Release Notes For GenBank Release 156
GBREL.TXT Genetic Sequence Data Bank
October 15 2006
NCBI-GenBank Flat File Release 156.0
Distribution Release Notes
62765195 loci, 66925938907 bases, from 62765195 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 156.0
1.2 Cutoff Date
1.3 Important Changes in Release 156.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 156.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
E-MAIL: update@ncbi.nlm.nih.gov
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 156.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.
1.2 Cutoff Date
This full release, 156.0, incorporates data available to the collaborating
databases as of October 12, 2006 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 156.0
1.3.1 Organizational changes
The total number of sequence data files increased by 23 with this release:
- the BCT division is now comprised of 17 files (+1)
- the EST division is now comprised of 554 files (+8)
- the GSS division is now comprised of 190 files (+9)
- the HTG division is now comprised of 86 files (+2)
- the PAT division is now comprised of 26 files (+1)
- the PLN division is now comprised of 19 files (+1)
- the VRT division is now comprised of 12 files (+1)
1.3.2 Index files gbjou.idx and gbkey.idx not available.
Problems were once again encountered generating the journal and keyword
'index' files, in spite of the recent changes which limit their content to
non-EST and non-GSS records (see Section 1.3.3 for a description of those
changes).
Another attempt to resolve this issue will be made prior to GenBank 157.0
Our apologies for any inconvenience that this may cause.
1.3.3 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics since January 2005
seem to support this: the index files are transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI. GenBank 156.0 thus contains these index
files, which lack all EST and most GSS content:
gbaut1.idx
gbaut2.idx
gbaut3.idx
gbaut4.idx
gbaut5.idx
gbaut6.idx
gbaut7.idx
gbaut8.idx
gbgen.idx
gbsec.idx
We intend to provide similarly-restricted gbjou.idx and gbkey.idx index
files, but could not do so for this release.
The gbacc.idx index file continues to reflect the entirety of the release,
including all EST and GSS records, however the file's contents are unsorted.
On a positive note, sequence version numbers have have been restored to
the accession number 'index' file as of GenBank 156.0 .
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options within the next year:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank files, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
info@ncbi.nlm.nih.gov
Our apologies for any inconvenience that these changes may cause.
1.3.4 New protein residue abbreviation for Pyrrolysine
Sequence databases use single-letter amino acid abbreviations to
record the primary structure (sequence) of amino acids in a polypeptide.
The table of abbreviations includes only those amino acids that are
encoded in the genetic code and directly inserted by a tRNA during the
process of protein translation. Post-translational modifications are
not represented in the sequence data itself, but may be described by
features annotated on the sequence.
The discovery of the 22nd naturally encoded amino acid, pyrrolysine,
and the recent submission of sequence records that should contain
this residue, require the adoption of a new amino acid abbreviation.
Because several letters are assigned to represent different experimental
ambiguities, the only letter still available for use is O (uppercase
letter o). Scientists working in the field have independently suggested
use of this letter, and it has a reasonable mnemonic, pyrrOlysine.
The IUPAC-IUBMB Joint Commission on Biochemical Nomenclature has agreed
that Pyl/O will be recommended for this amino acid.
The consequences for flatfile users are that O can now appear in CDS
/translation qualifiers, and that Pyl (the three-letter abbreviation)
can appear in CDS /transl_except qualifiers and in the /product and
/anticodon qualifiers of tRNA features. These changes are legal as of this
October 2006 GenBank Release.
Sample ASN.1, FASTA, GenBank flatfile, and INSDSeq XML files for CP000099,
which has a protein with a pyrrolysine residue, are available for testing
purposes at the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/genbank/Pyrrolysine_Samples
Files:
CP000099.pse (print-form ASN.1 Seq-entry)
CP000099.gbff (GenBank flatfile)
CP000099.aa_fsa (protein FASTA)
CP000099.isx (INSDSeq XML)
For BLAST and other sequence similarity search tools, we expect to map
pyrrolysine (O) to unknown (X), as is already done with selenocysteine
(U), the 21st naturally encoded amino acid. One reason is that the PAM
and BLOSUM substitution matrices do not accommodate these more recently
discovered amino acids. The other reason is that selenocysteine and
pyrrolysine both appear to be used as active sites in certain enzymes,
and thus do not simply substitute for cysteine or lysine.
Here are a few literature references which provide more information
about pyrrolysine :
G. Srinivasan, C. M. James, J. A. Krzycki. Pyrrolysine encoded by
UAG in Archaea: charging of a UAG-decoding specialized tRNA. Science
2002, 296:1459-1462.
B. Hao, W. Gong, T.K. Ferguson, C.M. James, J.A. Krzycki, M.K.
Chan. A new UAG-encoded residue in the structure of a methanogen
methyltransferase. Science 2002, 296:1462-1466.
C. Polycarpo, A. Ambrogelly, A. Berube, S.M. Winbush, J.A.
McCloskey, P. F. Crain, J. L. Wood, D. Soll. An aminoacyl-tRNA
synthetase that specifically activates pyrrolysine. Proc. Natl. Acad.
Sci. (USA) 2004, 101:12450-12454.
C. Fenske, G.J. Palm, W. Hinrichs. How unique is the genetic code?
Agnew. Chem. Int. Ed. 2003, 42:606-610.
1.3.5 Protein residue J for leucine/isoleucine ambiguities
The residue abbreviation J is reserved for mass spectrometry experiments that
cannot distinguish leucine from isoleucine. Although this abbreviation has
been part of the IUPAC recommendations for some time, it has not previously
appeared in protein sequences in the GenBank database.
As of October 2006, abbreviation J is legal in CDS /translation qualifiers,
and Xle (the three-letter abbreviation) will be allowed in CDS /transl_except
qualifiers and in the /product and /anticodon qualifiers of tRNA features.
J will also be mapped to unknown (X) for the purpose of BLAST and other
sequence similarity search tools.
1.3.6 /PCR_primers and modified bases
PCR primers are sometimes constructed which utilize modified bases,
such as those listed in the table of modified bases included in the
Feature Table document:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html#7.5.2
As of October 2006, it is legal to use modified-base abbreviations for the
/PCR_primers qualifier. For example:
/PCR_primers="fwd_seq: gcagtt<i>caag<gal q>tggagtgaa, rev_seq:
gcaacgtatcctccagagtgatcgb
Here, modified bases inosine and beta,D-galactosylqueosine are included
in the forward sequence of the primer pair, and enclosed between angle
brackets ( <...> ) .
Each pair of angle brackets will include only a single modified base
abbreviation.
1.3.7 New /mol_type value
A new legal molecule type value for viral cRNA sequences becomes
valid as of this October 2006 release:
/mol_type="viral cRNA"
This value will also be legal for the molecule type field on the
LOCUS line of the GenBank flatfile format. Additional details about
the usage of this new molecule type value will be provided via
these release notes and the GenBank newsgroup.
1.3.8 Feature location syntax X.Y no longer supported
The Feature Table has supported feature locations of the form
'X.Y', to represent a base position which is greater or equal to X,
and less than or equal to Y. For example:
misc_feature 1.10..20
misc_feature join(100..150,200.210..250)
In the first example, the misc_feature starts somewhere between
bases 1 and 10 (inclusive), and ends at basepair 20. In the second,
the 51 bases from 100..150 are joined together with a second basepair
interval, which could be anywhere from 200..250 to 210..250 .
Although this syntax seems like a reasonable way to capture an
uncertain interval, it is used for features on a vanishingly small
number of sequence records, most database submission mechanisms
don't support it, and the meaning of its use in a join() context
is not entirely clear.
As of October 2006, this type of location is no longer supported.
Those records with features which utilize X.Y locations will be reviewed
and converted to a non-uncertain format.
1.3.9 /operon on rRNA features
With this October 2006 GenBank release, the /operon qualifier may be
used for rRNA features.
1.3.10 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
thirty-five of the GSS flatfiles in Release 156.0. Consider gbgss156.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
October 15 2006
NCBI-GenBank Flat File Release 156.0
GSS Sequences (Part 1)
86835 loci, 64398688 bases, from 86835 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "156" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 Introduction of /mobile_element qualifier
For repeat_region features, the /transposon and /insertion_seq
qualifiers can be used to describe two specific classes of mobile
elements. But not all mobile elements fall into these two categories,
so a new structured /mobile_element qualifier will be introduced
as of GenBank 157.0 in December 2006. The preliminary description
of the new qualifier is as follows:
Qualifer: /mobile_element
Description: Type, and name (or identifier), of the mobile element
which is described by the parent feature.
Value format: <mobile_element_type>:<mobile_element_id>
Where mobile element type is one of the following: transposon,
integron, insertion_sequence, other .
Example: /mobile_element="transposon:Tnp9"
Further details about this new qualifier, the domain of mobile element
types in particular, will be provided in these release notes and via the
GenBank newsgroup as they become available.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1032 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut2.idx - Index of the entries according to accession number, part 2.
4. gbaut3.idx - Index of the entries according to accession number, part 3.
5. gbaut4.idx - Index of the entries according to accession number, part 4.
6. gbaut5.idx - Index of the entries according to accession number, part 5.
7. gbaut6.idx - Index of the entries according to accession number, part 6.
8. gbaut7.idx - Index of the entries according to accession number, part 7.
9. gbaut8.idx - Index of the entries according to accession number, part 8.
10. gbbct1.seq - Bacterial sequence entries, part 1.
11. gbbct10.seq - Bacterial sequence entries, part 10.
12. gbbct11.seq - Bacterial sequence entries, part 11.
13. gbbct12.seq - Bacterial sequence entries, part 12.
14. gbbct13.seq - Bacterial sequence entries, part 13.
15. gbbct14.seq - Bacterial sequence entries, part 14.
16. gbbct15.seq - Bacterial sequence entries, part 15.
17. gbbct16.seq - Bacterial sequence entries, part 16.
18. gbbct17.seq - Bacterial sequence entries, part 17.
19. gbbct2.seq - Bacterial sequence entries, part 2.
20. gbbct3.seq - Bacterial sequence entries, part 3.
21. gbbct4.seq - Bacterial sequence entries, part 4.
22. gbbct5.seq - Bacterial sequence entries, part 5.
23. gbbct6.seq - Bacterial sequence entries, part 6.
24. gbbct7.seq - Bacterial sequence entries, part 7.
25. gbbct8.seq - Bacterial sequence entries, part 8.
26. gbbct9.seq - Bacterial sequence entries, part 9.
27. gbchg.txt - Accession numbers of entries updated since the previous release.
28. gbcon1.seq - Constructed sequence entries, part 1.
29. gbcon2.seq - Constructed sequence entries, part 2.
30. gbcon3.seq - Constructed sequence entries, part 3.
31. gbdel.txt - Accession numbers of entries deleted since the previous release.
32. gbenv1.seq - Environmental sampling sequence entries, part 1.
33. gbenv2.seq - Environmental sampling sequence entries, part 2.
34. gbenv3.seq - Environmental sampling sequence entries, part 3.
35. gbenv4.seq - Environmental sampling sequence entries, part 4.
36. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
37. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
38. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
39. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
40. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
41. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
42. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
43. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
44. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
45. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
46. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
47. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
48. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
49. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
50. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
51. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
52. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
53. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
54. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
55. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
56. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
57. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
58. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
59. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
60. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
61. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
62. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
63. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
64. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
65. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
66. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
67. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
68. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
69. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
70. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
71. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
72. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
73. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
74. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
75. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
76. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
77. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
78. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
79. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
80. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
81. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
82. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
83. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
84. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
85. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
86. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
87. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
88. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
89. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
90. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
91. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
92. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
93. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
94. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
95. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
96. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
97. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
98. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
99. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
100. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
101. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
102. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
103. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
104. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
105. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
106. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
107. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
108. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
109. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
110. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
111. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
112. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
113. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
114. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
115. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
116. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
117. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
118. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
119. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
120. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
121. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
122. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
123. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
124. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
125. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
126. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
127. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
128. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
129. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
130. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
131. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
132. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
133. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
134. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
135. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
136. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
137. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
138. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
139. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
140. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
141. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
142. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
143. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
144. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
145. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
146. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
147. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
148. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
149. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
150. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
151. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
152. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
153. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
154. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
155. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
156. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
157. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
158. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
159. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
160. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
161. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
162. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
163. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
164. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
165. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
166. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
167. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
168. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
169. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
170. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
171. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
172. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
173. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
174. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
175. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
176. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
177. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
178. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
179. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
180. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
181. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
182. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
183. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
184. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
185. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
186. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
187. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
188. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
189. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
190. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
191. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
192. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
193. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
194. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
195. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
196. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
197. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
198. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
199. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
200. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
201. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
202. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
203. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
204. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
205. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
206. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
207. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
208. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
209. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
210. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
211. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
212. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
213. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
214. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
215. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
216. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
217. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
218. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
219. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
220. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
221. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
222. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
223. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
224. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
225. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
226. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
227. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
228. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
229. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
230. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
231. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
232. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
233. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
234. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
235. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
236. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
237. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
238. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
239. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
240. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
241. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
242. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
243. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
244. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
245. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
246. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
247. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
248. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
249. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
250. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
251. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
252. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
253. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
254. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
255. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
256. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
257. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
258. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
259. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
260. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
261. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
262. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
263. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
264. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
265. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
266. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
267. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
268. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
269. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
270. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
271. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
272. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
273. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
274. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
275. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
276. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
277. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
278. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
279. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
280. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
281. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
282. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
283. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
284. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
285. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
286. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
287. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
288. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
289. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
290. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
291. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
292. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
293. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
294. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
295. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
296. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
297. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
298. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
299. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
300. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
301. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
302. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
303. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
304. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
305. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
306. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
307. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
308. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
309. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
310. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
311. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
312. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
313. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
314. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
315. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
316. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
317. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
318. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
319. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
320. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
321. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
322. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
323. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
324. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
325. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
326. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
327. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
328. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
329. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
330. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
331. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
332. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
333. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
334. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
335. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
336. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
337. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
338. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
339. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
340. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
341. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
342. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
343. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
344. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
345. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
346. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
347. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
348. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
349. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
350. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
351. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
352. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
353. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
354. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
355. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
356. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
357. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
358. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
359. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
360. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
361. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
362. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
363. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
364. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
365. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
366. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
367. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
368. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
369. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
370. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
371. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
372. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
373. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
374. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
375. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
376. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
377. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
378. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
379. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
380. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
381. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
382. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
383. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
384. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
385. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
386. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
387. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
388. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
389. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
390. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
391. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
392. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
393. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
394. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
395. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
396. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
397. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
398. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
399. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
400. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
401. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
402. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
403. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
404. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
405. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
406. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
407. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
408. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
409. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
410. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
411. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
412. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
413. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
414. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
415. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
416. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
417. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
418. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
419. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
420. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
421. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
422. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
423. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
424. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
425. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
426. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
427. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
428. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
429. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
430. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
431. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
432. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
433. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
434. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
435. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
436. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
437. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
438. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
439. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
440. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
441. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
442. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
443. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
444. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
445. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
446. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
447. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
448. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
449. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
450. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
451. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
452. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
453. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
454. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
455. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
456. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
457. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
458. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
459. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
460. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
461. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
462. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
463. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
464. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
465. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
466. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
467. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
468. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
469. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
470. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
471. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
472. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
473. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
474. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
475. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
476. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
477. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
478. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
479. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
480. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
481. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
482. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
483. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
484. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
485. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
486. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
487. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
488. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
489. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
490. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
491. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
492. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
493. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
494. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
495. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
496. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
497. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
498. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
499. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
500. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
501. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
502. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
503. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
504. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
505. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
506. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
507. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
508. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
509. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
510. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
511. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
512. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
513. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
514. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
515. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
516. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
517. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
518. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
519. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
520. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
521. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
522. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
523. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
524. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
525. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
526. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
527. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
528. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
529. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
530. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
531. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
532. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
533. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
534. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
535. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
536. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
537. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
538. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
539. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
540. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
541. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
542. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
543. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
544. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
545. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
546. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
547. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
548. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
549. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
550. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
551. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
552. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
553. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
554. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
555. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
556. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
557. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
558. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
559. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
560. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
561. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
562. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
563. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
564. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
565. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
566. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
567. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
568. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
569. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
570. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
571. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
572. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
573. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
574. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
575. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
576. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
577. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
578. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
579. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
580. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
581. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
582. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
583. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
584. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
585. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
586. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
587. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
588. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
589. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
590. gbgen.idx - Index of the entries according to gene symbols.
591. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
592. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
593. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
594. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
595. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
596. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
597. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
598. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
599. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
600. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
601. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
602. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
603. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
604. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
605. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
606. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
607. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
608. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
609. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
610. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
611. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
612. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
613. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
614. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
615. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
616. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
617. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
618. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
619. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
620. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
621. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
622. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
623. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
624. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
625. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
626. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
627. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
628. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
629. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
630. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
631. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
632. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
633. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
634. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
635. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
636. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
637. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
638. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
639. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
640. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
641. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
642. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
643. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
644. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
645. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
646. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
647. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
648. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
649. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
650. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
651. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
652. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
653. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
654. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
655. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
656. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
657. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
658. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
659. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
660. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
661. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
662. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
663. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
664. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
665. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
666. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
667. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
668. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
669. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
670. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
671. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
672. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
673. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
674. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
675. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
676. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
677. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
678. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
679. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
680. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
681. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
682. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
683. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
684. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
685. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
686. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
687. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
688. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
689. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
690. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
691. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
692. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
693. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
694. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
695. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
696. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
697. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
698. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
699. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
700. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
701. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
702. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
703. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
704. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
705. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
706. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
707. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
708. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
709. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
710. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
711. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
712. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
713. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
714. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
715. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
716. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
717. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
718. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
719. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
720. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
721. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
722. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
723. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
724. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
725. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
726. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
727. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
728. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
729. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
730. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
731. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
732. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
733. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
734. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
735. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
736. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
737. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
738. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
739. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
740. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
741. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
742. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
743. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
744. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
745. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
746. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
747. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
748. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
749. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
750. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
751. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
752. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
753. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
754. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
755. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
756. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
757. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
758. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
759. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
760. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
761. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
762. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
763. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
764. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
765. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
766. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
767. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
768. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
769. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
770. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
771. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
772. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
773. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
774. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
775. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
776. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
777. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
778. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
779. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
780. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
781. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
782. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
783. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
784. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
785. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
786. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
787. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
788. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
789. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
790. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
791. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
792. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
793. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
794. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
795. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
796. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
797. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
798. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
799. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
800. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
801. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
802. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
803. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
804. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
805. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
806. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
807. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
808. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
809. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
810. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
811. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
812. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
813. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
814. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
815. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
816. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
817. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
818. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
819. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
820. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
821. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
822. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
823. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
824. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
825. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
826. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
827. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
828. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
829. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
830. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
831. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
832. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
833. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
834. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
835. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
836. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
837. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
838. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
839. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
840. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
841. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
842. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
843. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
844. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
845. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
846. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
847. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
848. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
849. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
850. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
851. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
852. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
853. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
854. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
855. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
856. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
857. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
858. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
859. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
860. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
861. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
862. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
863. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
864. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
865. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
866. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
867. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
868. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
869. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
870. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
871. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
872. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
873. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
874. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
875. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
876. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
877. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
878. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
879. gbinv1.seq - Invertebrate sequence entries, part 1.
880. gbinv2.seq - Invertebrate sequence entries, part 2.
881. gbinv3.seq - Invertebrate sequence entries, part 3.
882. gbinv4.seq - Invertebrate sequence entries, part 4.
883. gbinv5.seq - Invertebrate sequence entries, part 5.
884. gbinv6.seq - Invertebrate sequence entries, part 6.
885. gbinv7.seq - Invertebrate sequence entries, part 7.
886. gbinv8.seq - Invertebrate sequence entries, part 8.
887. gbinv9.seq - Invertebrate sequence entries, part 9.
888. gbmam1.seq - Other mammalian sequence entries, part 1.
889. gbmam2.seq - Other mammalian sequence entries, part 2.
890. gbmam3.seq - Other mammalian sequence entries, part 3.
891. gbnew.txt - Accession numbers of entries new since the previous release.
892. gbpat1.seq - Patent sequence entries, part 1.
893. gbpat10.seq - Patent sequence entries, part 10.
894. gbpat11.seq - Patent sequence entries, part 11.
895. gbpat12.seq - Patent sequence entries, part 12.
896. gbpat13.seq - Patent sequence entries, part 13.
897. gbpat14.seq - Patent sequence entries, part 14.
898. gbpat15.seq - Patent sequence entries, part 15.
899. gbpat16.seq - Patent sequence entries, part 16.
900. gbpat17.seq - Patent sequence entries, part 17.
901. gbpat18.seq - Patent sequence entries, part 18.
902. gbpat19.seq - Patent sequence entries, part 19.
903. gbpat2.seq - Patent sequence entries, part 2.
904. gbpat20.seq - Patent sequence entries, part 20.
905. gbpat21.seq - Patent sequence entries, part 21.
906. gbpat22.seq - Patent sequence entries, part 22.
907. gbpat23.seq - Patent sequence entries, part 23.
908. gbpat24.seq - Patent sequence entries, part 24.
909. gbpat25.seq - Patent sequence entries, part 25.
910. gbpat26.seq - Patent sequence entries, part 26.
911. gbpat3.seq - Patent sequence entries, part 3.
912. gbpat4.seq - Patent sequence entries, part 4.
913. gbpat5.seq - Patent sequence entries, part 5.
914. gbpat6.seq - Patent sequence entries, part 6.
915. gbpat7.seq - Patent sequence entries, part 7.
916. gbpat8.seq - Patent sequence entries, part 8.
917. gbpat9.seq - Patent sequence entries, part 9.
918. gbphg.seq - Phage sequence entries.
919. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
920. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
921. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
922. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
923. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
924. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
925. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
926. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
927. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
928. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
929. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
930. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
931. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
932. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
933. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
934. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
935. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
936. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
937. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
938. gbpri1.seq - Primate sequence entries, part 1.
939. gbpri10.seq - Primate sequence entries, part 10.
940. gbpri11.seq - Primate sequence entries, part 11.
941. gbpri12.seq - Primate sequence entries, part 12.
942. gbpri13.seq - Primate sequence entries, part 13.
943. gbpri14.seq - Primate sequence entries, part 14.
944. gbpri15.seq - Primate sequence entries, part 15.
945. gbpri16.seq - Primate sequence entries, part 16.
946. gbpri17.seq - Primate sequence entries, part 17.
947. gbpri18.seq - Primate sequence entries, part 18.
948. gbpri19.seq - Primate sequence entries, part 19.
949. gbpri2.seq - Primate sequence entries, part 2.
950. gbpri20.seq - Primate sequence entries, part 20.
951. gbpri21.seq - Primate sequence entries, part 21.
952. gbpri22.seq - Primate sequence entries, part 22.
953. gbpri23.seq - Primate sequence entries, part 23.
954. gbpri24.seq - Primate sequence entries, part 24.
955. gbpri25.seq - Primate sequence entries, part 25.
956. gbpri26.seq - Primate sequence entries, part 26.
957. gbpri27.seq - Primate sequence entries, part 27.
958. gbpri28.seq - Primate sequence entries, part 28.
959. gbpri29.seq - Primate sequence entries, part 29.
960. gbpri3.seq - Primate sequence entries, part 3.
961. gbpri30.seq - Primate sequence entries, part 30.
962. gbpri31.seq - Primate sequence entries, part 31.
963. gbpri4.seq - Primate sequence entries, part 4.
964. gbpri5.seq - Primate sequence entries, part 5.
965. gbpri6.seq - Primate sequence entries, part 6.
966. gbpri7.seq - Primate sequence entries, part 7.
967. gbpri8.seq - Primate sequence entries, part 8.
968. gbpri9.seq - Primate sequence entries, part 9.
969. gbrel.txt - Release notes (this document).
970. gbrod1.seq - Rodent sequence entries, part 1.
971. gbrod10.seq - Rodent sequence entries, part 10.
972. gbrod11.seq - Rodent sequence entries, part 11.
973. gbrod12.seq - Rodent sequence entries, part 12.
974. gbrod13.seq - Rodent sequence entries, part 13.
975. gbrod14.seq - Rodent sequence entries, part 14.
976. gbrod15.seq - Rodent sequence entries, part 15.
977. gbrod16.seq - Rodent sequence entries, part 16.
978. gbrod17.seq - Rodent sequence entries, part 17.
979. gbrod18.seq - Rodent sequence entries, part 18.
980. gbrod19.seq - Rodent sequence entries, part 19.
981. gbrod2.seq - Rodent sequence entries, part 2.
982. gbrod20.seq - Rodent sequence entries, part 20.
983. gbrod21.seq - Rodent sequence entries, part 21.
984. gbrod22.seq - Rodent sequence entries, part 22.
985. gbrod23.seq - Rodent sequence entries, part 23.
986. gbrod24.seq - Rodent sequence entries, part 24.
987. gbrod25.seq - Rodent sequence entries, part 25.
988. gbrod3.seq - Rodent sequence entries, part 3.
989. gbrod4.seq - Rodent sequence entries, part 4.
990. gbrod5.seq - Rodent sequence entries, part 5.
991. gbrod6.seq - Rodent sequence entries, part 6.
992. gbrod7.seq - Rodent sequence entries, part 7.
993. gbrod8.seq - Rodent sequence entries, part 8.
994. gbrod9.seq - Rodent sequence entries, part 9.
995. gbsdr1.txt - Short directory of the data bank, part 1.
996. gbsdr2.txt - Short directory of the data bank, part 2.
997. gbsdr3.txt - Short directory of the data bank, part 3.
998. gbsec.idx - Index of the entries according to secondary accession number.
999. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1000. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1001. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1002. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1003. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1004. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1005. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1006. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1007. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1008. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1009. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1010. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1011. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1012. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1013. gbsyn.seq - Synthetic and chimeric sequence entries.
1014. gbuna.seq - Unannotated sequence entries.
1015. gbvrl1.seq - Viral sequence entries, part 1.
1016. gbvrl2.seq - Viral sequence entries, part 2.
1017. gbvrl3.seq - Viral sequence entries, part 3.
1018. gbvrl4.seq - Viral sequence entries, part 4.
1019. gbvrl5.seq - Viral sequence entries, part 5.
1020. gbvrl6.seq - Viral sequence entries, part 6.
1021. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1022. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1023. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1024. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1025. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1026. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1027. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1028. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1029. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1030. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1031. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1032. gbvrt9.seq - Other vertebrate sequence entries, part 9.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 156.0 flatfiles require roughly 235 GB (sequence
files only) or 245 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
2063815924 gbacc.idx
502331172 gbaut1.idx
501211280 gbaut2.idx
501013232 gbaut3.idx
504739311 gbaut4.idx
502162025 gbaut5.idx
501325647 gbaut6.idx
500014669 gbaut7.idx
157149196 gbaut8.idx
253397092 gbbct1.seq
253749239 gbbct10.seq
258837096 gbbct11.seq
252224102 gbbct12.seq
254413529 gbbct13.seq
250323076 gbbct14.seq
250000623 gbbct15.seq
250689593 gbbct16.seq
106391355 gbbct17.seq
250045053 gbbct2.seq
251002786 gbbct3.seq
250001758 gbbct4.seq
250002328 gbbct5.seq
250006474 gbbct6.seq
250004131 gbbct7.seq
250000241 gbbct8.seq
256608277 gbbct9.seq
18657660 gbchg.txt
99406244 gbcon1.seq
783065965 gbcon2.seq
1457654750 gbcon3.seq
315974 gbdel.txt
250001631 gbenv1.seq
250001908 gbenv2.seq
250002941 gbenv3.seq
42015459 gbenv4.seq
230688413 gbest1.seq
230689410 gbest10.seq
230690111 gbest100.seq
230689096 gbest101.seq
230687754 gbest102.seq
230690368 gbest103.seq
230689258 gbest104.seq
230691000 gbest105.seq
230688624 gbest106.seq
230690647 gbest107.seq
230689473 gbest108.seq
230690115 gbest109.seq
230688482 gbest11.seq
230687985 gbest110.seq
230688270 gbest111.seq
230688590 gbest112.seq
230688681 gbest113.seq
230687872 gbest114.seq
230690385 gbest115.seq
230687729 gbest116.seq
230688579 gbest117.seq
230688224 gbest118.seq
230688662 gbest119.seq
230688564 gbest12.seq
230689104 gbest120.seq
230691258 gbest121.seq
230688779 gbest122.seq
230689583 gbest123.seq
230689180 gbest124.seq
230689542 gbest125.seq
230687653 gbest126.seq
230690046 gbest127.seq
230688689 gbest128.seq
230689897 gbest129.seq
230687773 gbest13.seq
230688181 gbest130.seq
230689978 gbest131.seq
230689568 gbest132.seq
230687784 gbest133.seq
230687461 gbest134.seq
230690790 gbest135.seq
230688811 gbest136.seq
230687842 gbest137.seq
230690593 gbest138.seq
230689770 gbest139.seq
230691098 gbest14.seq
230689437 gbest140.seq
230689188 gbest141.seq
230691377 gbest142.seq
230687686 gbest143.seq
230687536 gbest144.seq
230687617 gbest145.seq
230688642 gbest146.seq
230689291 gbest147.seq
230687705 gbest148.seq
230689712 gbest149.seq
230688327 gbest15.seq
230688880 gbest150.seq
230688746 gbest151.seq
230689276 gbest152.seq
230688443 gbest153.seq
230689179 gbest154.seq
230688381 gbest155.seq
230687614 gbest156.seq
230689529 gbest157.seq
230687526 gbest158.seq
230688937 gbest159.seq
230687768 gbest16.seq
230688286 gbest160.seq
230690031 gbest161.seq
230690118 gbest162.seq
230688399 gbest163.seq
230687454 gbest164.seq
230689635 gbest165.seq
230688796 gbest166.seq
230690190 gbest167.seq
230689393 gbest168.seq
230688879 gbest169.seq
230687622 gbest17.seq
230688479 gbest170.seq
230688098 gbest171.seq
230689383 gbest172.seq
230689193 gbest173.seq
230688287 gbest174.seq
230689526 gbest175.seq
229159690 gbest176.seq
230688039 gbest177.seq
230689183 gbest178.seq
230689057 gbest179.seq
230688429 gbest18.seq
230688993 gbest180.seq
230689980 gbest181.seq
230691264 gbest182.seq
230688731 gbest183.seq
230688434 gbest184.seq
230690301 gbest185.seq
230689705 gbest186.seq
230689858 gbest187.seq
230690055 gbest188.seq
230687811 gbest189.seq
230689218 gbest19.seq
230689382 gbest190.seq
230689227 gbest191.seq
230688107 gbest192.seq
230689740 gbest193.seq
230688952 gbest194.seq
230689976 gbest195.seq
230687444 gbest196.seq
230691070 gbest197.seq
230690123 gbest198.seq
230690247 gbest199.seq
230688569 gbest2.seq
230689149 gbest20.seq
230688368 gbest200.seq
230690858 gbest201.seq
230689139 gbest202.seq
230689246 gbest203.seq
230689308 gbest204.seq
230689224 gbest205.seq
230688567 gbest206.seq
230690488 gbest207.seq
230687863 gbest208.seq
230687962 gbest209.seq
230688867 gbest21.seq
230687991 gbest210.seq
230687629 gbest211.seq
230688934 gbest212.seq
230687729 gbest213.seq
230688304 gbest214.seq
230688221 gbest215.seq
230689701 gbest216.seq
230689727 gbest217.seq
230687444 gbest218.seq
230688054 gbest219.seq
230687516 gbest22.seq
230688221 gbest220.seq
230690283 gbest221.seq
230688290 gbest222.seq
230689409 gbest223.seq
230690747 gbest224.seq
230689235 gbest225.seq
173302232 gbest226.seq
162587678 gbest227.seq
164844741 gbest228.seq
171053566 gbest229.seq
230690156 gbest23.seq
169640856 gbest230.seq
163593119 gbest231.seq
165128503 gbest232.seq
164677655 gbest233.seq
164176323 gbest234.seq
164635851 gbest235.seq
164150476 gbest236.seq
164210683 gbest237.seq
162985961 gbest238.seq
168317224 gbest239.seq
230689281 gbest24.seq
162385448 gbest240.seq
163340862 gbest241.seq
167590357 gbest242.seq
167602283 gbest243.seq
165903171 gbest244.seq
165761741 gbest245.seq
165397472 gbest246.seq
165211635 gbest247.seq
164319224 gbest248.seq
164277424 gbest249.seq
230688613 gbest25.seq
165211447 gbest250.seq
165331223 gbest251.seq
180833935 gbest252.seq
172019987 gbest253.seq
188679893 gbest254.seq
230688935 gbest255.seq
230689044 gbest256.seq
230688281 gbest257.seq
230689136 gbest258.seq
230690249 gbest259.seq
230689124 gbest26.seq
230688138 gbest260.seq
230689213 gbest261.seq
230687973 gbest262.seq
230690734 gbest263.seq
230688794 gbest264.seq
230689910 gbest265.seq
230688818 gbest266.seq
230688636 gbest267.seq
230687477 gbest268.seq
230688934 gbest269.seq
230688410 gbest27.seq
230689543 gbest270.seq
230690072 gbest271.seq
230689248 gbest272.seq
230690895 gbest273.seq
230688930 gbest274.seq
230688620 gbest275.seq
230687738 gbest276.seq
230687980 gbest277.seq
230690718 gbest278.seq
230690039 gbest279.seq
230687729 gbest28.seq
230688096 gbest280.seq
230687876 gbest281.seq
230690288 gbest282.seq
230690844 gbest283.seq
230687966 gbest284.seq
222122245 gbest285.seq
207525317 gbest286.seq
230690528 gbest287.seq
230687519 gbest288.seq
230690549 gbest289.seq
230689504 gbest29.seq
230688388 gbest290.seq
230690292 gbest291.seq
230689532 gbest292.seq
230690337 gbest293.seq
230687858 gbest294.seq
230688254 gbest295.seq
230688829 gbest296.seq
230689882 gbest297.seq
230690811 gbest298.seq
230689003 gbest299.seq
230690160 gbest3.seq
230690219 gbest30.seq
230688124 gbest300.seq
230690055 gbest301.seq
230690477 gbest302.seq
230688656 gbest303.seq
230689160 gbest304.seq
230689215 gbest305.seq
230689914 gbest306.seq
230690443 gbest307.seq
230687622 gbest308.seq
230690692 gbest309.seq
230689936 gbest31.seq
230689365 gbest310.seq
230690024 gbest311.seq
230691132 gbest312.seq
230688949 gbest313.seq
230691283 gbest314.seq
230688692 gbest315.seq
230688833 gbest316.seq
230688674 gbest317.seq
230688668 gbest318.seq
230691346 gbest319.seq
230688897 gbest32.seq
230688925 gbest320.seq
230690757 gbest321.seq
230690556 gbest322.seq
230688778 gbest323.seq
230691202 gbest324.seq
230688938 gbest325.seq
230689713 gbest326.seq
230688101 gbest327.seq
230689345 gbest328.seq
230689591 gbest329.seq
230689322 gbest33.seq
230688795 gbest330.seq
230689894 gbest331.seq
230687606 gbest332.seq
230687587 gbest333.seq
230689153 gbest334.seq
206898658 gbest335.seq
230690122 gbest336.seq
230689376 gbest337.seq
230688204 gbest338.seq
230688924 gbest339.seq
230690399 gbest34.seq
230688148 gbest340.seq
230688717 gbest341.seq
150426179 gbest342.seq
168492381 gbest343.seq
230688315 gbest344.seq
230687569 gbest345.seq
230690628 gbest346.seq
230689395 gbest347.seq
230688320 gbest348.seq
230689354 gbest349.seq
230689363 gbest35.seq
230689869 gbest350.seq
230689022 gbest351.seq
230687679 gbest352.seq
230690141 gbest353.seq
230687734 gbest354.seq
230688114 gbest355.seq
230689332 gbest356.seq
230688407 gbest357.seq
230692131 gbest358.seq
230689113 gbest359.seq
230689884 gbest36.seq
230688890 gbest360.seq
230688516 gbest361.seq
230689687 gbest362.seq
230688568 gbest363.seq
230687443 gbest364.seq
230690032 gbest365.seq
230688604 gbest366.seq
230688072 gbest367.seq
230688484 gbest368.seq
230689005 gbest369.seq
230689278 gbest37.seq
230689099 gbest370.seq
230687656 gbest371.seq
230688076 gbest372.seq
230690760 gbest373.seq
230689670 gbest374.seq
230691684 gbest375.seq
230692912 gbest376.seq
230692273 gbest377.seq
230689064 gbest378.seq
230688281 gbest379.seq
230689984 gbest38.seq
230687478 gbest380.seq
230690215 gbest381.seq
230688913 gbest382.seq
230688859 gbest383.seq
230688250 gbest384.seq
230689468 gbest385.seq
230690609 gbest386.seq
230690498 gbest387.seq
230689560 gbest388.seq
227609174 gbest389.seq
230689418 gbest39.seq
230688518 gbest390.seq
230688609 gbest391.seq
230688123 gbest392.seq
230688144 gbest393.seq
230689128 gbest394.seq
230691218 gbest395.seq
217171780 gbest396.seq
230689535 gbest397.seq
230689012 gbest398.seq
230688026 gbest399.seq
230687668 gbest4.seq
230689575 gbest40.seq
230688072 gbest400.seq
230690859 gbest401.seq
230690010 gbest402.seq
230689337 gbest403.seq
230690761 gbest404.seq
230689329 gbest405.seq
230688713 gbest406.seq
230689113 gbest407.seq
230688912 gbest408.seq
230688284 gbest409.seq
230688725 gbest41.seq
230691229 gbest410.seq
230688859 gbest411.seq
230689213 gbest412.seq
230687624 gbest413.seq
210619555 gbest414.seq
210229638 gbest415.seq
210104100 gbest416.seq
210398274 gbest417.seq
210316196 gbest418.seq
210433373 gbest419.seq
229427140 gbest42.seq
211290353 gbest420.seq
211486397 gbest421.seq
211497248 gbest422.seq
211936064 gbest423.seq
213637859 gbest424.seq
211449334 gbest425.seq
210754463 gbest426.seq
210719670 gbest427.seq
210631074 gbest428.seq
210156695 gbest429.seq
192721854 gbest43.seq
210224141 gbest430.seq
210198474 gbest431.seq
210176434 gbest432.seq
221573901 gbest433.seq
230688350 gbest434.seq
230689890 gbest435.seq
230687542 gbest436.seq
230688325 gbest437.seq
230691653 gbest438.seq
230688294 gbest439.seq
191580324 gbest44.seq
230690920 gbest440.seq
230689368 gbest441.seq
230687817 gbest442.seq
230688359 gbest443.seq
230688987 gbest444.seq
230687519 gbest445.seq
230691266 gbest446.seq
230688233 gbest447.seq
230689404 gbest448.seq
230688670 gbest449.seq
213235232 gbest45.seq
230687687 gbest450.seq
230690276 gbest451.seq
230689793 gbest452.seq
230689982 gbest453.seq
230688506 gbest454.seq
230689455 gbest455.seq
230687722 gbest456.seq
230689957 gbest457.seq
230687816 gbest458.seq
230687441 gbest459.seq
216173771 gbest46.seq
230687583 gbest460.seq
230690914 gbest461.seq
230690202 gbest462.seq
230691202 gbest463.seq
230688051 gbest464.seq
230690170 gbest465.seq
230690206 gbest466.seq
230688350 gbest467.seq
230687905 gbest468.seq
230687725 gbest469.seq
215933638 gbest47.seq
230690939 gbest470.seq
230690334 gbest471.seq
230689186 gbest472.seq
230690163 gbest473.seq
230690918 gbest474.seq
230689190 gbest475.seq
230688979 gbest476.seq
230689050 gbest477.seq
230690558 gbest478.seq
230688685 gbest479.seq
216989315 gbest48.seq
230689036 gbest480.seq
230688656 gbest481.seq
230688802 gbest482.seq
230687758 gbest483.seq
230688704 gbest484.seq
230687712 gbest485.seq
230688000 gbest486.seq
230688357 gbest487.seq
230687811 gbest488.seq
230689603 gbest489.seq
230688497 gbest49.seq
230687656 gbest490.seq
230687852 gbest491.seq
230687450 gbest492.seq
225921281 gbest493.seq
225870086 gbest494.seq
230687455 gbest495.seq
230689225 gbest496.seq
230688169 gbest497.seq
230688553 gbest498.seq
230690739 gbest499.seq
164127827 gbest5.seq
230687935 gbest50.seq
230688466 gbest500.seq
230689680 gbest501.seq
230689166 gbest502.seq
230688536 gbest503.seq
230688179 gbest504.seq
230688318 gbest505.seq
230689565 gbest506.seq
229205187 gbest507.seq
196058373 gbest508.seq
222460001 gbest509.seq
227198104 gbest51.seq
230690258 gbest510.seq
230689403 gbest511.seq
230688768 gbest512.seq
230688057 gbest513.seq
230690229 gbest514.seq
230689672 gbest515.seq
230690746 gbest516.seq
230690347 gbest517.seq
230687479 gbest518.seq
230688343 gbest519.seq
230163976 gbest52.seq
230689503 gbest520.seq
230688272 gbest521.seq
230688457 gbest522.seq
230689715 gbest523.seq
230688702 gbest524.seq
230689199 gbest525.seq
230687855 gbest526.seq
228752733 gbest527.seq
218293401 gbest528.seq
230688076 gbest529.seq
230687928 gbest53.seq
230689025 gbest530.seq
230688080 gbest531.seq
230687526 gbest532.seq
230689453 gbest533.seq
230688795 gbest534.seq
230688234 gbest535.seq
230688908 gbest536.seq
230687518 gbest537.seq
230689056 gbest538.seq
230688892 gbest539.seq
230690883 gbest54.seq
230687670 gbest540.seq
230687733 gbest541.seq
230687664 gbest542.seq
230688911 gbest543.seq
230689330 gbest544.seq
230688307 gbest545.seq
230689313 gbest546.seq
230688878 gbest547.seq
230688924 gbest548.seq
230690202 gbest549.seq
230688969 gbest55.seq
230689690 gbest550.seq
230688574 gbest551.seq
220271994 gbest552.seq
230690433 gbest553.seq
222593997 gbest554.seq
230690067 gbest56.seq
230688544 gbest57.seq
230688202 gbest58.seq
230689100 gbest59.seq
177450586 gbest6.seq
230689965 gbest60.seq
230689483 gbest61.seq
230687519 gbest62.seq
230689292 gbest63.seq
230692586 gbest64.seq
230692649 gbest65.seq
230395332 gbest66.seq
230689386 gbest67.seq
209954396 gbest68.seq
209403267 gbest69.seq
230687876 gbest7.seq
208665609 gbest70.seq
209085267 gbest71.seq
209590860 gbest72.seq
210564250 gbest73.seq
209626384 gbest74.seq
208365166 gbest75.seq
210182934 gbest76.seq
208878894 gbest77.seq
205201670 gbest78.seq
208458430 gbest79.seq
230687875 gbest8.seq
207721360 gbest80.seq
210525979 gbest81.seq
224631036 gbest82.seq
230688975 gbest83.seq
230688376 gbest84.seq
222190019 gbest85.seq
214508601 gbest86.seq
214079678 gbest87.seq
230690078 gbest88.seq
230689746 gbest89.seq
230688341 gbest9.seq
230690715 gbest90.seq
230687682 gbest91.seq
230688623 gbest92.seq
230688399 gbest93.seq
230689827 gbest94.seq
230688704 gbest95.seq
230689691 gbest96.seq
230687508 gbest97.seq
230687506 gbest98.seq
230689878 gbest99.seq
68704293 gbgen.idx
230688077 gbgss1.seq
230687828 gbgss10.seq
228023753 gbgss100.seq
227980558 gbgss101.seq
228595561 gbgss102.seq
228611433 gbgss103.seq
228214065 gbgss104.seq
227702996 gbgss105.seq
230688799 gbgss106.seq
230690089 gbgss107.seq
230690680 gbgss108.seq
230687762 gbgss109.seq
230687606 gbgss11.seq
230689115 gbgss110.seq
230690649 gbgss111.seq
230689122 gbgss112.seq
230689716 gbgss113.seq
230689875 gbgss114.seq
230689012 gbgss115.seq
230689466 gbgss116.seq
230688478 gbgss117.seq
230689540 gbgss118.seq
230688039 gbgss119.seq
230687740 gbgss12.seq
230688088 gbgss120.seq
230688050 gbgss121.seq
230688363 gbgss122.seq
230688531 gbgss123.seq
230689775 gbgss124.seq
230689101 gbgss125.seq
230689851 gbgss126.seq
230688227 gbgss127.seq
230687448 gbgss128.seq
230690374 gbgss129.seq
230690045 gbgss13.seq
230687618 gbgss130.seq
230687924 gbgss131.seq
230687950 gbgss132.seq
230689529 gbgss133.seq
230689467 gbgss134.seq
230690132 gbgss135.seq
230688901 gbgss136.seq
230687845 gbgss137.seq
230688526 gbgss138.seq
230687727 gbgss139.seq
230689789 gbgss14.seq
230689421 gbgss140.seq
230687787 gbgss141.seq
230689079 gbgss142.seq
230688212 gbgss143.seq
224266913 gbgss144.seq
230688737 gbgss145.seq
230689538 gbgss146.seq
202717250 gbgss147.seq
230688006 gbgss148.seq
230688472 gbgss149.seq
230687716 gbgss15.seq
230689076 gbgss150.seq
230688196 gbgss151.seq
230690204 gbgss152.seq
230689021 gbgss153.seq
230687729 gbgss154.seq
173159400 gbgss155.seq
250002038 gbgss156.seq
250000034 gbgss157.seq
250000759 gbgss158.seq
250002082 gbgss159.seq
230689488 gbgss16.seq
250002778 gbgss160.seq
250000082 gbgss161.seq
250001097 gbgss162.seq
250001346 gbgss163.seq
250001591 gbgss164.seq
250002039 gbgss165.seq
250001643 gbgss166.seq
250001757 gbgss167.seq
250000549 gbgss168.seq
250000768 gbgss169.seq
230689664 gbgss17.seq
250003022 gbgss170.seq
250001636 gbgss171.seq
250003345 gbgss172.seq
250000714 gbgss173.seq
250001757 gbgss174.seq
250000099 gbgss175.seq
250002088 gbgss176.seq
250001239 gbgss177.seq
250000814 gbgss178.seq
250000658 gbgss179.seq
230688888 gbgss18.seq
250000626 gbgss180.seq
250000215 gbgss181.seq
250000770 gbgss182.seq
250001647 gbgss183.seq
250000915 gbgss184.seq
250000926 gbgss185.seq
250001230 gbgss186.seq
250001363 gbgss187.seq
250000953 gbgss188.seq
250002146 gbgss189.seq
230689897 gbgss19.seq
189269920 gbgss190.seq
230687684 gbgss2.seq
230690067 gbgss20.seq
230688835 gbgss21.seq
230691016 gbgss22.seq
230691085 gbgss23.seq
230689899 gbgss24.seq
230687864 gbgss25.seq
230688958 gbgss26.seq
230689374 gbgss27.seq
230689562 gbgss28.seq
230689901 gbgss29.seq
230690835 gbgss3.seq
230689605 gbgss30.seq
230688431 gbgss31.seq
230689450 gbgss32.seq
230690395 gbgss33.seq
230687480 gbgss34.seq
230690180 gbgss35.seq
230687454 gbgss36.seq
230687600 gbgss37.seq
230690135 gbgss38.seq
230690398 gbgss39.seq
230689817 gbgss4.seq
230689568 gbgss40.seq
230689925 gbgss41.seq
230688530 gbgss42.seq
230687546 gbgss43.seq
230689722 gbgss44.seq
230687863 gbgss45.seq
230689764 gbgss46.seq
230689834 gbgss47.seq
230688641 gbgss48.seq
230689280 gbgss49.seq
230690411 gbgss5.seq
230688020 gbgss50.seq
230688697 gbgss51.seq
230688446 gbgss52.seq
230689282 gbgss53.seq
230687790 gbgss54.seq
230687669 gbgss55.seq
230688951 gbgss56.seq
230688199 gbgss57.seq
230687520 gbgss58.seq
230688430 gbgss59.seq
230690401 gbgss6.seq
230687731 gbgss60.seq
229150528 gbgss61.seq
230687846 gbgss62.seq
230689140 gbgss63.seq
230687956 gbgss64.seq
230689071 gbgss65.seq
230687968 gbgss66.seq
230689275 gbgss67.seq
230689309 gbgss68.seq
230687543 gbgss69.seq
230690824 gbgss7.seq
230689553 gbgss70.seq
230689334 gbgss71.seq
230688967 gbgss72.seq
230687852 gbgss73.seq
230688187 gbgss74.seq
230687752 gbgss75.seq
230687631 gbgss76.seq
230687655 gbgss77.seq
230689662 gbgss78.seq
230687666 gbgss79.seq
230689975 gbgss8.seq
230687446 gbgss80.seq
207738988 gbgss81.seq
194702597 gbgss82.seq
212422187 gbgss83.seq
230689445 gbgss84.seq
230688272 gbgss85.seq
230689109 gbgss86.seq
230690352 gbgss87.seq
230688299 gbgss88.seq
230688261 gbgss89.seq
230689930 gbgss9.seq
230688872 gbgss90.seq
230690526 gbgss91.seq
230688906 gbgss92.seq
230690767 gbgss93.seq
230687621 gbgss94.seq
230688405 gbgss95.seq
230689199 gbgss96.seq
230687519 gbgss97.seq
230687532 gbgss98.seq
230687710 gbgss99.seq
250004946 gbhtc1.seq
250001501 gbhtc10.seq
250000805 gbhtc11.seq
89952402 gbhtc12.seq
250009739 gbhtc2.seq
250012126 gbhtc3.seq
250002187 gbhtc4.seq
250007686 gbhtc5.seq
250009409 gbhtc6.seq
250000603 gbhtc7.seq
250000846 gbhtc8.seq
250003103 gbhtc9.seq
250237448 gbhtg1.seq
250176157 gbhtg10.seq
250000257 gbhtg11.seq
250085847 gbhtg12.seq
250295963 gbhtg13.seq
250240196 gbhtg14.seq
250065413 gbhtg15.seq
250143829 gbhtg16.seq
250337651 gbhtg17.seq
250083031 gbhtg18.seq
250018774 gbhtg19.seq
250032700 gbhtg2.seq
250559515 gbhtg20.seq
250270371 gbhtg21.seq
250143798 gbhtg22.seq
250447974 gbhtg23.seq
250477508 gbhtg24.seq
250205057 gbhtg25.seq
250347489 gbhtg26.seq
250304133 gbhtg27.seq
250028005 gbhtg28.seq
250119929 gbhtg29.seq
250064165 gbhtg3.seq
250126940 gbhtg30.seq
250090350 gbhtg31.seq
250094986 gbhtg32.seq
250001387 gbhtg33.seq
250181278 gbhtg34.seq
250271560 gbhtg35.seq
250036942 gbhtg36.seq
250066105 gbhtg37.seq
250142992 gbhtg38.seq
250276898 gbhtg39.seq
250187160 gbhtg4.seq
250037411 gbhtg40.seq
250066413 gbhtg41.seq
250077219 gbhtg42.seq
250119629 gbhtg43.seq
250105852 gbhtg44.seq
250074973 gbhtg45.seq
250203081 gbhtg46.seq
250144094 gbhtg47.seq
250135222 gbhtg48.seq
250060325 gbhtg49.seq
250197337 gbhtg5.seq
250117519 gbhtg50.seq
250064532 gbhtg51.seq
250023524 gbhtg52.seq
250264881 gbhtg53.seq
250020609 gbhtg54.seq
250058175 gbhtg55.seq
250268772 gbhtg56.seq
250066917 gbhtg57.seq
250123032 gbhtg58.seq
250064800 gbhtg59.seq
250104846 gbhtg6.seq
250179241 gbhtg60.seq
250006195 gbhtg61.seq
250068210 gbhtg62.seq
250134856 gbhtg63.seq
250134290 gbhtg64.seq
250026870 gbhtg65.seq
250051424 gbhtg66.seq
250142819 gbhtg67.seq
250015310 gbhtg68.seq
250006287 gbhtg69.seq
250129674 gbhtg7.seq
250131133 gbhtg70.seq
250160964 gbhtg71.seq
250197781 gbhtg72.seq
250271218 gbhtg73.seq
250004277 gbhtg74.seq
250269157 gbhtg75.seq
250042493 gbhtg76.seq
250051359 gbhtg77.seq
250002887 gbhtg78.seq
250127510 gbhtg79.seq
250121591 gbhtg8.seq
250284420 gbhtg80.seq
250262816 gbhtg81.seq
252007638 gbhtg82.seq
250049831 gbhtg83.seq
250020760 gbhtg84.seq
250155099 gbhtg85.seq
163194297 gbhtg86.seq
250322628 gbhtg9.seq
250074597 gbinv1.seq
250049528 gbinv2.seq
250000251 gbinv3.seq
250728576 gbinv4.seq
250002428 gbinv5.seq
250001299 gbinv6.seq
250000034 gbinv7.seq
250004185 gbinv8.seq
107458141 gbinv9.seq
250116293 gbmam1.seq
250001409 gbmam2.seq
29737074 gbmam3.seq
26074190 gbnew.txt
250003273 gbpat1.seq
250000419 gbpat10.seq
250001255 gbpat11.seq
250000155 gbpat12.seq
250001248 gbpat13.seq
250032616 gbpat14.seq
250001555 gbpat15.seq
250000063 gbpat16.seq
250002190 gbpat17.seq
250036240 gbpat18.seq
250001396 gbpat19.seq
250002492 gbpat2.seq
250000083 gbpat20.seq
250000631 gbpat21.seq
250079764 gbpat22.seq
250001024 gbpat23.seq
250004215 gbpat24.seq
250000630 gbpat25.seq
118562608 gbpat26.seq
250001521 gbpat3.seq
250003935 gbpat4.seq
250000148 gbpat5.seq
250001365 gbpat6.seq
250001901 gbpat7.seq
250003411 gbpat8.seq
250000512 gbpat9.seq
52693194 gbphg.seq
250121653 gbpln1.seq
256257327 gbpln10.seq
250101312 gbpln11.seq
250000209 gbpln12.seq
250000743 gbpln13.seq
250000484 gbpln14.seq
250088262 gbpln15.seq
250001231 gbpln16.seq
250002598 gbpln17.seq
250000987 gbpln18.seq
167396785 gbpln19.seq
250092077 gbpln2.seq
250020836 gbpln3.seq
250001358 gbpln4.seq
250002832 gbpln5.seq
250002689 gbpln6.seq
250111496 gbpln7.seq
250053355 gbpln8.seq
295075945 gbpln9.seq
250217397 gbpri1.seq
250148292 gbpri10.seq
250029750 gbpri11.seq
250061489 gbpri12.seq
250056508 gbpri13.seq
250139883 gbpri14.seq
250141831 gbpri15.seq
250002557 gbpri16.seq
250003815 gbpri17.seq
250213460 gbpri18.seq
250148659 gbpri19.seq
250049822 gbpri2.seq
250041408 gbpri20.seq
250003422 gbpri21.seq
250146560 gbpri22.seq
250036886 gbpri23.seq
250002065 gbpri24.seq
250003094 gbpri25.seq
250223935 gbpri26.seq
250001043 gbpri27.seq
250034748 gbpri28.seq
250197741 gbpri29.seq
250173348 gbpri3.seq
250031242 gbpri30.seq
160278902 gbpri31.seq
250211019 gbpri4.seq
250181780 gbpri5.seq
250223461 gbpri6.seq
250034324 gbpri7.seq
250094976 gbpri8.seq
250106964 gbpri9.seq
233024 gbrel.txt
250216601 gbrod1.seq
250169795 gbrod10.seq
250040283 gbrod11.seq
250145250 gbrod12.seq
250139281 gbrod13.seq
250120971 gbrod14.seq
250051702 gbrod15.seq
250009135 gbrod16.seq
250008081 gbrod17.seq
250007792 gbrod18.seq
250137021 gbrod19.seq
250172647 gbrod2.seq
250014223 gbrod20.seq
250001926 gbrod21.seq
250112181 gbrod22.seq
250000588 gbrod23.seq
250001396 gbrod24.seq
91823456 gbrod25.seq
250283869 gbrod3.seq
250291920 gbrod4.seq
250178620 gbrod5.seq
250156326 gbrod6.seq
250141641 gbrod7.seq
250192027 gbrod8.seq
250000794 gbrod9.seq
656153500 gbsdr1.txt
3118697188 gbsdr2.txt
1246431760 gbsdr3.txt
2271246 gbsec.idx
250001976 gbsts1.seq
250000971 gbsts10.seq
250002463 gbsts11.seq
250001006 gbsts12.seq
250000794 gbsts13.seq
45073194 gbsts14.seq
250002556 gbsts2.seq
250000042 gbsts3.seq
250002798 gbsts4.seq
250002066 gbsts5.seq
250002667 gbsts6.seq
250004451 gbsts7.seq
250002334 gbsts8.seq
250000760 gbsts9.seq
166828168 gbsyn.seq
422535 gbuna.seq
250010063 gbvrl1.seq
250000749 gbvrl2.seq
250001653 gbvrl3.seq
250001193 gbvrl4.seq
250000347 gbvrl5.seq
192684510 gbvrl6.seq
250002281 gbvrt1.seq
250200929 gbvrt10.seq
250002489 gbvrt11.seq
91359714 gbvrt12.seq
250043016 gbvrt2.seq
250001075 gbvrt3.seq
250003527 gbvrt4.seq
250120729 gbvrt5.seq
250174766 gbvrt6.seq
250118908 gbvrt7.seq
250000204 gbvrt8.seq
250002577 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 26496 104334993
BCT10 2194 111441533
BCT11 47 115874001
BCT12 53 114572038
BCT13 60 116676469
BCT14 452 110972398
BCT15 31206 95372986
BCT16 49419 89001452
BCT17 12218 38940219
BCT2 4845 107684464
BCT3 146 112075037
BCT4 24282 103770688
BCT5 36531 92252380
BCT6 5772 107816024
BCT7 65427 83869236
BCT8 7448 114123311
BCT9 1446 96311823
ENV1 92773 72271338
ENV2 88266 80388825
ENV3 91537 81770804
ENV4 16263 12053447
EST1 68132 26291928
EST10 76538 29845881
EST100 73729 34825505
EST101 72600 42118797
EST102 67682 36413958
EST103 73281 36087331
EST104 72731 49350560
EST105 72491 42517623
EST106 69257 45619137
EST107 73848 33204566
EST108 70929 29777230
EST109 64901 33336477
EST11 75115 28773787
EST110 68084 39706927
EST111 69870 39629917
EST112 71407 40697253
EST113 75379 34176504
EST114 74389 27518334
EST115 74710 30434040
EST116 72186 38425620
EST117 65881 33347785
EST118 79357 47363593
EST119 78563 44374756
EST12 77708 30807144
EST120 70214 47582475
EST121 69362 39519022
EST122 72734 49768365
EST123 68325 42516169
EST124 74263 44923447
EST125 74298 45070892
EST126 71171 48645318
EST127 74542 48204068
EST128 75992 45945319
EST129 77092 32734035
EST13 77115 29303869
EST130 77717 30424814
EST131 79903 48160406
EST132 74905 42690511
EST133 64697 35193579
EST134 72559 37366000
EST135 66589 36657978
EST136 66336 36272453
EST137 71008 43786705
EST138 72826 44189355
EST139 67896 40138870
EST14 78488 31801075
EST140 67126 40073776
EST141 76569 45060167
EST142 68950 41555663
EST143 59648 33715471
EST144 98695 53735782
EST145 82651 47434727
EST146 80972 41878273
EST147 102563 54899683
EST148 107192 57784492
EST149 98801 55155546
EST15 74857 31633275
EST150 73340 44838523
EST151 94297 55433071
EST152 99635 59517043
EST153 94746 57220823
EST154 75560 43866811
EST155 68844 37482757
EST156 65953 29975162
EST157 60333 27839597
EST158 56280 27399252
EST159 64753 31457516
EST16 75818 33329573
EST160 54212 27222251
EST161 80374 54250549
EST162 68302 36597694
EST163 72209 52638458
EST164 71915 40904489
EST165 60737 30454573
EST166 63825 38376238
EST167 65872 32250018
EST168 63427 45914745
EST169 64333 37024228
EST17 82603 34101648
EST170 103972 45950113
EST171 87810 52101851
EST172 99115 57399761
EST173 101897 57054558
EST174 96623 52002048
EST175 79979 37888205
EST176 92396 40365068
EST177 94640 49528838
EST178 89536 34783195
EST179 95433 43530015
EST18 81045 32199593
EST180 63950 43005177
EST181 68919 37154827
EST182 59684 34931545
EST183 69806 44528293
EST184 71018 29331273
EST185 76395 37345828
EST186 70359 40826545
EST187 74253 37017662
EST188 67190 35234356
EST189 69420 50013437
EST19 78338 31879774
EST190 67711 45268443
EST191 68736 35014905
EST192 68267 45624969
EST193 68621 51956314
EST194 68444 35794616
EST195 71191 43090745
EST196 70629 61117463
EST197 65278 47406507
EST198 64489 47269848
EST199 64263 47227667
EST2 74651 28648243
EST20 74804 30647838
EST200 66015 46021626
EST201 67037 51061270
EST202 62726 40329549
EST203 62184 38031550
EST204 62801 34855362
EST205 68053 38670495
EST206 84487 49203919
EST207 80172 52987596
EST208 76825 45106321
EST209 106550 66062809
EST21 73457 34190090
EST210 109004 65288343
EST211 108520 64492957
EST212 103278 66788753
EST213 108242 56319620
EST214 103228 51348969
EST215 90982 54851635
EST216 99031 43276126
EST217 88721 49534968
EST218 72188 44584923
EST219 67061 47214667
EST22 75910 30461725
EST220 68370 58597111
EST221 71518 55681749
EST222 78575 39529149
EST223 79929 48500283
EST224 73986 52875728
EST225 70911 51184890
EST226 33113 13973598
EST227 27798 10601123
EST228 27425 10157900
EST229 26354 9665648
EST23 77302 32566771
EST230 26678 8974109
EST231 27621 10064378
EST232 27206 9832014
EST233 27198 9819453
EST234 27294 10538763
EST235 27121 11990010
EST236 27224 11157310
EST237 27353 9993070
EST238 27621 9258859
EST239 26880 9389817
EST24 75009 33181059
EST240 27812 11295997
EST241 27699 10876351
EST242 26958 11335961
EST243 26682 12009528
EST244 27079 11245212
EST245 27036 10884672
EST246 27029 11674002
EST247 27155 11550556
EST248 27267 10961153
EST249 27261 10850457
EST25 73551 31508778
EST250 27162 10465274
EST251 27129 11654179
EST252 24403 17199513
EST253 25809 17253893
EST254 49009 22350036
EST255 84184 42891919
EST256 58779 30005061
EST257 97393 39979961
EST258 70810 42221425
EST259 68759 44591375
EST26 75773 31313320
EST260 69407 44354912
EST261 69672 43869063
EST262 69455 40742132
EST263 69836 40319248
EST264 64833 49381763
EST265 63500 31016559
EST266 85843 42285251
EST267 98272 45942499
EST268 71597 40853227
EST269 64700 32698119
EST27 75353 32857663
EST270 69814 33657286
EST271 69818 42744543
EST272 74762 34670112
EST273 70807 36655252
EST274 71942 46558249
EST275 64283 35625696
EST276 68011 35728177
EST277 84551 45167807
EST278 72401 40058693
EST279 81708 55179045
EST28 108320 51493172
EST280 81371 52465936
EST281 110539 49048029
EST282 77513 42197354
EST283 73886 45725149
EST284 72946 40443805
EST285 70247 34640649
EST286 70122 27345117
EST287 67891 41135171
EST288 62547 35191575
EST289 64705 41516638
EST29 97472 46535173
EST290 70474 40512324
EST291 64760 44517611
EST292 63021 32316242
EST293 80813 42828102
EST294 83702 44413812
EST295 82083 50470244
EST296 109206 53950178
EST297 116338 48279366
EST298 72584 35223660
EST299 67571 36689345
EST3 73739 29916860
EST30 98539 53652889
EST300 71317 46788486
EST301 80850 39785691
EST302 69995 41861420
EST303 71321 41490753
EST304 60158 34303984
EST305 52752 31778531
EST306 68245 43356272
EST307 69616 44930217
EST308 68333 42592290
EST309 70622 40893781
EST31 80424 46259044
EST310 76595 38203438
EST311 56150 29872366
EST312 53668 27462662
EST313 52640 28135766
EST314 52868 28243241
EST315 51853 27577390
EST316 54465 25581078
EST317 55750 24509092
EST318 55082 23104378
EST319 54560 22431179
EST32 65848 49869347
EST320 55601 21333829
EST321 55097 22141830
EST322 55935 22238738
EST323 55120 21411297
EST324 56220 20035545
EST325 67254 38550596
EST326 76426 34310735
EST327 74260 32292177
EST328 76964 32927902
EST329 79503 36502322
EST33 73944 53206977
EST330 89581 61068346
EST331 71144 52340408
EST332 92248 56817332
EST333 93133 56002611
EST334 88476 52963846
EST335 69424 39036683
EST336 77451 43560125
EST337 62914 55532658
EST338 64110 46188192
EST339 65144 41555698
EST34 85808 47754359
EST340 62706 36042675
EST341 72642 50549901
EST342 49455 26294931
EST343 52807 26272228
EST344 71972 39294820
EST345 60813 32941104
EST346 61628 31077124
EST347 65277 42218424
EST348 86476 43606535
EST349 71414 42319688
EST35 87273 44614018
EST350 67934 43627740
EST351 66535 37778196
EST352 67303 44006811
EST353 87173 49248127
EST354 84786 50500854
EST355 76267 41848626
EST356 63025 36988562
EST357 65712 33984201
EST358 72432 39690655
EST359 47198 24147384
EST36 96410 52581391
EST360 67688 38824145
EST361 72596 42748508
EST362 98819 46081612
EST363 73549 48866422
EST364 70156 44907161
EST365 68485 44006085
EST366 63857 34901718
EST367 80918 37186856
EST368 76167 38778551
EST369 55119 39037048
EST37 79765 57848345
EST370 61492 38705451
EST371 61184 39523363
EST372 95832 53752708
EST373 82262 43556303
EST374 70184 46796277
EST375 73902 37880046
EST376 47599 29473707
EST377 44121 23114578
EST378 80468 54476490
EST379 80304 39553290
EST38 82259 57611408
EST380 78641 46749057
EST381 75457 45750680
EST382 77569 47969763
EST383 74712 49287147
EST384 71160 40233626
EST385 60299 39409202
EST386 75031 39966757
EST387 52236 32643013
EST388 77997 30647245
EST389 80906 28970367
EST39 101264 48764594
EST390 70230 44386045
EST391 64821 36988229
EST392 68074 35302929
EST393 71914 42383439
EST394 67915 46153245
EST395 66358 44373478
EST396 75997 44589187
EST397 59137 33092522
EST398 60666 37549848
EST399 83224 52443785
EST4 74569 28389457
EST40 92522 46275951
EST400 82633 48791913
EST401 77199 43717739
EST402 58897 41048627
EST403 56830 40909516
EST404 57296 40599305
EST405 62602 39193627
EST406 77750 47460520
EST407 49933 31578839
EST408 63256 39553507
EST409 58023 40640831
EST41 96215 47397708
EST410 61011 41074459
EST411 56183 42154582
EST412 47210 33531163
EST413 91644 42343572
EST414 69406 38634230
EST415 69719 38300023
EST416 69875 38203520
EST417 69554 38767179
EST418 69595 38548783
EST419 69565 38721278
EST42 96168 38061866
EST420 68951 38379408
EST421 69043 38207997
EST422 68988 39366964
EST423 68415 37684866
EST424 67507 38524261
EST425 69320 39124394
EST426 69338 38191092
EST427 69445 38516996
EST428 69488 37978859
EST429 69854 38177641
EST43 68598 18388104
EST430 69713 38359405
EST431 69752 38273377
EST432 69904 37518569
EST433 81088 45387977
EST434 86258 46218311
EST435 79689 35667943
EST436 78413 42855552
EST437 63707 45780988
EST438 52071 40770208
EST439 68565 45006233
EST44 68844 18352750
EST440 65547 37747647
EST441 68758 40969133
EST442 111449 56525418
EST443 82663 50869196
EST444 85167 56473000
EST445 51434 32857950
EST446 49323 42148126
EST447 46667 58994696
EST448 70299 56992493
EST449 65605 37771863
EST45 65715 20043035
EST450 73531 43120421
EST451 68545 43141032
EST452 67260 44018269
EST453 64655 49782669
EST454 77914 45530082
EST455 109178 47938290
EST456 86036 52567499
EST457 62709 41605122
EST458 56301 41010543
EST459 55694 37505737
EST46 43670 11852578
EST460 66370 48244288
EST461 66060 46439095
EST462 62279 45548807
EST463 52123 37484410
EST464 52718 38383244
EST465 59519 42513297
EST466 63827 36375508
EST467 70063 44784794
EST468 57248 38012611
EST469 57263 40186162
EST47 43401 12096356
EST470 62682 46696412
EST471 60013 46383785
EST472 63548 41999767
EST473 52949 40849949
EST474 54844 36561736
EST475 53152 36218185
EST476 59491 39129511
EST477 67748 40282803
EST478 65316 44728656
EST479 74476 61315147
EST48 43222 11474293
EST480 73700 50186202
EST481 61494 52611913
EST482 47976 56015474
EST483 60805 52101861
EST484 64071 40986405
EST485 67041 38301362
EST486 81908 51031589
EST487 81527 54415387
EST488 81871 49711325
EST489 59555 39374994
EST49 73452 28643754
EST490 72123 46296870
EST491 80317 50693122
EST492 79058 56455396
EST493 71601 54032164
EST494 71754 51131737
EST495 67736 45142374
EST496 62573 49934211
EST497 62776 45348337
EST498 76543 44321009
EST499 70069 42917816
EST5 48198 15295521
EST50 96778 44640278
EST500 113404 46072343
EST501 116689 48994327
EST502 81618 52007934
EST503 50576 49945533
EST504 71984 37602894
EST505 103303 11558284
EST506 103375 11445631
EST507 98019 37485184
EST508 86986 31693531
EST509 86446 34683442
EST51 92786 45873414
EST510 61275 63453810
EST511 89307 56531122
EST512 83018 45828550
EST513 68704 42735875
EST514 72105 49526077
EST515 76107 48746230
EST516 89589 52678194
EST517 70876 51143388
EST518 70095 50279294
EST519 69646 52301205
EST52 90136 43225633
EST520 82260 55301362
EST521 86867 43622124
EST522 79726 43352683
EST523 79810 55185215
EST524 72806 55614667
EST525 71516 48549545
EST526 89963 44935517
EST527 106263 45353302
EST528 109501 49085305
EST529 129878 53932277
EST53 101419 51260674
EST530 130705 57889583
EST531 73888 54447790
EST532 84873 41834866
EST533 84289 8749848
EST534 94375 29275887
EST535 127228 62711498
EST536 99228 57232608
EST537 66182 42561037
EST538 71650 45808787
EST539 76664 52301364
EST54 102414 52312772
EST540 71210 45751860
EST541 72165 47759565
EST542 70738 53640687
EST543 68773 44211473
EST544 63125 46412970
EST545 93541 58665309
EST546 91384 51995275
EST547 84979 36716492
EST548 71646 25591176
EST549 72226 26945333
EST55 75905 32945648
EST550 73399 26146124
EST551 72031 26141494
EST552 77317 25861382
EST553 71570 28936859
EST554 72096 27257275
EST56 66534 28771788
EST57 73312 32503166
EST58 70588 30029854
EST59 79992 32534479
EST6 54924 17445206
EST60 75904 29877818
EST61 70941 28633690
EST62 65073 29796316
EST63 73265 32827202
EST64 78744 35201468
EST65 73491 29343720
EST66 74662 25230330
EST67 86999 42254131
EST68 42038 11804446
EST69 40410 11133744
EST7 74544 29357938
EST70 40380 12377953
EST71 40762 12584116
EST72 40791 12170747
EST73 40774 13224659
EST74 40614 12680472
EST75 40487 12331065
EST76 40143 11931676
EST77 40808 12805820
EST78 41467 11696652
EST79 41010 13195946
EST8 75853 30597153
EST80 40898 12756834
EST81 41953 13176639
EST82 45729 14594534
EST83 43224 27268660
EST84 42091 20223515
EST85 47267 18998046
EST86 50703 22949288
EST87 51189 21294164
EST88 78193 46104085
EST89 77986 38621781
EST9 77568 29867722
EST90 72477 28052126
EST91 75701 29452023
EST92 74538 38932997
EST93 76435 41855568
EST94 77656 44834660
EST95 75690 34786840
EST96 75274 43708009
EST97 70623 36322354
EST98 75556 34391725
EST99 72224 44064903
GSS1 90427 38661176
GSS10 74869 43583037
GSS100 75077 42497421
GSS101 74342 43242882
GSS102 73628 45042091
GSS103 73606 45095491
GSS104 73270 45281144
GSS105 73292 44753210
GSS106 75829 48301553
GSS107 86685 57582199
GSS108 82316 55173154
GSS109 82706 51842337
GSS11 70614 35935027
GSS110 87621 53206960
GSS111 80251 63393322
GSS112 80421 47502853
GSS113 94529 52820462
GSS114 81740 50438968
GSS115 80807 54618131
GSS116 87103 69001453
GSS117 76946 44398901
GSS118 76344 51687453
GSS119 93679 48181364
GSS12 72880 38305303
GSS120 88384 55463721
GSS121 85618 53768456
GSS122 86887 56783336
GSS123 76853 62194367
GSS124 76873 69212982
GSS125 79465 61496051
GSS126 78686 54693322
GSS127 78770 54536769
GSS128 79102 54070342
GSS129 78848 54450556
GSS13 76710 38972691
GSS130 79272 53915379
GSS131 83964 60027747
GSS132 81331 58356139
GSS133 67222 56663599
GSS134 71929 55407710
GSS135 76732 68691552
GSS136 76363 62788206
GSS137 78594 52956954
GSS138 86723 53773881
GSS139 94729 58025635
GSS14 71318 32129972
GSS140 92900 59947486
GSS141 84724 56063906
GSS142 82277 55402359
GSS143 87434 56395683
GSS144 115672 59408436
GSS145 103842 60625908
GSS146 79621 54862740
GSS147 49279 31571796
GSS148 71584 53908366
GSS149 72983 55917766
GSS15 70061 34758779
GSS150 72991 55904074
GSS151 73015 55861954
GSS152 72988 55908945
GSS153 72973 55934847
GSS154 77040 55788195
GSS155 54342 43187133
GSS156 86835 64398688
GSS157 83575 62753093
GSS158 103107 48160258
GSS159 68551 58490104
GSS16 78470 46274403
GSS160 68306 58779705
GSS161 69368 56627986
GSS162 69629 56121941
GSS163 70373 55413136
GSS164 85863 73126419
GSS165 85421 40036063
GSS166 82919 55620584
GSS167 69563 60363864
GSS168 85051 42664873
GSS169 79374 50931676
GSS17 70905 33300780
GSS170 108512 70911997
GSS171 89810 38778615
GSS172 72386 59414597
GSS173 70248 59129439
GSS174 79815 67396647
GSS175 120678 73151233
GSS176 117807 76106669
GSS177 104497 57808694
GSS178 85722 54908755
GSS179 93822 57461326
GSS18 59071 27947019
GSS180 107362 78632237
GSS181 108191 77694546
GSS182 106123 79969074
GSS183 105451 80687848
GSS184 80100 54559670
GSS185 104382 64283805
GSS186 109833 66602549
GSS187 86234 46737882
GSS188 98472 50473481
GSS189 81567 58699642
GSS19 56793 29073119
GSS190 82625 40958289
GSS2 88926 39303697
GSS20 57668 26712147
GSS21 61488 29058582
GSS22 64939 38228021
GSS23 57529 27081913
GSS24 66169 42024225
GSS25 68210 28289508
GSS26 58176 25355944
GSS27 65304 31935395
GSS28 65526 32575556
GSS29 77227 39670266
GSS3 87398 41802021
GSS30 82957 39749876
GSS31 74190 40412475
GSS32 70591 48301027
GSS33 79804 37824579
GSS34 75888 40321464
GSS35 74120 40021207
GSS36 87372 56192392
GSS37 87597 58173547
GSS38 85525 44940845
GSS39 86833 50465832
GSS4 78874 41011062
GSS40 86246 39997839
GSS41 83166 31867100
GSS42 81247 56932382
GSS43 80146 58103023
GSS44 72028 47496494
GSS45 72035 47431583
GSS46 77672 45763300
GSS47 77855 38693451
GSS48 83229 58014799
GSS49 86574 64699915
GSS5 78796 40546530
GSS50 81591 54456853
GSS51 93866 59263956
GSS52 88547 58817109
GSS53 76626 42252532
GSS54 72830 40516913
GSS55 86501 47034791
GSS56 88085 58497671
GSS57 77066 64867618
GSS58 71985 79294476
GSS59 86858 69257687
GSS6 78151 38870383
GSS60 88580 59257198
GSS61 63418 45075754
GSS62 67023 45959994
GSS63 89648 67278486
GSS64 84980 57972006
GSS65 86074 53093430
GSS66 86454 56259664
GSS67 95422 58307228
GSS68 100728 54382421
GSS69 100599 54544444
GSS7 77732 39126523
GSS70 101401 53529912
GSS71 102483 52156766
GSS72 102416 52241294
GSS73 102572 52042841
GSS74 102154 52572610
GSS75 99640 55772373
GSS76 90052 69070137
GSS77 89844 70766123
GSS78 88291 69753061
GSS79 87837 69660017
GSS8 75722 38102298
GSS80 88013 61735937
GSS81 82946 31218248
GSS82 77834 24404740
GSS83 84686 33001992
GSS84 82013 50082046
GSS85 80185 45208811
GSS86 88069 61218473
GSS87 80655 59811160
GSS88 77048 79086452
GSS89 77427 62278599
GSS9 72105 37148208
GSS90 89858 48288964
GSS91 79258 45084455
GSS92 79799 45257540
GSS93 73408 62688513
GSS94 83731 51934101
GSS95 80855 57046188
GSS96 85700 56695065
GSS97 83784 57931532
GSS98 89146 52414223
GSS99 83343 72418448
HTC1 25058 27045991
HTC10 67519 60482631
HTC11 66393 82571539
HTC12 20234 33218907
HTC2 15992 36039041
HTC3 15968 36541538
HTC4 16191 35386951
HTC5 15926 40285999
HTC6 16011 37282387
HTC7 51341 28447219
HTC8 60033 71001865
HTC9 81349 67924969
HTG1 1315 189001996
HTG10 1296 186583592
HTG11 1434 184163155
HTG12 874 191880397
HTG13 750 192467812
HTG14 744 192320348
HTG15 781 192186943
HTG16 803 192068012
HTG17 767 192415658
HTG18 2060 171096726
HTG19 1061 187949006
HTG2 2580 186063570
HTG20 979 189628661
HTG21 784 192061515
HTG22 924 190389755
HTG23 902 190887456
HTG24 810 191772904
HTG25 778 192146608
HTG26 865 191543634
HTG27 883 190976752
HTG28 950 189903682
HTG29 896 191124860
HTG3 2462 185369026
HTG30 928 190435594
HTG31 871 191340183
HTG32 968 189649894
HTG33 878 191121372
HTG34 858 191551797
HTG35 825 192011331
HTG36 936 190168969
HTG37 938 190703575
HTG38 937 190457285
HTG39 1036 189517024
HTG4 2498 188464247
HTG40 1187 187204693
HTG41 1250 188125260
HTG42 1190 188168753
HTG43 1164 187279535
HTG44 1102 191553006
HTG45 1216 190999235
HTG46 1243 191024287
HTG47 1132 191205992
HTG48 1069 191116327
HTG49 920 189760850
HTG5 1282 185728071
HTG50 1064 189628733
HTG51 919 189663861
HTG52 1024 189723550
HTG53 939 189487714
HTG54 1005 189431176
HTG55 931 189259370
HTG56 960 189014477
HTG57 1109 188665452
HTG58 975 189561375
HTG59 1092 185910810
HTG6 1271 185296555
HTG60 1093 188766778
HTG61 1004 189206773
HTG62 1016 189037390
HTG63 975 189044499
HTG64 1129 188756428
HTG65 1075 188676952
HTG66 1287 184292614
HTG67 1247 185621436
HTG68 1238 184549105
HTG69 1262 184559335
HTG7 1274 185516840
HTG70 1215 185850289
HTG71 1425 188299234
HTG72 1277 187705130
HTG73 1104 191768758
HTG74 1139 191980077
HTG75 1200 192371762
HTG76 1147 191541560
HTG77 1186 190884770
HTG78 1185 191345513
HTG79 1134 188966417
HTG8 1420 184780750
HTG80 1528 188645196
HTG81 1020 193673613
HTG82 1023 194886027
HTG83 836 175734348
HTG84 1110 193410405
HTG85 1166 191839468
HTG86 776 116810371
HTG9 1192 187322429
INV1 19865 157405044
INV2 1583 169503795
INV3 25076 126143154
INV4 76837 79147376
INV5 71787 74016259
INV6 80468 71734198
INV7 33144 116056952
INV8 77177 72537533
INV9 13545 48677515
MAM1 39126 132574937
MAM2 61475 92114410
MAM3 8522 9429843
PAT1 222661 70153368
PAT10 124531 99864894
PAT11 142427 61876405
PAT12 105533 59652976
PAT13 103508 49937213
PAT14 121259 53445610
PAT15 113306 61346719
PAT16 144954 54962600
PAT17 154995 70392623
PAT18 97251 122793686
PAT19 148128 86890252
PAT2 194463 84678606
PAT20 117384 104343385
PAT21 124087 103351380
PAT22 111295 103033339
PAT23 107101 71122042
PAT24 93806 81177089
PAT25 117860 66183397
PAT26 94506 28961462
PAT3 172005 95888203
PAT4 153751 106059983
PAT5 184026 85614248
PAT6 156618 92818836
PAT7 151949 82079403
PAT8 104393 119606064
PAT9 143561 89243336
PHG 3173 21103754
PLN1 43487 111546412
PLN10 5 168115057
PLN11 1727 164132320
PLN12 39088 90345979
PLN13 74910 76167173
PLN14 77003 78261577
PLN15 56807 98883686
PLN16 31518 116664005
PLN17 76248 79221455
PLN18 46997 109266912
PLN19 27976 67881727
PLN2 1340 168360577
PLN3 1678 172614760
PLN4 46299 107712140
PLN5 76536 78183519
PLN6 43355 55538708
PLN7 33652 83422888
PLN8 1259 165596392
PLN9 1200 190655777
PRI1 23715 138129745
PRI10 1452 181742040
PRI11 1303 179093039
PRI12 1529 177985451
PRI13 1585 179766106
PRI14 1512 185615962
PRI15 1241 192326221
PRI16 14121 170258770
PRI17 44296 108539569
PRI18 26919 108422577
PRI19 1636 182829772
PRI2 1496 172739639
PRI20 1690 183837273
PRI21 1922 182945187
PRI22 9548 164104866
PRI23 1579 179136487
PRI24 57039 88691985
PRI25 36071 71739647
PRI26 14602 142426604
PRI27 15439 160934717
PRI28 59184 111852246
PRI29 47320 123383323
PRI3 1285 186590900
PRI30 32930 135354569
PRI31 38435 62583117
PRI4 1314 183799052
PRI5 1190 181557102
PRI6 1218 179102991
PRI7 1230 180618392
PRI8 1360 174548325
PRI9 1224 177472594
ROD1 10588 167258613
ROD10 976 182286010
ROD11 1029 186525579
ROD12 960 183512017
ROD13 1023 187396135
ROD14 954 181058996
ROD15 962 182350093
ROD16 1039 186106941
ROD17 27543 145010454
ROD18 1703 188062557
ROD19 1199 193205495
ROD2 926 174247142
ROD20 1343 193665543
ROD21 42145 87128295
ROD22 19844 116739145
ROD23 34147 155779798
ROD24 134296 33355549
ROD25 25053 31098003
ROD3 905 174005978
ROD4 904 174191111
ROD5 926 174030188
ROD6 985 181080878
ROD7 971 179834321
ROD8 987 181775603
ROD9 1009 182892582
STS1 82258 35125399
STS10 58006 44374969
STS11 57857 43544736
STS12 73132 38701728
STS13 85483 37913253
STS14 20495 7925600
STS2 84249 45121168
STS3 75765 30338803
STS4 67541 34215925
STS5 54864 31990595
STS6 54734 32212264
STS7 54691 32191253
STS8 56253 38509115
STS9 57907 44422832
SYN 38867 51890227
UNA 211 114018
VRL1 72113 65849875
VRL2 71295 65632738
VRL3 68533 70185055
VRL4 62871 70888975
VRL5 65025 72741885
VRL6 56551 51866320
VRT1 17277 167060418
VRT10 11415 175619651
VRT11 48240 119902625
VRT12 28788 26540375
VRT2 62443 95830875
VRT3 27360 150719304
VRT4 76453 67699083
VRT5 27939 89254291
VRT6 1203 192830282
VRT7 1282 192518809
VRT8 5886 184751476
VRT9 13706 173796592
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 156.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
10660543 12409524777 Homo sapiens
6755370 8061500977 Mus musculus
1268019 5748039298 Rattus norvegicus
1664937 3568441092 Bos taurus
1331387 2589801329 Danio rerio
2774495 2239003294 Zea mays
1153407 1506785825 Oryza sativa (japonica cultivar-group)
226215 1251964415 Strongylocentrotus purpuratus
1247597 1131771085 Sus scrofa
1176472 962963380 Xenopus tropicalis
1427155 903612372 Canis familiaris
673763 860742285 Drosophila melanogaster
800823 789715161 Gallus gallus
1198679 758760957 Arabidopsis thaliana
209647 751673767 Pan troglodytes
868266 508060088 Triticum aestivum
70054 497873590 Macaca mulatta
801652 476969297 Sorghum bicolor
397483 472974068 Medicago truncatula
696368 421393665 Ciona intestinalis
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, CON-division sequence files, and the
lists of new, changed, and deleted accession numbers, each of the files of a
GenBank release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 October 2006
NCBI-GenBank Flat File Release 156.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
bits-request@ncbi.nlm.nih.gov
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to
indicate the GenBank release number (e.g., Release 156.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Irene Fang, Linda Frisse, Michael Fetchko, Andrea Gocke, Amelie Gubitz
Anjanette Johnston, Kellie Kelm, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, WonHee Jang,
Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
