
 210596392     gbest425.seq
 210696569     gbest426.seq
 210801135     gbest427.seq
 210181255     gbest428.seq
 210189950     gbest429.seq
 192370513     gbest43.seq
 210225526     gbest430.seq
 210042189     gbest431.seq
 215339177     gbest432.seq
 230687940     gbest433.seq
 230688283     gbest434.seq
 230690014     gbest435.seq
 230687562     gbest436.seq
 230690107     gbest437.seq
 230690368     gbest438.seq
 230691238     gbest439.seq
 191875225     gbest44.seq
 230688113     gbest440.seq
 230688604     gbest441.seq
 230687862     gbest442.seq
 230689150     gbest443.seq
 230688879     gbest444.seq
 230691136     gbest445.seq
 230689565     gbest446.seq
 230688930     gbest447.seq
 230688852     gbest448.seq
 230690702     gbest449.seq
 215236461     gbest45.seq
 230690732     gbest450.seq
 230688501     gbest451.seq
 230690275     gbest452.seq
 230689339     gbest453.seq
 230689302     gbest454.seq
 230688536     gbest455.seq
 230691400     gbest456.seq
 230689970     gbest457.seq
 230689124     gbest458.seq
 230689503     gbest459.seq
 216203855     gbest46.seq
 230687742     gbest460.seq
 230690363     gbest461.seq
 230688286     gbest462.seq
 230688995     gbest463.seq
 230687544     gbest464.seq
 230689910     gbest465.seq
 230688613     gbest466.seq
 230691349     gbest467.seq
 230689602     gbest468.seq
 230690908     gbest469.seq
 215869013     gbest47.seq
 230688370     gbest470.seq
 230688812     gbest471.seq
 230690984     gbest472.seq
 230688646     gbest473.seq
 230688840     gbest474.seq
 230690358     gbest475.seq
 230690328     gbest476.seq
 230688073     gbest477.seq
 230687507     gbest478.seq
 230687763     gbest479.seq
 216960744     gbest48.seq
 230688890     gbest480.seq
 230691781     gbest481.seq
 230689192     gbest482.seq
 230687838     gbest483.seq
 230688442     gbest484.seq
 230689606     gbest485.seq
 230689918     gbest486.seq
 230689319     gbest487.seq
 230689080     gbest488.seq
 230688514     gbest489.seq
 230687688     gbest49.seq
 230688710     gbest490.seq
 230688098     gbest491.seq
 225321089     gbest492.seq
 230691666     gbest493.seq
 230687724     gbest494.seq
 230688412     gbest495.seq
 230687617     gbest496.seq
 230689988     gbest497.seq
 230688500     gbest498.seq
 230688353     gbest499.seq
 164127827     gbest5.seq
 230688381     gbest50.seq
 230687933     gbest500.seq
 230691150     gbest501.seq
 230687802     gbest502.seq
 230687641     gbest503.seq
 196055448     gbest504.seq
 217214521     gbest505.seq
 230689949     gbest506.seq
 230688595     gbest507.seq
 230689310     gbest508.seq
 230689292     gbest509.seq
 224403268     gbest51.seq
 230688360     gbest510.seq
 230689229     gbest511.seq
 230688827     gbest512.seq
 230690324     gbest513.seq
 230688304     gbest514.seq
 230688292     gbest515.seq
 230688683     gbest516.seq
 230688558     gbest517.seq
 230688280     gbest518.seq
 230690251     gbest519.seq
 230689824     gbest52.seq
 230687991     gbest520.seq
 230688679     gbest521.seq
 230688995     gbest522.seq
 228754599     gbest523.seq
 218169478     gbest524.seq
 230688378     gbest525.seq
 230687927     gbest526.seq
 230688559     gbest527.seq
 230688358     gbest528.seq
 230688468     gbest529.seq
 230688722     gbest53.seq
 230687566     gbest530.seq
 230687947     gbest531.seq
 230687908     gbest532.seq
 230690655     gbest533.seq
 230687955     gbest534.seq
 230688227     gbest535.seq
 230687953     gbest536.seq
 230689495     gbest537.seq
 229655452     gbest538.seq
 230689373     gbest539.seq
 230691187     gbest54.seq
 230690704     gbest540.seq
 230688885     gbest541.seq
 230690117     gbest542.seq
 230688387     gbest543.seq
 230688785     gbest544.seq
 230690881     gbest545.seq
  87138789     gbest546.seq
 230688590     gbest55.seq
 230688259     gbest56.seq
 230690410     gbest57.seq
 230691647     gbest58.seq
 230688466     gbest59.seq
 177450586     gbest6.seq
 230689150     gbest60.seq
 230687856     gbest61.seq
 230687909     gbest62.seq
 230687716     gbest63.seq
 230691866     gbest64.seq
 230690143     gbest65.seq
 230688211     gbest66.seq
 230687950     gbest67.seq
 209685318     gbest68.seq
 209421994     gbest69.seq
 230687876     gbest7.seq
 208477430     gbest70.seq
 209145026     gbest71.seq
 209844462     gbest72.seq
 210242705     gbest73.seq
 209599870     gbest74.seq
 208456813     gbest75.seq
 210228695     gbest76.seq
 208330905     gbest77.seq
 205431204     gbest78.seq
 208527781     gbest79.seq
 230687875     gbest8.seq
 208043663     gbest80.seq
 211332037     gbest81.seq
 226310984     gbest82.seq
 230692737     gbest83.seq
 230692246     gbest84.seq
 220626103     gbest85.seq
 214653924     gbest86.seq
 213918219     gbest87.seq
 230687549     gbest88.seq
 230688710     gbest89.seq
 230688341     gbest9.seq
 230688607     gbest90.seq
 230689804     gbest91.seq
 230688727     gbest92.seq
 230687546     gbest93.seq
 230687697     gbest94.seq
 230688547     gbest95.seq
 230688403     gbest96.seq
 230690347     gbest97.seq
 230687632     gbest98.seq
 230688831     gbest99.seq
  55966830     gbgen.idx
 230688077     gbgss1.seq
 230689730     gbgss10.seq
 228038693     gbgss100.seq
 227980545     gbgss101.seq
 228598143     gbgss102.seq
 228612310     gbgss103.seq
 228212424     gbgss104.seq
 227703233     gbgss105.seq
 230688645     gbgss106.seq
 230689412     gbgss107.seq
 230688127     gbgss108.seq
 230687770     gbgss109.seq
 230689992     gbgss11.seq
 230688807     gbgss110.seq
 230687869     gbgss111.seq
 230689841     gbgss112.seq
 230689642     gbgss113.seq
 230690244     gbgss114.seq
 230689402     gbgss115.seq
 230688638     gbgss116.seq
 230689369     gbgss117.seq
 230687504     gbgss118.seq
 230688950     gbgss119.seq
 230689920     gbgss12.seq
 230689210     gbgss120.seq
 230690029     gbgss121.seq
 230687718     gbgss122.seq
 230688247     gbgss123.seq
 230688225     gbgss124.seq
 230687526     gbgss125.seq
 230689005     gbgss126.seq
 230690365     gbgss127.seq
 230689865     gbgss128.seq
 230688306     gbgss129.seq
 230689812     gbgss13.seq
 230688630     gbgss130.seq
 230689828     gbgss131.seq
 230688699     gbgss132.seq
 230689040     gbgss133.seq
 230688288     gbgss134.seq
 230688154     gbgss135.seq
 230688152     gbgss136.seq
 230688075     gbgss137.seq
 230689026     gbgss138.seq
 230689742     gbgss139.seq
 230687711     gbgss14.seq
 230688439     gbgss140.seq
 230689303     gbgss141.seq
 230690220     gbgss142.seq
 230687464     gbgss143.seq
 224282746     gbgss144.seq
 230688045     gbgss145.seq
 230687893     gbgss146.seq
 203757438     gbgss147.seq
 127375547     gbgss148.seq
 250002654     gbgss149.seq
 230689194     gbgss15.seq
 250000413     gbgss150.seq
 250000610     gbgss151.seq
 250001358     gbgss152.seq
 250002661     gbgss153.seq
 250000087     gbgss154.seq
 250001749     gbgss155.seq
 250001532     gbgss156.seq
 250002533     gbgss157.seq
 250000051     gbgss158.seq
 250000170     gbgss159.seq
 230690433     gbgss16.seq
 250000228     gbgss160.seq
 250001919     gbgss161.seq
 250001198     gbgss162.seq
 250001788     gbgss163.seq
 250003107     gbgss164.seq
 250001327     gbgss165.seq
 250000822     gbgss166.seq
 250000112     gbgss167.seq
 250002119     gbgss168.seq
 250003386     gbgss169.seq
 230689500     gbgss17.seq
 250002008     gbgss170.seq
 250001008     gbgss171.seq
 250001624     gbgss172.seq
 250001987     gbgss173.seq
 250000858     gbgss174.seq
 250000482     gbgss175.seq
 250000748     gbgss176.seq
 250002372     gbgss177.seq
 250000353     gbgss178.seq
 250002603     gbgss179.seq
 230690354     gbgss18.seq
 250001924     gbgss180.seq
 195843421     gbgss181.seq
 230688963     gbgss19.seq
 230687684     gbgss2.seq
 230690353     gbgss20.seq
 230690378     gbgss21.seq
 230690820     gbgss22.seq
 230690043     gbgss23.seq
 230690276     gbgss24.seq
 230687532     gbgss25.seq
 230688590     gbgss26.seq
 230689250     gbgss27.seq
 230689496     gbgss28.seq
 230689262     gbgss29.seq
 230690835     gbgss3.seq
 230690281     gbgss30.seq
 230690207     gbgss31.seq
 230690608     gbgss32.seq
 230687460     gbgss33.seq
 230687663     gbgss34.seq
 230687549     gbgss35.seq
 230688420     gbgss36.seq
 230688908     gbgss37.seq
 230687471     gbgss38.seq
 230690130     gbgss39.seq
 230689817     gbgss4.seq
 230688609     gbgss40.seq
 230687759     gbgss41.seq
 230687625     gbgss42.seq
 230689840     gbgss43.seq
 230689853     gbgss44.seq
 230690607     gbgss45.seq
 230687759     gbgss46.seq
 230688291     gbgss47.seq
 230688935     gbgss48.seq
 230690090     gbgss49.seq
 230687574     gbgss5.seq
 230688170     gbgss50.seq
 230688112     gbgss51.seq
 230688081     gbgss52.seq
 230688084     gbgss53.seq
 230689232     gbgss54.seq
 230688400     gbgss55.seq
 230687626     gbgss56.seq
 230688276     gbgss57.seq
 230689024     gbgss58.seq
 230689325     gbgss59.seq
 230688137     gbgss6.seq
 230690360     gbgss60.seq
 229149318     gbgss61.seq
 230688595     gbgss62.seq
 230689690     gbgss63.seq
 230689152     gbgss64.seq
 230689102     gbgss65.seq
 230688817     gbgss66.seq
 230689369     gbgss67.seq
 230688428     gbgss68.seq
 230688222     gbgss69.seq
 230690545     gbgss7.seq
 230688853     gbgss70.seq
 230687799     gbgss71.seq
 230689124     gbgss72.seq
 230688126     gbgss73.seq
 230688380     gbgss74.seq
 230687734     gbgss75.seq
 230688955     gbgss76.seq
 230689466     gbgss77.seq
 230687513     gbgss78.seq
 230689696     gbgss79.seq
 230689401     gbgss8.seq
 230688290     gbgss80.seq
 207761086     gbgss81.seq
 194703062     gbgss82.seq
 212393575     gbgss83.seq
 230689304     gbgss84.seq
 230688842     gbgss85.seq
 230689258     gbgss86.seq
 230688625     gbgss87.seq
 230688002     gbgss88.seq
 230689368     gbgss89.seq
 230687534     gbgss9.seq
 230689270     gbgss90.seq
 230690109     gbgss91.seq
 230687664     gbgss92.seq
 230689740     gbgss93.seq
 230689454     gbgss94.seq
 230687471     gbgss95.seq
 230689019     gbgss96.seq
 230690298     gbgss97.seq
 230689348     gbgss98.seq
 230687786     gbgss99.seq
 250001968     gbhtc1.seq
 250001195     gbhtc10.seq
 250001461     gbhtc11.seq
  30544988     gbhtc12.seq
 250004428     gbhtc2.seq
 250012262     gbhtc3.seq
 250015320     gbhtc4.seq
 250008411     gbhtc5.seq
 250007056     gbhtc6.seq
 250001941     gbhtc7.seq
 250002773     gbhtc8.seq
 250001438     gbhtc9.seq
 250237448     gbhtg1.seq
 250045437     gbhtg10.seq
 250032938     gbhtg11.seq
 250179642     gbhtg12.seq
 250199617     gbhtg13.seq
 250277060     gbhtg14.seq
 250091761     gbhtg15.seq
 250187683     gbhtg16.seq
 250237715     gbhtg17.seq
 250208345     gbhtg18.seq
 250046641     gbhtg19.seq
 250077396     gbhtg2.seq
 250036213     gbhtg20.seq
 250098671     gbhtg21.seq
 250252062     gbhtg22.seq
 250169127     gbhtg23.seq
 250243030     gbhtg24.seq
 250185543     gbhtg25.seq
 250079499     gbhtg26.seq
 250178920     gbhtg27.seq
 250037259     gbhtg28.seq
 250044466     gbhtg29.seq
 250003990     gbhtg3.seq
 250244546     gbhtg30.seq
 250152942     gbhtg31.seq
 250339855     gbhtg32.seq
 250097373     gbhtg33.seq
 250108236     gbhtg34.seq
 250044369     gbhtg35.seq
 250162010     gbhtg36.seq
 250119260     gbhtg37.seq
 250306034     gbhtg38.seq
 250064189     gbhtg39.seq
 250049411     gbhtg4.seq
 250188586     gbhtg40.seq
 250057655     gbhtg41.seq
 250007145     gbhtg42.seq
 250114281     gbhtg43.seq
 250153988     gbhtg44.seq
 250267595     gbhtg45.seq
 250179879     gbhtg46.seq
 250012436     gbhtg47.seq
 250207690     gbhtg48.seq
 250008723     gbhtg49.seq
 250083749     gbhtg5.seq
 250114430     gbhtg50.seq
 250128136     gbhtg51.seq
 250184643     gbhtg52.seq
 250085640     gbhtg53.seq
 250034671     gbhtg54.seq
 250060812     gbhtg55.seq
 250111887     gbhtg56.seq
 250101058     gbhtg57.seq
 250221079     gbhtg58.seq
 250189789     gbhtg59.seq
 250099605     gbhtg6.seq
 250047291     gbhtg60.seq
 250190079     gbhtg61.seq
 250158112     gbhtg62.seq
 250002607     gbhtg63.seq
 250136451     gbhtg64.seq
 250082525     gbhtg65.seq
 250156990     gbhtg66.seq
 250045350     gbhtg67.seq
 250089900     gbhtg68.seq
 250063126     gbhtg69.seq
 250027750     gbhtg7.seq
 250103383     gbhtg70.seq
 250122028     gbhtg71.seq
 250049555     gbhtg72.seq
 250064266     gbhtg73.seq
 250056674     gbhtg74.seq
 250092842     gbhtg75.seq
 250244925     gbhtg76.seq
 250167009     gbhtg77.seq
 250165853     gbhtg78.seq
 250284076     gbhtg79.seq
 250189743     gbhtg8.seq
 250194714     gbhtg80.seq
 250138763     gbhtg81.seq
 250095949     gbhtg82.seq
 250108073     gbhtg83.seq
 245529166     gbhtg84.seq
 250112663     gbhtg9.seq
 250162623     gbinv1.seq
 250326179     gbinv2.seq
 250000011     gbinv3.seq
 250002283     gbinv4.seq
 250001416     gbinv5.seq
 250002136     gbinv6.seq
 250001091     gbinv7.seq
 250000350     gbinv8.seq
  64151761     gbinv9.seq
         0     gbjou.idx
         0     gbkey.idx
 250003870     gbmam1.seq
 250000880     gbmam2.seq
   1520239     gbmam3.seq
  35099899     gbnew.txt
 250002898     gbpat1.seq
 250000899     gbpat10.seq
 250001512     gbpat11.seq
 250000803     gbpat12.seq
 250000968     gbpat13.seq
 250002468     gbpat14.seq
 250000705     gbpat15.seq
 250000534     gbpat16.seq
 250001059     gbpat17.seq
 250000706     gbpat18.seq
 250091866     gbpat19.seq
 250002492     gbpat2.seq
 250000968     gbpat20.seq
 250006295     gbpat21.seq
 250000241     gbpat22.seq
 250002941     gbpat23.seq
 250000768     gbpat24.seq
 207942750     gbpat25.seq
 250001521     gbpat3.seq
 250003935     gbpat4.seq
 250001906     gbpat5.seq
 250000234     gbpat6.seq
 250013261     gbpat7.seq
 250000026     gbpat8.seq
 250000667     gbpat9.seq
  51741271     gbphg.seq
 250199607     gbpln1.seq
 269805077     gbpln10.seq
 250001269     gbpln11.seq
 250002892     gbpln12.seq
 250001172     gbpln13.seq
 250000001     gbpln14.seq
 250041558     gbpln15.seq
 250177808     gbpln16.seq
 250135002     gbpln17.seq
 211501680     gbpln18.seq
 250183685     gbpln2.seq
 250130456     gbpln3.seq
 250002087     gbpln4.seq
 250000474     gbpln5.seq
 250002606     gbpln6.seq
 250059865     gbpln7.seq
 250145335     gbpln8.seq
 287646474     gbpln9.seq
 250015038     gbpri1.seq
 250072333     gbpri10.seq
 250087309     gbpri11.seq
 250142684     gbpri12.seq
 250036111     gbpri13.seq
 250144355     gbpri14.seq
 250196351     gbpri15.seq
 250001736     gbpri16.seq
 250006067     gbpri17.seq
 250048819     gbpri18.seq
 250209839     gbpri19.seq
 250228108     gbpri2.seq
 250110324     gbpri20.seq
 250070269     gbpri21.seq
 250380155     gbpri22.seq
 250005489     gbpri23.seq
 250004734     gbpri24.seq
 250005112     gbpri25.seq
 250218310     gbpri26.seq
 250000180     gbpri27.seq
 250000580     gbpri28.seq
 250101256     gbpri29.seq
 250081747     gbpri3.seq
 250003772     gbpri30.seq
  50725909     gbpri31.seq
 250117926     gbpri4.seq
 250098877     gbpri5.seq
 250046487     gbpri6.seq
 250159872     gbpri7.seq
 250041437     gbpri8.seq
 250070646     gbpri9.seq
    230092     gbrel.txt
 250238832     gbrod1.seq
 250131771     gbrod10.seq
 250151382     gbrod11.seq
 250159289     gbrod12.seq
 250144023     gbrod13.seq
 250099971     gbrod14.seq
 250157960     gbrod15.seq
 250258825     gbrod16.seq
 250045948     gbrod17.seq
 250236625     gbrod18.seq
 250128256     gbrod19.seq
 250078755     gbrod2.seq
 250161126     gbrod20.seq
 250000270     gbrod21.seq
 250015989     gbrod22.seq
 250000099     gbrod23.seq
 250000681     gbrod24.seq
  72542911     gbrod25.seq
 250237763     gbrod3.seq
 250120595     gbrod4.seq
 250133433     gbrod5.seq
 250186119     gbrod6.seq
 250033478     gbrod7.seq
 250225765     gbrod8.seq
 250146455     gbrod9.seq
 638270222     gbsdr1.txt
3061951354     gbsdr2.txt
1189617059     gbsdr3.txt
   2295930     gbsec.idx
 250002483     gbsts1.seq
 250003858     gbsts10.seq
 250002700     gbsts11.seq
 250000578     gbsts12.seq
 250001316     gbsts13.seq
  44451530     gbsts14.seq
 250000857     gbsts2.seq
 250001527     gbsts3.seq
 250004195     gbsts4.seq
 250004133     gbsts5.seq
 250001009     gbsts6.seq
 250003068     gbsts7.seq
 250004332     gbsts8.seq
 250000563     gbsts9.seq
 150664180     gbsyn.seq
    419480     gbuna.seq
 250001918     gbvrl1.seq
 250077102     gbvrl2.seq
 250006090     gbvrl3.seq
 250000070     gbvrl4.seq
 250000901     gbvrl5.seq
 138685425     gbvrl6.seq
 250006585     gbvrt1.seq
 250012613     gbvrt10.seq
 231007356     gbvrt11.seq
 250231361     gbvrt2.seq
 250001468     gbvrt3.seq
 250002690     gbvrt4.seq
 250166656     gbvrt5.seq
 250078443     gbvrt6.seq
 250121121     gbvrt7.seq
 250157917     gbvrt8.seq
 250008118     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         25895      103022857
BCT10        59         114156922
BCT11        53         111685685
BCT12        55         117647329
BCT13        61         114127927
BCT14        25596      97566706
BCT15        50858      88353044
BCT16        12192      40415548
BCT2         4843       107679885
BCT3         144        112033611
BCT4         24249      103808149
BCT5         37894      95591569
BCT6         25080      103858198
BCT7         46109      96903930
BCT8         6420       108096929
BCT9         2287       99439208
ENV1         92045      72634486
ENV2         89093      80119701
ENV3         92038      81707140
ENV4         2260       1454349
EST1         68132      26291928
EST10        76538      29845881
EST100       74101      37168671
EST101       71379      40038024
EST102       68625      37259081
EST103       73286      36464688
EST104       72018      47276179
EST105       72413      44615521
EST106       69714      44299651
EST107       73490      32996863
EST108       70465      29738800
EST109       65977      35671325
EST11        75115      28773787
EST110       68251      37682783
EST111       69074      41119290
EST112       72073      38451731
EST113       75175      34460794
EST114       74530      27394254
EST115       74037      32543836
EST116       72923      37065371
EST117       65583      35440755
EST118       80104      45880506
EST119       78290      43479695
EST12        77707      30806669
EST120       68401      47851729
EST121       68843      39341201
EST122       74367      51243879
EST123       69121      41499798
EST124       73948      45251625
EST125       74206      45536123
EST126       71319      48803056
EST127       73624      48255430
EST128       78462      45341221
EST129       75314      31463155
EST13        77115      29303866
EST130       78040      32694677
EST131       79531      46731699
EST132       74841      42510363
EST133       64885      35446375
EST134       71228      36735110
EST135       67519      36940283
EST136       66026      36208702
EST137       71508      44103205
EST138       72754      45285506
EST139       67875      39374610
EST14        78480      31798234
EST140       68353      39885374
EST141       75505      45738712
EST142       67951      40017952
EST143       62031      35305247
EST144       99171      53956753
EST145       79955      45833426
EST146       84120      43711656
EST147       103972     54936638
EST148       105699     57575386
EST149       98892      56294552
EST15        74859      31632774
EST150       74079      44557910
EST151       93756      55654544
EST152       99923      59297624
EST153       86974      48743136
EST154       74729      45405267
EST155       68236      33666355
EST156       64023      29207546
EST157       54975      25056293
EST158       65243      31089563
EST159       59897      30868912
EST16        75818      33328356
EST160       64936      34809477
EST161       75367      52732805
EST162       63857      43851557
EST163       80887      47453712
EST164       61344      31456401
EST165       61079      30889542
EST166       66180      40649943
EST167       65444      31824616
EST168       64182      47469845
EST169       83124      43832556
EST17        82605      34104057
EST170       95549      45769223
EST171       92598      54891859
EST172       99603      57684787
EST173       96273      53631131
EST174       99049      48406266
EST175       90297      36823566
EST176       94990      49877086
EST177       89516      38265783
EST178       94517      41079757
EST179       71199      37977772
EST18        81048      32198622
EST180       68127      44210500
EST181       65220      37448483
EST182       65085      42733871
EST183       68217      30854052
EST184       76220      31605109
EST185       69060      43664853
EST186       82880      41262720
EST187       61628      32008533
EST188       67779      47600791
EST189       70407      46526296
EST19        78336      31879785
EST190       67693      36782902
EST191       67428      44785429
EST192       70584      54528469
EST193       69509      33349694
EST194       72248      40613631
EST195       69788      59452744
EST196       66707      50323486
EST197       64627      46989175
EST198       64135      47558206
EST199       66037      46133597
EST2         74651      28648243
EST20        74807      30649777
EST200       65680      47309937
EST201       63997      47444932
EST202       61945      37654677
EST203       64189      33992348
EST204       62735      36602982
EST205       85191      47810692
EST206       83939      54794595
EST207       68960      40395304
EST208       106257     66676506
EST209       108322     65428644
EST21        73434      34181726
EST210       109045     64580325
EST211       103524     66695627
EST212       107026     59640308
EST213       106758     50259383
EST214       90742      55053251
EST215       98184      44423662
EST216       92985      48268945
EST217       72719      46995603
EST218       67528      43542978
EST219       68684      58294463
EST22        75906      30459367
EST220       68255      58433906
EST221       80264      40176484
EST222       80212      46175695
EST223       74690      52937879
EST224       71181      51910519
EST225       41263      21016279
EST226       27787      10559603
EST227       27699      10229377
EST228       26347      9774065
EST229       26648      8986035
EST23        77302      32567547
EST230       27529      9768152
EST231       27190      10069641
EST232       27175      9749670
EST233       27328      10241953
EST234       27109      12086833
EST235       27209      11278983
EST236       27319      10129848
EST237       27603      9297013
EST238       26857      9187835
EST239       27775      11263127
EST24        74984      33169666
EST240       27781      10796739
EST241       27101      11342347
EST242       26616      11925440
EST243       27063      11374849
EST244       27050      10891118
EST245       27018      11509288
EST246       27131      11557860
EST247       27264      11161257
EST248       27265      10817291
EST249       27185      10578007
EST25        73550      31507451
EST250       27239      10800302
EST251       24700      17182416
EST252       25579      17030804
EST253       39655      19059348
EST254       91062      44459092
EST255       48890      28767035
EST256       104058     40738921
EST257       71005      40773444
EST258       68636      44546071
EST259       69435      44548504
EST26        75750      31306553
EST260       69306      44143469
EST261       67730      39763385
EST262       72887      42541059
EST263       65003      49083039
EST264       64306      32329510
EST265       79095      39164560
EST266       101935     46841105
EST267       73038      42095357
EST268       66387      33566388
EST269       68187      32986190
EST27        75334      32833469
EST270       70219      42437821
EST271       73699      34791706
EST272       70356      35404713
EST273       73224      46703940
EST274       63795      33961540
EST275       67765      38117088
EST276       82259      43082203
EST277       75735      42773676
EST278       79226      51537943
EST279       75460      54141717
EST28        108337     51504400
EST280       111973     49079314
EST281       83557      42527023
EST282       73107      45523258
EST283       73511      40010583
EST284       72301      38188337
EST285       70110      27515327
EST286       69922      41536709
EST287       62202      34101138
EST288       63807      41613708
EST289       71352      40513860
EST29        97463      46528948
EST290       62128      44249224
EST291       63464      31931151
EST292       82304      43425940
EST293       83753      43196805
EST294       78200      49400634
EST295       104813     56900692
EST296       123708     46426656
EST297       73689      37096685
EST298       68013      35445530
EST299       69709      46567423
EST3         73739      29916860
EST30        98609      53704827
EST300       80550      39203310
EST301       71539      42178579
EST302       71672      41625368
EST303       60316      33703312
EST304       56216      35063772
EST305       63159      38948029
EST306       70820      47906627
EST307       68523      41854777
EST308       72282      41944159
EST309       73599      37436501
EST31        80400      46237488
EST310       58934      30804093
EST311       53752      27557633
EST312       52750      28221229
EST313       52998      28245701
EST314       51882      27077398
EST315       54061      26200780
EST316       55676      24528439
EST317       55236      23351768
EST318       54469      22373051
EST319       55571      21402826
EST32        65852      49922173
EST320       54988      22088118
EST321       56110      22357472
EST322       55027      21389590
EST323       56195      20110923
EST324       65263      36062100
EST325       76494      35128356
EST326       74436      33211780
EST327       77253      33043007
EST328       76853      33698094
EST329       92736      61422621
EST33        73960      53181049
EST330       69385      53146134
EST331       96509      58706317
EST332       95437      57574211
EST333       89323      52637108
EST334       70138      38897297
EST335       75703      39677603
EST336       67402      54051582
EST337       64371      49175593
EST338       61788      44281453
EST339       61236      32079262
EST34        85809      47750392
EST340       72991      49244800
EST341       56989      34792914
EST342       50297      25232257
EST343       67513      36162238
EST344       65400      34755932
EST345       62175      30421713
EST346       63501      41060631
EST347       82466      45517131
EST348       72446      40624763
EST349       68505      41501100
EST35        87306      44620350
EST350       71153      40711598
EST351       62342      42796911
EST352       85034      48654868
EST353       84526      49829536
EST354       81129      44643560
EST355       64072      35607794
EST356       67602      37359852
EST357       72934      39918635
EST358       48001      24311584
EST359       62502      35707618
EST36        96359      52570774
EST360       69918      42015636
EST361       97707      45710069
EST362       75670      44793018
EST363       72259      47887745
EST364       72081      46465296
EST365       62542      36039577
EST366       72711      36048120
EST367       82974      38014953
EST368       59315      40566789
EST369       55550      37994698
EST37        79761      57857604
EST370       63623      37462418
EST371       86999      52870412
EST372       90385      48779564
EST373       67406      42766107
EST374       79861      41777455
EST375       52260      33227962
EST376       44246      23219595
EST377       69090      44083857
EST378       80855      41390549
EST379       80582      47848899
EST38        81885      57660790
EST380       74507      45770761
EST381       78864      48696588
EST382       75468      50260530
EST383       72529      39962751
EST384       60830      39449473
EST385       74148      40446645
EST386       53189      32953953
EST387       74659      31135331
EST388       79705      25559603
EST389       70817      45450978
EST39        101870     48131626
EST390       65906      37813058
EST391       70442      36887574
EST392       66075      40741500
EST393       73159      46666801
EST394       65996      44293764
EST395       73802      43482143
EST396       59572      33016584
EST397       65081      39650579
EST398       78524      50510417
EST399       83606      48315497
EST4         74569      28389457
EST40        89921      45721990
EST400       79676      45180181
EST401       58988      41011370
EST402       56700      41120993
EST403       57385      40426560
EST404       60497      38700819
EST405       78552      49193392
EST406       48682      29941989
EST407       65877      40254344
EST408       57943      40100959
EST409       60869      41379967
EST41        98958      47728577
EST410       56408      41937033
EST411       47515      33598257
EST412       89266      42349939
EST413       69385      38584947
EST414       69694      38365940
EST415       69823      38311409
EST416       69620      38660294
EST417       69619      38514596
EST418       69509      38799227
EST419       69029      38302355
EST42        91338      35148977
EST420       68966      38270392
EST421       69042      39197890
EST422       68667      38275953
EST423       67253      38056889
EST424       69293      39117557
EST425       69422      38192763
EST426       69452      38595947
EST427       69402      37845533
EST428       69833      38248384
EST429       69769      38305043
EST43        68712      18254628
EST430       69705      38296963
EST431       69973      37781947
EST432       76190      40839134
EST433       88363      50129018
EST434       80040      35555216
EST435       78867      41008996
EST436       59931      44244386
EST437       52024      40815636
EST438       70201      44789601
EST439       63753      37438093
EST44        68701      18400992
EST440       70501      41929847
EST441       113605     57446022
EST442       81264      49946931
EST443       84054      57516961
EST444       51283      30968447
EST445       48241      43593894
EST446       46354      59028646
EST447       72254      55931859
EST448       65136      38116812
EST449       72877      43186144
EST45        63649      19463529
EST450       68112      42900527
EST451       70475      43664090
EST452       61765      51373818
EST453       80828      44577649
EST454       109120     47983417
EST455       83991      53713031
EST456       61895      40098647
EST457       56463      40830510
EST458       56259      37832362
EST459       66540      49202844
EST46        43714      11915585
EST460       66193      46088724
EST461       61143      44591065
EST462       52007      37839162
EST463       53184      38216839
EST464       59169      42321565
EST465       65441      37109152
EST466       68803      44358611
EST467       57198      37958397
EST468       57368      40622845
EST469       62663      46733433
EST47        43324      12000544
EST470       59994      46423112
EST471       58061      40955944
EST472       55807      41496017
EST473       51775      34421699
EST474       54008      37516468
EST475       59761      38918331
EST476       71632      41137817
EST477       61572      46662437
EST478       76489      61117703
EST479       79017      50478480
EST48        43205      11443119
EST480       50425      53712283
EST481       49505      51538523
EST482       65798      54451171
EST483       58191      38414058
EST484       71092      39149200
EST485       85383      54612848
EST486       80482      53659625
EST487       81541      49144937
EST488       57857      37648881
EST489       74360      50622671
EST49        78330      31700224
EST490       80779      49605319
EST491       78245      61271884
EST492       70257      47738181
EST493       71728      50575894
EST494       69007      49073381
EST495       62971      49232531
EST496       66334      47323851
EST497       89267      47452689
EST498       84567      40435712
EST499       118088     43159122
EST5         48198      15295521
EST50        96034      43778252
EST500       95081      54685919
EST501       66933      51551110
EST502       50581      49977276
EST503       88531      46038660
EST504       86988      31698364
EST505       85146      33812033
EST506       63593      62327395
EST507       85792      55516762
EST508       85481      46757458
EST509       69683      43001148
EST51        91160      46330123
EST510       71307      50046685
EST511       75574      47566630
EST512       90205      53531370
EST513       73090      51946314
EST514       72969      52334100
EST515       71723      53940812
EST516       82367      55249192
EST517       86816      43630811
EST518       79856      43496331
EST519       79691      55133564
EST52        89438      41867417
EST520       72786      55635978
EST521       71543      48431635
EST522       90273      45015685
EST523       106265     45364761
EST524       109468     49055224
EST525       129866     54078151
EST526       130680     57895206
EST527       73743      54420683
EST528       84874      41449132
EST529       84288      8752058
EST53        102784     52610140
EST530       95394      30131233
EST531       127228     62580437
EST532       97866      56845739
EST533       66225      42458150
EST534       72664      46528564
EST535       75670      51749643
EST536       71435      45840248
EST537       71898      47844539
EST538       70649      53429429
EST539       77915      29969631
EST54        99632      50582761
EST540       70081      24915531
EST541       75562      27724162
EST542       72166      26214010
EST543       79582      27022980
EST544       73021      26830976
EST545       68398      29247681
EST546       32236      10780782
EST55        77614      33615128
EST56        65918      28597186
EST57        72475      32188041
EST58        71078      29987400
EST59        81169      32827232
EST6         54924      17445206
EST60        74584      29511036
EST61        70946      28530152
EST62        63854      29424552
EST63        75740      34123640
EST64        76563      34157214
EST65        73844      29117444
EST66        76271      26357601
EST67        85775      40862315
EST68        40599      11561923
EST69        40413      11092878
EST7         74544      29357938
EST70        40374      12434324
EST71        40799      12600325
EST72        40821      12295063
EST73        40748      13008029
EST74        40513      12951153
EST75        40562      12067819
EST76        40156      12006166
EST77        40892      12741724
EST78        41419      11832336
EST79        41006      13094422
EST8         75853      30597153
EST80        40878      12856048
EST81        42298      13021157
EST82        45883      16028950
EST83        42943      27024751
EST84        42186      19741072
EST85        47964      19422733
EST86        50698      22414395
EST87        51198      21744847
EST88        80925      47470201
EST89        77406      38108218
EST9         77568      29867722
EST90        71843      27739362
EST91        75451      29571087
EST92        74536      39938995
EST93        77397      41499579
EST94        77548      44464753
EST95        75161      35148705
EST96        74936      42839261
EST97        70583      36576730
EST98        75185      35637464
EST99        72727      42296827
GSS1         90427      38661176
GSS10        74870      43584742
GSS100       75087      42511982
GSS101       74344      43239187
GSS102       73629      45042310
GSS103       73606      45096160
GSS104       73270      45279931
GSS105       73291      44755222
GSS106       75828      48300165
GSS107       86687      57578307
GSS108       82316      55174300
GSS109       82704      51843211
GSS11        70615      35935175
GSS110       87610      53211266
GSS111       80263      63387588
GSS112       80415      47501680
GSS113       94528      52820153
GSS114       81746      50443815
GSS115       80802      54612024
GSS116       87105      68998146
GSS117       76951      44419169
GSS118       76338      51679219
GSS119       93675      48178164
GSS12        72880      38304785
GSS120       88391      55459542
GSS121       85617      53771483
GSS122       86881      56791736
GSS123       76693      62034126
GSS124       76641      69023151
GSS125       79339      61468776
GSS126       78689      54702920
GSS127       78775      54530501
GSS128       79095      54083148
GSS129       78863      54425415
GSS13        76710      38972527
GSS130       79235      53882212
GSS131       83953      60045451
GSS132       81395      58309666
GSS133       67342      56734920
GSS134       71765      55319486
GSS135       76516      68437520
GSS136       76148      62877643
GSS137       78643      52934822
GSS138       86523      53717696
GSS139       94701      58063897
GSS14        71317      32130397
GSS140       93156      59959927
GSS141       84910      56319633
GSS142       82441      55221274
GSS143       87031      56444758
GSS144       115648     59445406
GSS145       104031     60590461
GSS146       78712      55278151
GSS147       49677      31917845
GSS148       39405      28629642
GSS149       86836      64404216
GSS15        70061      34757698
GSS150       83575      62753164
GSS151       103108     48161425
GSS152       68548      58488280
GSS153       68306      58779598
GSS154       69368      56627991
GSS155       69629      56122459
GSS156       70375      55415422
GSS157       85863      73122780
GSS158       85378      39156750
GSS159       74963      33079603
GSS16        78471      46275348
GSS160       99506      75348035
GSS161       89185      41363850
GSS162       92288      63244766
GSS163       78702      64020542
GSS164       70304      59021023
GSS165       68301      63092133
GSS166       62749      54711659
GSS167       117480     70781758
GSS168       119025     74853485
GSS169       114267     72254427
GSS17        70905      33300657
GSS170       87631      49229155
GSS171       90246      55270778
GSS172       102926     71827750
GSS173       108147     77711555
GSS174       106272     79809757
GSS175       105897     80219201
GSS176       107049     72381349
GSS177       100003     56068892
GSS178       85050      46343972
GSS179       92430      47704839
GSS18        59072      27947831
GSS180       97897      64619078
GSS181       79920      37420076
GSS19        56793      29072377
GSS2         88926      39303697
GSS20        57668      26712370
GSS21        61488      29057627
GSS22        64939      38230047
GSS23        57529      27081083
GSS24        66168      42024043
GSS25        68211      28289704
GSS26        58176      25355644
GSS27        65303      31934874
GSS28        65527      32575936
GSS29        77225      39669329
GSS3         87398      41802021
GSS30        82941      39740821
GSS31        74191      40411920
GSS32        70577      48294741
GSS33        79802      37824944
GSS34        75888      40321723
GSS35        74118      40025167
GSS36        87368      56179107
GSS37        87598      58173223
GSS38        85523      44940858
GSS39        86842      50474937
GSS4         78874      41011062
GSS40        86235      40010785
GSS41        83170      31845412
GSS42        81247      56931682
GSS43        80151      58109065
GSS44        72029      47494612
GSS45        72036      47432000
GSS46        77670      45765395
GSS47        77852      38688037
GSS48        83227      58010682
GSS49        86577      64688617
GSS5         78791      40543955
GSS50        81582      54470283
GSS51        93869      59259705
GSS52        88547      58814864
GSS53        76634      42273729
GSS54        72820      40498003
GSS55        86508      47046265
GSS56        88083      58488041
GSS57        77072      64858906
GSS58        71984      79297095
GSS59        86848      69263601
GSS6         78151      38870151
GSS60        88595      59269234
GSS61        63418      45073816
GSS62        67010      45951178
GSS63        89650      67276495
GSS64        84977      57982472
GSS65        86077      53089534
GSS66        86455      56259854
GSS67        95417      58306687
GSS68        100726     54384268
GSS69        100601     54542451
GSS7         77733      39126124
GSS70        101398     53533159
GSS71        102485     52153030
GSS72        102417     52240125
GSS73        102570     52045621
GSS74        102155     52571486
GSS75        99645      55765892
GSS76        90053      69068841
GSS77        89843      70768813
GSS78        88293      69750437
GSS79        87836      69662977
GSS8         75721      38102431
GSS80        88014      61735137
GSS81        82953      31239512
GSS82        77833      24406765
GSS83        84678      32982575
GSS84        82016      50098224
GSS85        80185      45188726
GSS86        88071      61219987
GSS87        80660      59807489
GSS88        77047      79083981
GSS89        77429      62294764
GSS9         72104      37147963
GSS90        89842      48298589
GSS91        79275      45077466
GSS92        79790      45255544
GSS93        73424      62676198
GSS94        83721      51944563
GSS95        80854      57043892
GSS96        85701      56695468
GSS97        83788      57930313
GSS98        89143      52417098
GSS99        83341      72414518
HTC1         25078      27084705
HTC10        68763      57931150
HTC11        63086      92340607
HTC12        6140       11900954
HTC2         16058      36229239
HTC3         16038      36659055
HTC4         16267      35590099
HTC5         15990      40339220
HTC6         16079      37520340
HTC7         54075      28899070
HTC8         68822      68666092
HTC9         74820      66153981
HTG1         1315       189001996
HTG10        1242       186554222
HTG11        1431       184145531
HTG12        875        191959854
HTG13        750        192389796
HTG14        744        192349572
HTG15        781        192209305
HTG16        803        192103599
HTG17        767        192339460
HTG18        2057       171267054
HTG19        1060       187954823
HTG2         2565       186048467
HTG20        983        189168049
HTG21        782        191932247
HTG22        924        190481556
HTG23        903        190675343
HTG24        808        191581061
HTG25        778        192132261
HTG26        861        191378895
HTG27        886        190840247
HTG28        948        189926051
HTG29        897        191058389
HTG3         2462       185298819
HTG30        927        190534683
HTG31        873        191385647
HTG32        969        189828845
HTG33        876        191206623
HTG34        856        191509142
HTG35        827        191817102
HTG36        933        190289287
HTG37        932        190866152
HTG38        944        190473113
HTG39        1034       189365258
HTG4         2512       188369264
HTG40        1190       187296947
HTG41        1219       188353891
HTG42        1214       187981531
HTG43        1169       187168544
HTG44        1097       191611449
HTG45        1219       191128483
HTG46        1241       191035081
HTG47        1125       191016734
HTG48        1064       191241274
HTG49        948        189855440
HTG5         1281       185650087
HTG50        1052       189562319
HTG51        935        189770266
HTG52        1013       189819223
HTG53        954        189388393
HTG54        997        189505079
HTG55        933        189214632
HTG56        960        188927643
HTG57        1107       188635272
HTG58        971        189702585
HTG59        1092       186367097
HTG6         1273       185296458
HTG60        1095       188294189
HTG61        991        189350844
HTG62        1028       189164049
HTG63        971        188976728
HTG64        1136       188605223
HTG65        1060       189147126
HTG66        1290       184350752
HTG67        1240       185596635
HTG68        1239       184583979
HTG69        1270       184556192
HTG7         1247       185472319
HTG70        1217       185671394
HTG71        1423       188498058
HTG72        1286       187089618
HTG73        1120       191470147
HTG74        1128       191861721
HTG75        1213       192402180
HTG76        1210       190724567
HTG77        1121       190727665
HTG78        1382       189616290
HTG79        1184       190590209
HTG8         1287       185088399
HTG80        1057       193720413
HTG81        824        182251305
HTG82        1154       192964185
HTG83        1094       193288104
HTG84        1151       179504982
HTG9         1182       187153099
INV1         19424      158207180
INV2         1721       169897633
INV3         27020      122544890
INV4         77673      77590348
INV5         71276      74698851
INV6         78535      72103383
INV7         33368      117309086
INV8         73758      75842681
INV9         4963       31339404
MAM1         43015      127776600
MAM2         62235      91120597
MAM3         487        404900
PAT1         222661     70153368
PAT10        131378     94484437
PAT11        132691     49097192
PAT12        98678      62670606
PAT13        106585     52269888
PAT14        118298     50572468
PAT15        132825     61368974
PAT16        145798     55071555
PAT17        163674     72081754
PAT18        99838      123694029
PAT19        125185     100581343
PAT2         194463     84678606
PAT20        109171     111409176
PAT21        132217     97422079
PAT22        97968      86269861
PAT23        93589      88397252
PAT24        116136     62879962
PAT25        135481     51362787
PAT3         172005     95888203
PAT4         153751     106059983
PAT5         184027     85615040
PAT6         143672     90639971
PAT7         117052     108912035
PAT8         143257     91284644
PAT9         128552     98390983
PHG          3133       20987022
PLN1         41264      114023244
PLN10        7          212935788
PLN11        17643      146973938
PLN12        63594      68848456
PLN13        76364      79825769
PLN14        72704      74979597
PLN15        22074      136449511
PLN16        72865      79608981
PLN17        50337      106632997
PLN18        38689      84149393
PLN2         1329       168842465
PLN3         1700       172870147
PLN4         50910      101459358
PLN5         75726      78871340
PLN6         40848      53265884
PLN7         28068      101003373
PLN8         1267       166333799
PLN9         1016       199395591
PRI1         23601      138184720
PRI10        1446       181739865
PRI11        1304       179062265
PRI12        1529       178067270
PRI13        1586       179764992
PRI14        1510       185706612
PRI15        1239       192348990
PRI16        23052      153417029
PRI17        43536      96669036
PRI18        18195      134846681
PRI19        1609       183733155
PRI2         1495       172941800
PRI20        1713       183451913
PRI21        2098       181541623
PRI22        9242       164934818
PRI23        14453      156379216
PRI24        54887      85141086
PRI25        34266      65734614
PRI26        5246       180115911
PRI27        51032      120381134
PRI28        24888      149684258
PRI29        52631      114710404
PRI3         1283       186456779
PRI30        45927      116667230
PRI31        13609      18265677
PRI4         1316       183769278
PRI5         1192       181567723
PRI6         1214       178891038
PRI7         1231       180702496
PRI8         1363       174476885
PRI9         1226       177460200
ROD1         10551      167353725
ROD10        976        182240100
ROD11        1029       186601938
ROD12        961        183590825
ROD13        1022       187180465
ROD14        954        181242214
ROD15        962        182424639
ROD16        1044       186279949
ROD17        27973      143979646
ROD18        1153       189541310
ROD19        1205       193271370
ROD2         926        174172315
ROD20        1362       193705723
ROD21        43433      81469909
ROD22        19014      121847179
ROD23        46830      143530712
ROD24        126649     38119089
ROD25        18913      25568661
ROD3         905        173962592
ROD4         903        174078642
ROD5         926        174002445
ROD6         986        181144729
ROD7         970        179743598
ROD8         987        181796241
ROD9         1010       183014841
STS1         81961      35118162
STS10        58007      44374628
STS11        57856      43534988
STS12        73664      38752655
STS13        85604      38009156
STS14        20169      7801049
STS2         84099      44831343
STS3         76178      30730745
STS4         67016      33929465
STS5         54867      31984196
STS6         54730      32220767
STS7         54692      32190666
STS8         56286      38614037
STS9         57907      44422629
SYN          35185      47169042
UNA          211        114018
VRL1         72573      65420322
VRL2         71821      65377855
VRL3         68700      70502590
VRL4         64282      70378979
VRL5         66245      71093684
VRL6         40217      38215015
VRT1         26978      151805902
VRT10        9416       178233905
VRT11        67105      76539521
VRT2         51934      112300935
VRT3         37937      134201023
VRT4         69709      66955064
VRT5         22209      113717976
VRT6         1226       192703044
VRT7         1280       192383680
VRT8         8910       180162841
VRT9         14692      172568628

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 155.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries        Bases   Species

10649134 12385903706   Homo sapiens
6753652   8049817803   Mus musculus
1267882   5747965742   Rattus norvegicus
1663937   3566605068   Bos taurus
1287702   2540551749   Danio rerio
2499723   1998269811   Zea mays
1149146   1500985768   Oryza sativa (japonica cultivar-group)
226213    1251961979   Strongylocentrotus purpuratus
1236899   1075752229   Sus scrofa
1175934    961525020   Xenopus tropicalis
1426915    893771790   Canis familiaris
655519     845341580   Drosophila melanogaster
800633     770627209   Gallus gallus
1198209    758043364   Arabidopsis thaliana
209185     691252171   Pan troglodytes
868038     507883206   Triticum aestivum
397437     468939096   Medicago truncatula
784170     465881813   Sorghum bicolor
69335      463195893   Macaca mulatta
696319     421330392   Ciona intestinalis

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, CON-division sequence files, and the
lists of new, changed, and deleted accession numbers, each of the files of a
GenBank release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 August 2006

                NCBI-GenBank Flat File Release 155.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 155.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
	Irene Fang, Linda Frisse, Michael Fetchko, Andrea Gocke, Amelie Gubitz
	Anjanette Johnston, Kellie Kelm, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
	Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, WonHee Jang,
	Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Tony Stearman

User Support
	Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
	Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
	Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
	David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center