Release Notes For GenBank Release 158

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2007

               NCBI-GenBank Flat File Release 158.0

                    Distribution Release Notes

 67218344 loci, 71292211453 bases, from 67218344 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 158.0
1.2 Cutoff Date
1.3 Important Changes in Release 158.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 158.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 158.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.

1.2 Cutoff Date

  This full release, 158.0, incorporates data available to the collaborating
databases as of February 8, 2007 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 158.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 35 with this release:

  - the BCT division is now comprised of  20 files (+2)
  - the CON division is now comprised of   4 files (+1)
  - the EST division is now comprised of 589 files (+19)
  - the GSS division is now comprised of 202 files (+5)
  - the HTG division is now comprised of  90 files (+2)
  - the PAT division is now comprised of  28 files (+1)
  - the PLN division is now comprised of  24 files (+4)
  - the VRT division is now comprised of  13 files (+1)

  The total number of index files increased by 8 with this release:

  - the ACC index is now comprised of  3 files (+2)
  - the AUT index is now comprised of 20 files (+4)
  - the JOU index is now comprised of  2 files (+1)
  - the KEY index is now comprised of  2 files (+1)

  These increases reflect changes in the way index files are being
  split into multiple files of more manageable sizes. Some flux in
  the sizes/numbers of index files can be expected over the next
  few releases.

1.3.2 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI. GenBank 158.0 thus contains these index
files, which lack all EST and most GSS content:

	gbaut1.idx - gbaut20.idx (20 files)
	gbgen.idx
	gbjou1.idx - gbjou2.idx  (2 files)
	gbkey1.idx - gbkey2.idx  (2 files)
	gbsec.idx

  The three gbacc*.idx index files continues to reflect the entirety of the release,
including all EST and GSS records, however the file contents are unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank files, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
forty-one of the GSS flatfiles in Release 158.0. Consider gbgss162.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                          February 15 2007

                NCBI-GenBank Flat File Release 158.0

                           GSS Sequences (Part 1)

   86834 loci,    64352152 bases, from    86834 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "162" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 Multiple identifiers for the PROJECT line

  The recently-introduced PROJECT linetype (see Section 3.4.7.2) provides a
way to link GenBank sequences that are part of a sequencing project to the
Entrez Genome Project database, where further details about the project can
be found.

  As of June 2007, multiple identifiers will be valid for the PROJECT line.
Here is a mocked-up example of the expected usage:

LOCUS       AANA01000001               2 rc    DNA     linear   BCT 09-FEB-2007
DEFINITION  Polaribacter dokdonensis MED152 whole genome shotgun sequencing
            project.
ACCESSION   AANA01000001
VERSION     AANA01000001.1  GI:85822094
PROJECT     GenomeProject:13543  GenomeProject:99999

  There are several situations in which a record could be considered part
of two different Genome Projects. For example, consider an
environmental-sampling metagenomic WGS project for which the individual
sequence-overlap contigs are not attributed to a specific organism. A
Genome Project could exist that provides further details about the
sequencing effort, the centers involved, etc.

  If, in subsequent assembly and annotation phases, scaffold/super-contig/
chromosomal records are created which **are** attributed to a specific
organism, then those CON-division records could have two Genome Project IDs:
one for the WGS sequencing project as a whole; and a second for organism-
specific Genome Projects.

  Additional examples illustrating the use of multiple Genome Project IDs 
will be provided in future release notes, and via the GenBank listserv.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1115 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut3.idx - Index of the entries according to author name, part 3.
18. gbaut4.idx - Index of the entries according to author name, part 4.
19. gbaut5.idx - Index of the entries according to author name, part 5.
20. gbaut6.idx - Index of the entries according to author name, part 6.
21. gbaut7.idx - Index of the entries according to author name, part 7.
22. gbaut8.idx - Index of the entries according to author name, part 8.
23. gbaut9.idx - Index of the entries according to author name, part 9.
24. gbbct1.seq - Bacterial sequence entries, part 1.
25. gbbct10.seq - Bacterial sequence entries, part 10.
26. gbbct11.seq - Bacterial sequence entries, part 11.
27. gbbct12.seq - Bacterial sequence entries, part 12.
28. gbbct13.seq - Bacterial sequence entries, part 13.
29. gbbct14.seq - Bacterial sequence entries, part 14.
30. gbbct15.seq - Bacterial sequence entries, part 15.
31. gbbct16.seq - Bacterial sequence entries, part 16.
32. gbbct17.seq - Bacterial sequence entries, part 17.
33. gbbct18.seq - Bacterial sequence entries, part 18.
34. gbbct19.seq - Bacterial sequence entries, part 19.
35. gbbct2.seq - Bacterial sequence entries, part 2.
36. gbbct20.seq - Bacterial sequence entries, part 20.
37. gbbct3.seq - Bacterial sequence entries, part 3.
38. gbbct4.seq - Bacterial sequence entries, part 4.
39. gbbct5.seq - Bacterial sequence entries, part 5.
40. gbbct6.seq - Bacterial sequence entries, part 6.
41. gbbct7.seq - Bacterial sequence entries, part 7.
42. gbbct8.seq - Bacterial sequence entries, part 8.
43. gbbct9.seq - Bacterial sequence entries, part 9.
44. gbchg.txt - Accession numbers of entries updated since the previous release.
45. gbcon1.seq - Constructed sequence entries, part 1.
46. gbcon2.seq - Constructed sequence entries, part 2.
47. gbcon3.seq - Constructed sequence entries, part 3.
48. gbcon4.seq - Constructed sequence entries, part 4.
49. gbdel.txt - Accession numbers of entries deleted since the previous release.
50. gbenv1.seq - Environmental sampling sequence entries, part 1.
51. gbenv2.seq - Environmental sampling sequence entries, part 2.
52. gbenv3.seq - Environmental sampling sequence entries, part 3.
53. gbenv4.seq - Environmental sampling sequence entries, part 4.
54. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
55. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
56. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
57. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
58. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
59. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
60. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
61. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
62. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
63. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
64. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
65. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
66. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
67. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
68. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
69. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
70. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
71. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
72. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
73. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
74. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
75. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
76. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
77. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
78. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
79. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
80. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
81. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
82. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
83. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
84. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
85. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
86. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
87. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
88. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
89. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
90. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
91. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
92. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
93. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
94. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
95. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
96. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
97. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
98. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
99. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
100. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
101. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
102. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
103. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
104. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
105. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
106. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
107. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
108. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
109. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
110. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
111. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
112. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
113. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
114. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
115. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
116. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
117. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
118. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
119. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
120. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
121. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
122. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
123. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
124. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
125. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
126. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
127. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
128. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
129. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
130. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
131. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
132. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
133. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
134. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
135. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
136. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
137. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
138. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
139. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
140. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
141. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
142. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
143. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
144. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
145. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
146. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
147. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
148. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
149. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
150. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
151. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
152. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
153. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
154. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
155. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
156. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
157. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
158. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
159. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
160. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
161. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
162. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
163. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
164. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
165. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
166. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
167. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
168. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
169. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
170. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
171. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
172. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
173. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
174. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
175. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
176. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
177. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
178. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
179. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
180. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
181. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
182. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
183. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
184. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
185. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
186. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
187. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
188. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
189. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
190. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
191. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
192. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
193. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
194. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
195. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
196. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
197. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
198. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
199. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
200. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
201. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
202. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
203. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
204. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
205. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
206. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
207. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
208. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
209. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
210. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
211. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
212. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
213. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
214. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
215. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
216. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
217. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
218. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
219. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
220. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
221. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
222. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
223. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
224. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
225. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
226. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
227. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
228. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
229. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
230. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
231. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
232. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
233. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
234. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
235. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
236. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
237. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
238. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
239. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
240. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
241. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
242. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
243. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
244. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
245. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
246. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
247. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
248. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
249. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
250. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
251. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
252. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
253. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
254. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
255. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
256. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
257. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
258. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
259. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
260. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
261. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
262. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
263. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
264. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
265. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
266. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
267. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
268. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
269. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
270. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
271. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
272. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
273. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
274. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
275. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
276. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
277. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
278. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
279. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
280. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
281. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
282. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
283. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
284. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
285. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
286. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
287. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
288. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
289. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
290. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
291. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
292. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
293. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
294. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
295. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
296. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
297. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
298. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
299. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
300. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
301. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
302. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
303. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
304. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
305. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
306. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
307. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
308. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
309. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
310. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
311. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
312. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
313. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
314. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
315. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
316. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
317. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
318. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
319. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
320. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
321. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
322. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
323. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
324. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
325. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
326. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
327. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
328. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
329. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
330. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
331. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
332. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
333. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
334. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
335. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
336. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
337. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
338. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
339. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
340. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
341. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
342. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
343. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
344. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
345. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
346. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
347. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
348. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
349. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
350. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
351. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
352. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
353. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
354. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
355. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
356. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
357. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
358. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
359. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
360. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
361. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
362. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
363. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
364. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
365. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
366. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
367. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
368. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
369. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
370. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
371. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
372. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
373. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
374. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
375. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
376. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
377. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
378. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
379. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
380. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
381. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
382. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
383. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
384. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
385. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
386. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
387. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
388. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
389. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
390. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
391. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
392. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
393. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
394. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
395. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
396. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
397. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
398. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
399. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
400. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
401. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
402. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
403. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
404. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
405. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
406. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
407. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
408. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
409. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
410. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
411. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
412. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
413. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
414. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
415. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
416. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
417. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
418. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
419. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
420. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
421. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
422. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
423. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
424. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
425. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
426. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
427. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
428. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
429. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
430. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
431. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
432. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
433. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
434. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
435. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
436. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
437. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
438. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
439. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
440. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
441. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
442. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
443. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
444. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
445. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
446. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
447. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
448. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
449. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
450. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
451. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
452. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
453. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
454. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
455. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
456. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
457. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
458. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
459. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
460. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
461. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
462. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
463. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
464. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
465. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
466. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
467. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
468. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
469. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
470. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
471. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
472. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
473. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
474. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
475. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
476. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
477. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
478. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
479. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
480. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
481. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
482. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
483. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
484. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
485. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
486. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
487. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
488. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
489. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
490. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
491. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
492. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
493. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
494. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
495. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
496. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
497. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
498. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
499. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
500. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
501. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
502. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
503. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
504. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
505. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
506. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
507. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
508. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
509. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
510. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
511. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
512. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
513. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
514. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
515. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
516. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
517. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
518. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
519. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
520. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
521. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
522. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
523. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
524. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
525. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
526. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
527. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
528. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
529. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
530. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
531. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
532. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
533. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
534. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
535. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
536. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
537. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
538. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
539. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
540. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
541. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
542. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
543. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
544. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
545. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
546. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
547. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
548. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
549. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
550. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
551. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
552. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
553. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
554. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
555. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
556. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
557. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
558. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
559. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
560. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
561. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
562. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
563. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
564. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
565. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
566. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
567. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
568. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
569. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
570. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
571. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
572. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
573. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
574. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
575. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
576. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
577. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
578. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
579. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
580. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
581. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
582. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
583. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
584. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
585. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
586. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
587. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
588. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
589. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
590. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
591. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
592. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
593. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
594. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
595. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
596. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
597. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
598. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
599. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
600. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
601. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
602. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
603. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
604. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
605. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
606. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
607. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
608. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
609. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
610. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
611. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
612. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
613. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
614. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
615. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
616. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
617. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
618. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
619. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
620. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
621. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
622. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
623. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
624. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
625. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
626. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
627. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
628. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
629. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
630. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
631. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
632. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
633. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
634. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
635. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
636. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
637. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
638. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
639. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
640. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
641. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
642. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
643. gbgen.idx - Index of the entries according to gene symbols.
644. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
645. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
646. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
647. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
648. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
649. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
650. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
651. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
652. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
653. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
654. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
655. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
656. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
657. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
658. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
659. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
660. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
661. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
662. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
663. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
664. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
665. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
666. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
667. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
668. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
669. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
670. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
671. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
672. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
673. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
674. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
675. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
676. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
677. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
678. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
679. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
680. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
681. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
682. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
683. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
684. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
685. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
686. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
687. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
688. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
689. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
690. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
691. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
692. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
693. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
694. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
695. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
696. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
697. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
698. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
699. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
700. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
701. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
702. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
703. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
704. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
705. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
706. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
707. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
708. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
709. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
710. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
711. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
712. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
713. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
714. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
715. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
716. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
717. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
718. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
719. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
720. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
721. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
722. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
723. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
724. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
725. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
726. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
727. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
728. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
729. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
730. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
731. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
732. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
733. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
734. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
735. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
736. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
737. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
738. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
739. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
740. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
741. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
742. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
743. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
744. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
745. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
746. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
747. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
748. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
749. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
750. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
751. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
752. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
753. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
754. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
755. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
756. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
757. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
758. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
759. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
760. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
761. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
762. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
763. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
764. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
765. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
766. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
767. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
768. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
769. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
770. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
771. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
772. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
773. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
774. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
775. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
776. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
777. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
778. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
779. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
780. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
781. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
782. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
783. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
784. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
785. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
786. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
787. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
788. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
789. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
790. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
791. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
792. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
793. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
794. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
795. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
796. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
797. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
798. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
799. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
800. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
801. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
802. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
803. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
804. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
805. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
806. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
807. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
808. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
809. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
810. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
811. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
812. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
813. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
814. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
815. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
816. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
817. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
818. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
819. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
820. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
821. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
822. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
823. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
824. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
825. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
826. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
827. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
828. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
829. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
830. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
831. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
832. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
833. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
834. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
835. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
836. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
837. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
838. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
839. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
840. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
841. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
842. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
843. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
844. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
845. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
846. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
847. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
848. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
849. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
850. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
851. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
852. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
853. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
854. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
855. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
856. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
857. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
858. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
859. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
860. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
861. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
862. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
863. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
864. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
865. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
866. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
867. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
868. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
869. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
870. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
871. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
872. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
873. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
874. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
875. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
876. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
877. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
878. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
879. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
880. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
881. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
882. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
883. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
884. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
885. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
886. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
887. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
888. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
889. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
890. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
891. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
892. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
893. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
894. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
895. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
896. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
897. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
898. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
899. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
900. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
901. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
902. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
903. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
904. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
905. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
906. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
907. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
908. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
909. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
910. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
911. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
912. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
913. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
914. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
915. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
916. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
917. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
918. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
919. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
920. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
921. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
922. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
923. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
924. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
925. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
926. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
927. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
928. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
929. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
930. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
931. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
932. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
933. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
934. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
935. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
936. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
937. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
938. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
939. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
940. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
941. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
942. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
943. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
944. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
945. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
946. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
947. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
948. gbinv1.seq - Invertebrate sequence entries, part 1.
949. gbinv2.seq - Invertebrate sequence entries, part 2.
950. gbinv3.seq - Invertebrate sequence entries, part 3.
951. gbinv4.seq - Invertebrate sequence entries, part 4.
952. gbinv5.seq - Invertebrate sequence entries, part 5.
953. gbinv6.seq - Invertebrate sequence entries, part 6.
954. gbinv7.seq - Invertebrate sequence entries, part 7.
955. gbinv8.seq - Invertebrate sequence entries, part 8.
956. gbinv9.seq - Invertebrate sequence entries, part 9.
957. gbjou1.idx - Index of the entries according to journal citation, part 1.
958. gbjou2.idx - Index of the entries according to journal citation, part 2.
959. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
960. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
961. gbmam1.seq - Other mammalian sequence entries, part 1.
962. gbmam2.seq - Other mammalian sequence entries, part 2.
963. gbmam3.seq - Other mammalian sequence entries, part 3.
964. gbnew.txt - Accession numbers of entries new since the previous release.
965. gbpat1.seq - Patent sequence entries, part 1.
966. gbpat10.seq - Patent sequence entries, part 10.
967. gbpat11.seq - Patent sequence entries, part 11.
968. gbpat12.seq - Patent sequence entries, part 12.
969. gbpat13.seq - Patent sequence entries, part 13.
970. gbpat14.seq - Patent sequence entries, part 14.
971. gbpat15.seq - Patent sequence entries, part 15.
972. gbpat16.seq - Patent sequence entries, part 16.
973. gbpat17.seq - Patent sequence entries, part 17.
974. gbpat18.seq - Patent sequence entries, part 18.
975. gbpat19.seq - Patent sequence entries, part 19.
976. gbpat2.seq - Patent sequence entries, part 2.
977. gbpat20.seq - Patent sequence entries, part 20.
978. gbpat21.seq - Patent sequence entries, part 21.
979. gbpat22.seq - Patent sequence entries, part 22.
980. gbpat23.seq - Patent sequence entries, part 23.
981. gbpat24.seq - Patent sequence entries, part 24.
982. gbpat25.seq - Patent sequence entries, part 25.
983. gbpat26.seq - Patent sequence entries, part 26.
984. gbpat27.seq - Patent sequence entries, part 27.
985. gbpat28.seq - Patent sequence entries, part 28.
986. gbpat3.seq - Patent sequence entries, part 3.
987. gbpat4.seq - Patent sequence entries, part 4.
988. gbpat5.seq - Patent sequence entries, part 5.
989. gbpat6.seq - Patent sequence entries, part 6.
990. gbpat7.seq - Patent sequence entries, part 7.
991. gbpat8.seq - Patent sequence entries, part 8.
992. gbpat9.seq - Patent sequence entries, part 9.
993. gbphg.seq - Phage sequence entries.
994. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
995. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
996. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
997. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
998. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
999. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1000. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1001. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1002. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1003. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1004. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1005. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1006. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1007. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1008. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1009. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1010. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1011. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1012. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1013. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1014. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1015. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1016. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1017. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1018. gbpri1.seq - Primate sequence entries, part 1.
1019. gbpri10.seq - Primate sequence entries, part 10.
1020. gbpri11.seq - Primate sequence entries, part 11.
1021. gbpri12.seq - Primate sequence entries, part 12.
1022. gbpri13.seq - Primate sequence entries, part 13.
1023. gbpri14.seq - Primate sequence entries, part 14.
1024. gbpri15.seq - Primate sequence entries, part 15.
1025. gbpri16.seq - Primate sequence entries, part 16.
1026. gbpri17.seq - Primate sequence entries, part 17.
1027. gbpri18.seq - Primate sequence entries, part 18.
1028. gbpri19.seq - Primate sequence entries, part 19.
1029. gbpri2.seq - Primate sequence entries, part 2.
1030. gbpri20.seq - Primate sequence entries, part 20.
1031. gbpri21.seq - Primate sequence entries, part 21.
1032. gbpri22.seq - Primate sequence entries, part 22.
1033. gbpri23.seq - Primate sequence entries, part 23.
1034. gbpri24.seq - Primate sequence entries, part 24.
1035. gbpri25.seq - Primate sequence entries, part 25.
1036. gbpri26.seq - Primate sequence entries, part 26.
1037. gbpri27.seq - Primate sequence entries, part 27.
1038. gbpri28.seq - Primate sequence entries, part 28.
1039. gbpri29.seq - Primate sequence entries, part 29.
1040. gbpri3.seq - Primate sequence entries, part 3.
1041. gbpri30.seq - Primate sequence entries, part 30.
1042. gbpri31.seq - Primate sequence entries, part 31.
1043. gbpri32.seq - Primate sequence entries, part 32.
1044. gbpri4.seq - Primate sequence entries, part 4.
1045. gbpri5.seq - Primate sequence entries, part 5.
1046. gbpri6.seq - Primate sequence entries, part 6.
1047. gbpri7.seq - Primate sequence entries, part 7.
1048. gbpri8.seq - Primate sequence entries, part 8.
1049. gbpri9.seq - Primate sequence entries, part 9.
1050. gbrel.txt - Release notes (this document).
1051. gbrod1.seq - Rodent sequence entries, part 1.
1052. gbrod10.seq - Rodent sequence entries, part 10.
1053. gbrod11.seq - Rodent sequence entries, part 11.
1054. gbrod12.seq - Rodent sequence entries, part 12.
1055. gbrod13.seq - Rodent sequence entries, part 13.
1056. gbrod14.seq - Rodent sequence entries, part 14.
1057. gbrod15.seq - Rodent sequence entries, part 15.
1058. gbrod16.seq - Rodent sequence entries, part 16.
1059. gbrod17.seq - Rodent sequence entries, part 17.
1060. gbrod18.seq - Rodent sequence entries, part 18.
1061. gbrod19.seq - Rodent sequence entries, part 19.
1062. gbrod2.seq - Rodent sequence entries, part 2.
1063. gbrod20.seq - Rodent sequence entries, part 20.
1064. gbrod21.seq - Rodent sequence entries, part 21.
1065. gbrod22.seq - Rodent sequence entries, part 22.
1066. gbrod23.seq - Rodent sequence entries, part 23.
1067. gbrod24.seq - Rodent sequence entries, part 24.
1068. gbrod25.seq - Rodent sequence entries, part 25.
1069. gbrod3.seq - Rodent sequence entries, part 3.
1070. gbrod4.seq - Rodent sequence entries, part 4.
1071. gbrod5.seq - Rodent sequence entries, part 5.
1072. gbrod6.seq - Rodent sequence entries, part 6.
1073. gbrod7.seq - Rodent sequence entries, part 7.
1074. gbrod8.seq - Rodent sequence entries, part 8.
1075. gbrod9.seq - Rodent sequence entries, part 9.
1076. gbsdr1.txt - Short directory of the data bank, part 1.
1077. gbsdr2.txt - Short directory of the data bank, part 2.
1078. gbsdr3.txt - Short directory of the data bank, part 3.
1079. gbsec.idx - Index of the entries according to secondary accession number.
1080. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1081. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1082. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1083. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1084. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1085. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1086. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1087. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1088. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1089. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1090. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1091. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1092. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1093. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1094. gbsyn.seq - Synthetic and chimeric sequence entries.
1095. gbuna.seq - Unannotated sequence entries.
1096. gbvrl1.seq - Viral sequence entries, part 1.
1097. gbvrl2.seq - Viral sequence entries, part 2.
1098. gbvrl3.seq - Viral sequence entries, part 3.
1099. gbvrl4.seq - Viral sequence entries, part 4.
1100. gbvrl5.seq - Viral sequence entries, part 5.
1101. gbvrl6.seq - Viral sequence entries, part 6.
1102. gbvrl7.seq - Viral sequence entries, part 7.
1103. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1104. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1105. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1106. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1107. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1108. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1109. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1110. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1111. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1112. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1113. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1114. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1115. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 158.0 flatfiles require roughly 251 GB (sequence
files only) or 263 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 408401010     gbacc1.idx
1374104235     gbacc2.idx
 427837944     gbacc3.idx
 183912854     gbaut1.idx
 183866144     gbaut10.idx
 183752652     gbaut11.idx
 183765653     gbaut12.idx
 183832651     gbaut13.idx
 183932599     gbaut14.idx
 183916205     gbaut15.idx
 183828041     gbaut16.idx
 183824953     gbaut17.idx
 183920952     gbaut18.idx
 183636590     gbaut19.idx
 183812538     gbaut2.idx
 164220975     gbaut20.idx
 183712551     gbaut3.idx
 183786882     gbaut4.idx
 183891981     gbaut5.idx
 183875085     gbaut6.idx
 183769619     gbaut7.idx
 183846579     gbaut8.idx
 183858532     gbaut9.idx
 257421335     gbbct1.seq
 250191834     gbbct10.seq
 250033238     gbbct11.seq
 255365487     gbbct12.seq
 251901481     gbbct13.seq
 258012214     gbbct14.seq
 254439511     gbbct15.seq
 251163040     gbbct16.seq
 252136078     gbbct17.seq
 250049803     gbbct18.seq
 250000301     gbbct19.seq
 250024572     gbbct2.seq
  25140438     gbbct20.seq
 250907046     gbbct3.seq
 250000325     gbbct4.seq
 254041327     gbbct5.seq
 250001302     gbbct6.seq
 250002880     gbbct7.seq
 250945836     gbbct8.seq
 250664389     gbbct9.seq
   6624473     gbchg.txt
 155802466     gbcon1.seq
 645705157     gbcon2.seq
1311004797     gbcon3.seq
1182643479     gbcon4.seq
     10332     gbdel.txt
 250000046     gbenv1.seq
 250002223     gbenv2.seq
 250001608     gbenv3.seq
 222311831     gbenv4.seq
 230690796     gbest1.seq
 230689658     gbest10.seq
 230687763     gbest100.seq
 230691234     gbest101.seq
 230690282     gbest102.seq
 230688468     gbest103.seq
 230689870     gbest104.seq
 230689609     gbest105.seq
 230688387     gbest106.seq
 230689166     gbest107.seq
 230688421     gbest108.seq
 230690461     gbest109.seq
 230689625     gbest11.seq
 230688051     gbest110.seq
 230689441     gbest111.seq
 230690026     gbest112.seq
 230688711     gbest113.seq
 230688908     gbest114.seq
 230690648     gbest115.seq
 230690229     gbest116.seq
 230689944     gbest117.seq
 230687619     gbest118.seq
 230688151     gbest119.seq
 230689666     gbest12.seq
 230690314     gbest120.seq
 230690150     gbest121.seq
 230688173     gbest122.seq
 230689346     gbest123.seq
 230688391     gbest124.seq
 230690265     gbest125.seq
 230689918     gbest126.seq
 230688599     gbest127.seq
 230687842     gbest128.seq
 230688472     gbest129.seq
 230688387     gbest13.seq
 230689665     gbest130.seq
 230688759     gbest131.seq
 230690486     gbest132.seq
 230691630     gbest133.seq
 230688563     gbest134.seq
 230689424     gbest135.seq
 230687827     gbest136.seq
 230689066     gbest137.seq
 230689821     gbest138.seq
 230687792     gbest139.seq
 230688451     gbest14.seq
 230691697     gbest140.seq
 230688192     gbest141.seq
 230687711     gbest142.seq
 230689315     gbest143.seq
 230689161     gbest144.seq
 230690116     gbest145.seq
 230687581     gbest146.seq
 230688814     gbest147.seq
 230688917     gbest148.seq
 230689508     gbest149.seq
 230687633     gbest15.seq
 230688599     gbest150.seq
 230689521     gbest151.seq
 230688717     gbest152.seq
 230688966     gbest153.seq
 230690452     gbest154.seq
 230690435     gbest155.seq
 230690606     gbest156.seq
 230690442     gbest157.seq
 230689894     gbest158.seq
 230689884     gbest159.seq
 230689430     gbest16.seq
 230693570     gbest160.seq
 230690509     gbest161.seq
 230690227     gbest162.seq
 230688318     gbest163.seq
 230687904     gbest164.seq
 230688879     gbest165.seq
 230687774     gbest166.seq
 230690067     gbest167.seq
 230690902     gbest168.seq
 230690046     gbest169.seq
 230689624     gbest17.seq
 230688622     gbest170.seq
 230688929     gbest171.seq
 230689434     gbest172.seq
 230688460     gbest173.seq
 230688702     gbest174.seq
 230687740     gbest175.seq
 223066345     gbest176.seq
 230689112     gbest177.seq
 230688305     gbest178.seq
 230687533     gbest179.seq
 230689148     gbest18.seq
 230689791     gbest180.seq
 230688854     gbest181.seq
 230689127     gbest182.seq
 230688307     gbest183.seq
 230688760     gbest184.seq
 230687561     gbest185.seq
 230688765     gbest186.seq
 230691369     gbest187.seq
 230689069     gbest188.seq
 230687799     gbest189.seq
 230688609     gbest19.seq
 230688655     gbest190.seq
 230688967     gbest191.seq
 230688846     gbest192.seq
 230689441     gbest193.seq
 230688574     gbest194.seq
 230688386     gbest195.seq
 230689939     gbest196.seq
 230689176     gbest197.seq
 230689396     gbest198.seq
 230688841     gbest199.seq
 230690075     gbest2.seq
 230688496     gbest20.seq
 230690908     gbest200.seq
 230690230     gbest201.seq
 230692077     gbest202.seq
 230688147     gbest203.seq
 230688867     gbest204.seq
 230689284     gbest205.seq
 230688607     gbest206.seq
 230688124     gbest207.seq
 230688734     gbest208.seq
 230687815     gbest209.seq
 230691129     gbest21.seq
 230687877     gbest210.seq
 230688784     gbest211.seq
 230687631     gbest212.seq
 230687615     gbest213.seq
 230687696     gbest214.seq
 230689169     gbest215.seq
 230687585     gbest216.seq
 230688268     gbest217.seq
 230688157     gbest218.seq
 230690070     gbest219.seq
 230688449     gbest22.seq
 230688729     gbest220.seq
 230687689     gbest221.seq
 230688457     gbest222.seq
 230688175     gbest223.seq
 230690243     gbest224.seq
 230689642     gbest225.seq
 187550035     gbest226.seq
 162788739     gbest227.seq
 163406917     gbest228.seq
 171210352     gbest229.seq
 230688787     gbest23.seq
 169801271     gbest230.seq
 164173541     gbest231.seq
 165252939     gbest232.seq
 164818228     gbest233.seq
 164058427     gbest234.seq
 164703119     gbest235.seq
 164190717     gbest236.seq
 164317082     gbest237.seq
 163105593     gbest238.seq
 168345283     gbest239.seq
 230688524     gbest24.seq
 162751330     gbest240.seq
 162849352     gbest241.seq
 166950720     gbest242.seq
 168107322     gbest243.seq
 165981237     gbest244.seq
 165789332     gbest245.seq
 165465393     gbest246.seq
 165241212     gbest247.seq
 164408593     gbest248.seq
 164267561     gbest249.seq
 230689026     gbest25.seq
 165020440     gbest250.seq
 164927938     gbest251.seq
 179330742     gbest252.seq
 173434715     gbest253.seq
 180431473     gbest254.seq
 230689394     gbest255.seq
 230689413     gbest256.seq
 230688760     gbest257.seq
 230687651     gbest258.seq
 230688833     gbest259.seq
 230690203     gbest26.seq
 230687496     gbest260.seq
 230690343     gbest261.seq
 230687558     gbest262.seq
 230690693     gbest263.seq
 230687654     gbest264.seq
 230690597     gbest265.seq
 230689095     gbest266.seq
 230689804     gbest267.seq
 230688969     gbest268.seq
 230689009     gbest269.seq
 230688437     gbest27.seq
 230689238     gbest270.seq
 230691457     gbest271.seq
 230687662     gbest272.seq
 230689761     gbest273.seq
 230690758     gbest274.seq
 230689269     gbest275.seq
 230688825     gbest276.seq
 230688254     gbest277.seq
 230688232     gbest278.seq
 230687982     gbest279.seq
 230688959     gbest28.seq
 230688720     gbest280.seq
 230689312     gbest281.seq
 230689436     gbest282.seq
 230687755     gbest283.seq
 230687591     gbest284.seq
 230689059     gbest285.seq
 207594965     gbest286.seq
 230688929     gbest287.seq
 230690001     gbest288.seq
 230688195     gbest289.seq
 230687749     gbest29.seq
 230687505     gbest290.seq
 230690432     gbest291.seq
 230688693     gbest292.seq
 230688957     gbest293.seq
 230688075     gbest294.seq
 230688976     gbest295.seq
 230688624     gbest296.seq
 230688547     gbest297.seq
 230689294     gbest298.seq
 230689518     gbest299.seq
 230688010     gbest3.seq
 230687638     gbest30.seq
 230691298     gbest300.seq
 230689443     gbest301.seq
 230687903     gbest302.seq
 230688504     gbest303.seq
 230689365     gbest304.seq
 230689123     gbest305.seq
 230687966     gbest306.seq
 230688668     gbest307.seq
 230692057     gbest308.seq
 230689565     gbest309.seq
 230688098     gbest31.seq
 230690564     gbest310.seq
 230688605     gbest311.seq
 230688770     gbest312.seq
 230688394     gbest313.seq
 230691694     gbest314.seq
 230690225     gbest315.seq
 230688172     gbest316.seq
 230687479     gbest317.seq
 230687611     gbest318.seq
 230688325     gbest319.seq
 230688441     gbest32.seq
 230687521     gbest320.seq
 230688466     gbest321.seq
 230691281     gbest322.seq
 230688887     gbest323.seq
 230689793     gbest324.seq
 230689265     gbest325.seq
 230688357     gbest326.seq
 230690173     gbest327.seq
 230689369     gbest328.seq
 230688109     gbest329.seq
 230688413     gbest33.seq
 230689170     gbest330.seq
 230688685     gbest331.seq
 230687769     gbest332.seq
 230687738     gbest333.seq
 230690591     gbest334.seq
 230688061     gbest335.seq
 204501264     gbest336.seq
 230688764     gbest337.seq
 230689631     gbest338.seq
 230690620     gbest339.seq
 230687863     gbest34.seq
 230687858     gbest340.seq
 230688025     gbest341.seq
 199476798     gbest342.seq
 142635115     gbest343.seq
 230690542     gbest344.seq
 230689713     gbest345.seq
 230690113     gbest346.seq
 230691070     gbest347.seq
 230689238     gbest348.seq
 230690094     gbest349.seq
 230687776     gbest35.seq
 230688080     gbest350.seq
 230689445     gbest351.seq
 230691173     gbest352.seq
 230689792     gbest353.seq
 230689277     gbest354.seq
 230688773     gbest355.seq
 230688763     gbest356.seq
 230688419     gbest357.seq
 230688896     gbest358.seq
 230690992     gbest359.seq
 230688293     gbest36.seq
 230688346     gbest360.seq
 230689832     gbest361.seq
 230688536     gbest362.seq
 230689682     gbest363.seq
 230689714     gbest364.seq
 221100420     gbest365.seq
 230689861     gbest366.seq
 230689080     gbest367.seq
 230688831     gbest368.seq
 230688469     gbest369.seq
 230687883     gbest37.seq
 230691468     gbest370.seq
 230689576     gbest371.seq
 230691026     gbest372.seq
 230688232     gbest373.seq
 230690118     gbest374.seq
 230688632     gbest375.seq
 230689883     gbest376.seq
 230690431     gbest377.seq
 230689464     gbest378.seq
 230689237     gbest379.seq
 230689761     gbest38.seq
 230689918     gbest380.seq
 230690025     gbest381.seq
 230690136     gbest382.seq
 230689052     gbest383.seq
 230688653     gbest384.seq
 230689945     gbest385.seq
 230689075     gbest386.seq
 230687441     gbest387.seq
 230687779     gbest388.seq
 230689769     gbest389.seq
 230687592     gbest39.seq
 230689974     gbest390.seq
 230689025     gbest391.seq
 230687996     gbest392.seq
 230689638     gbest393.seq
 230688968     gbest394.seq
 230688384     gbest395.seq
 230689370     gbest396.seq
 211146823     gbest397.seq
 230687719     gbest398.seq
 230688145     gbest399.seq
 230688498     gbest4.seq
 230689799     gbest40.seq
 230690492     gbest400.seq
 230688833     gbest401.seq
 230690209     gbest402.seq
 230691022     gbest403.seq
 230691226     gbest404.seq
 230687768     gbest405.seq
 230688242     gbest406.seq
 230689423     gbest407.seq
 230688548     gbest408.seq
 230688546     gbest409.seq
 230688809     gbest41.seq
 230687580     gbest410.seq
 230690681     gbest411.seq
 230691672     gbest412.seq
 230690168     gbest413.seq
 230688529     gbest414.seq
 210588881     gbest415.seq
 210244866     gbest416.seq
 210120829     gbest417.seq
 210407972     gbest418.seq
 210296536     gbest419.seq
 230689331     gbest42.seq
 210434278     gbest420.seq
 211382358     gbest421.seq
 211690969     gbest422.seq
 211189127     gbest423.seq
 212264234     gbest424.seq
 213422972     gbest425.seq
 211346422     gbest426.seq
 210845888     gbest427.seq
 210739469     gbest428.seq
 210532061     gbest429.seq
 192679634     gbest43.seq
 210142274     gbest430.seq
 210235421     gbest431.seq
 210197915     gbest432.seq
 210114558     gbest433.seq
 225478817     gbest434.seq
 230687715     gbest435.seq
 230687939     gbest436.seq
 230689893     gbest437.seq
 230689133     gbest438.seq
 230688085     gbest439.seq
 191595893     gbest44.seq
 230688335     gbest440.seq
 230687851     gbest441.seq
 230687589     gbest442.seq
 230689041     gbest443.seq
 230687493     gbest444.seq
 230689715     gbest445.seq
 230688994     gbest446.seq
 230688653     gbest447.seq
 230687687     gbest448.seq
 230690200     gbest449.seq
 211592068     gbest45.seq
 230690998     gbest450.seq
 230687443     gbest451.seq
 230689357     gbest452.seq
 230688466     gbest453.seq
 230687944     gbest454.seq
 230687911     gbest455.seq
 230688919     gbest456.seq
 230689359     gbest457.seq
 226046432     gbest458.seq
 230688983     gbest459.seq
 216207081     gbest46.seq
 230688548     gbest460.seq
 230691537     gbest461.seq
 230691425     gbest462.seq
 230691369     gbest463.seq
 230689659     gbest464.seq
 230687606     gbest465.seq
 230691364     gbest466.seq
 230689378     gbest467.seq
 230688341     gbest468.seq
 230688258     gbest469.seq
 215975671     gbest47.seq
 230688963     gbest470.seq
 230688009     gbest471.seq
 230687846     gbest472.seq
 230689624     gbest473.seq
 230690229     gbest474.seq
 230690410     gbest475.seq
 230690130     gbest476.seq
 230688261     gbest477.seq
 230688907     gbest478.seq
 230689071     gbest479.seq
 217031395     gbest48.seq
 230690318     gbest480.seq
 230689997     gbest481.seq
 230688085     gbest482.seq
 230691574     gbest483.seq
 230689113     gbest484.seq
 230688949     gbest485.seq
 230688136     gbest486.seq
 230688676     gbest487.seq
 230687739     gbest488.seq
 230688662     gbest489.seq
 230688473     gbest49.seq
 230687599     gbest490.seq
 230689218     gbest491.seq
 230688044     gbest492.seq
 230691164     gbest493.seq
 230689987     gbest494.seq
 230689611     gbest495.seq
 230687834     gbest496.seq
 230689614     gbest497.seq
 230689291     gbest498.seq
 230224339     gbest499.seq
 164128347     gbest5.seq
 230688920     gbest50.seq
 230689338     gbest500.seq
 230691182     gbest501.seq
 230687951     gbest502.seq
 230688475     gbest503.seq
 230688768     gbest504.seq
 230688328     gbest505.seq
 230688824     gbest506.seq
 230689817     gbest507.seq
 230689470     gbest508.seq
 230687799     gbest509.seq
 229444033     gbest51.seq
 230688504     gbest510.seq
 230687718     gbest511.seq
 230688291     gbest512.seq
 230687982     gbest513.seq
 196042339     gbest514.seq
 208221599     gbest515.seq
 230688848     gbest516.seq
 230688722     gbest517.seq
 230688542     gbest518.seq
 230688271     gbest519.seq
 228716074     gbest52.seq
 230689764     gbest520.seq
 230689958     gbest521.seq
 230688396     gbest522.seq
 230687911     gbest523.seq
 230690405     gbest524.seq
 230689488     gbest525.seq
 230688378     gbest526.seq
 230688094     gbest527.seq
 230560235     gbest528.seq
 222069870     gbest529.seq
 230688211     gbest53.seq
 230688181     gbest530.seq
 230689375     gbest531.seq
 230689853     gbest532.seq
 230687593     gbest533.seq
 230688834     gbest534.seq
 230687931     gbest535.seq
 219240049     gbest536.seq
 216056972     gbest537.seq
 230688702     gbest538.seq
 230689878     gbest539.seq
 230687673     gbest54.seq
 230688786     gbest540.seq
 230690136     gbest541.seq
 230689682     gbest542.seq
 230688308     gbest543.seq
 230688307     gbest544.seq
 230687640     gbest545.seq
 230689632     gbest546.seq
 230689173     gbest547.seq
 230689765     gbest548.seq
 230689600     gbest549.seq
 230687868     gbest55.seq
 230688199     gbest550.seq
 230690654     gbest551.seq
 230687580     gbest552.seq
 230689211     gbest553.seq
 230688181     gbest554.seq
 230689010     gbest555.seq
 230687529     gbest556.seq
 230687628     gbest557.seq
 230688288     gbest558.seq
 230689459     gbest559.seq
 230691044     gbest56.seq
 230690155     gbest560.seq
 230689081     gbest561.seq
 230689808     gbest562.seq
 230687694     gbest563.seq
 230687535     gbest564.seq
 230687520     gbest565.seq
 220326049     gbest566.seq
 230689985     gbest567.seq
 230688515     gbest568.seq
 230689353     gbest569.seq
 230690061     gbest57.seq
 230691978     gbest570.seq
 230688315     gbest571.seq
 230688759     gbest572.seq
 230689950     gbest573.seq
 230688845     gbest574.seq
 230688324     gbest575.seq
 230687646     gbest576.seq
 230687835     gbest577.seq
 230688180     gbest578.seq
 230690386     gbest579.seq
 230687674     gbest58.seq
 230688994     gbest580.seq
 230688729     gbest581.seq
 230688114     gbest582.seq
 230689686     gbest583.seq
 230690346     gbest584.seq
 230690882     gbest585.seq
 225982739     gbest586.seq
 230688299     gbest587.seq
 230689141     gbest588.seq
  44548884     gbest589.seq
 230689928     gbest59.seq
 177443987     gbest6.seq
 230687624     gbest60.seq
 230690592     gbest61.seq
 230690131     gbest62.seq
 230688576     gbest63.seq
 230690390     gbest64.seq
 230689819     gbest65.seq
 229923206     gbest66.seq
 230690342     gbest67.seq
 211214243     gbest68.seq
 209388782     gbest69.seq
 230690464     gbest7.seq
 208850471     gbest70.seq
 209086006     gbest71.seq
 209377398     gbest72.seq
 210736096     gbest73.seq
 209448609     gbest74.seq
 208482155     gbest75.seq
 210209922     gbest76.seq
 209326718     gbest77.seq
 205101176     gbest78.seq
 208215126     gbest79.seq
 230688138     gbest8.seq
 207424260     gbest80.seq
 210035074     gbest81.seq
 222825784     gbest82.seq
 230689570     gbest83.seq
 230689393     gbest84.seq
 223389343     gbest85.seq
 214734045     gbest86.seq
 214314224     gbest87.seq
 230689698     gbest88.seq
 230687521     gbest89.seq
 230689173     gbest9.seq
 230690217     gbest90.seq
 230690165     gbest91.seq
 230689824     gbest92.seq
 230689829     gbest93.seq
 230687460     gbest94.seq
 230689547     gbest95.seq
 230688380     gbest96.seq
 230689280     gbest97.seq
 230690718     gbest98.seq
 230690127     gbest99.seq
  62479754     gbgen.idx
 230688637     gbgss1.seq
 230687925     gbgss10.seq
 228961235     gbgss100.seq
 227967581     gbgss101.seq
 228612853     gbgss102.seq
 228592407     gbgss103.seq
 228234721     gbgss104.seq
 227713457     gbgss105.seq
 230688750     gbgss106.seq
 230689008     gbgss107.seq
 230690456     gbgss108.seq
 230689372     gbgss109.seq
 230689943     gbgss11.seq
 230688410     gbgss110.seq
 230687687     gbgss111.seq
 230688461     gbgss112.seq
 230687567     gbgss113.seq
 230689140     gbgss114.seq
 230688373     gbgss115.seq
 230688273     gbgss116.seq
 230690830     gbgss117.seq
 230688639     gbgss118.seq
 230689503     gbgss119.seq
 230687579     gbgss12.seq
 230687464     gbgss120.seq
 230689682     gbgss121.seq
 230688855     gbgss122.seq
 230687991     gbgss123.seq
 230690337     gbgss124.seq
 230689160     gbgss125.seq
 230688256     gbgss126.seq
 230688300     gbgss127.seq
 230689817     gbgss128.seq
 230688065     gbgss129.seq
 230690564     gbgss13.seq
 230687605     gbgss130.seq
 230687461     gbgss131.seq
 230689258     gbgss132.seq
 230691049     gbgss133.seq
 230688012     gbgss134.seq
 230690138     gbgss135.seq
 230690030     gbgss136.seq
 230687641     gbgss137.seq
 230689398     gbgss138.seq
 230689142     gbgss139.seq
 230689739     gbgss14.seq
 230688799     gbgss140.seq
 230689298     gbgss141.seq
 230688065     gbgss142.seq
 230690380     gbgss143.seq
 229486739     gbgss144.seq
 226636378     gbgss145.seq
 230688013     gbgss146.seq
 210543365     gbgss147.seq
 230688261     gbgss148.seq
 230689391     gbgss149.seq
 230688189     gbgss15.seq
 230689607     gbgss150.seq
 230688951     gbgss151.seq
 230690120     gbgss152.seq
 230690128     gbgss153.seq
 230690220     gbgss154.seq
 230688737     gbgss155.seq
 230689750     gbgss156.seq
 230688994     gbgss157.seq
 230689610     gbgss158.seq
 230688062     gbgss159.seq
 230690067     gbgss16.seq
 230688928     gbgss160.seq
 209836298     gbgss161.seq
 250001357     gbgss162.seq
 250001049     gbgss163.seq
 250002566     gbgss164.seq
 250001260     gbgss165.seq
 250003158     gbgss166.seq
 250002814     gbgss167.seq
 250000938     gbgss168.seq
 250001812     gbgss169.seq
 230687646     gbgss17.seq
 250002369     gbgss170.seq
 250002252     gbgss171.seq
 250003125     gbgss172.seq
 250000355     gbgss173.seq
 250002552     gbgss174.seq
 250001671     gbgss175.seq
 250001316     gbgss176.seq
 250002477     gbgss177.seq
 250001361     gbgss178.seq
 250001270     gbgss179.seq
 230690809     gbgss18.seq
 250000891     gbgss180.seq
 250001685     gbgss181.seq
 250001161     gbgss182.seq
 250001797     gbgss183.seq
 250000186     gbgss184.seq
 250000280     gbgss185.seq
 250000211     gbgss186.seq
 250001032     gbgss187.seq
 250001719     gbgss188.seq
 250000714     gbgss189.seq
 230689798     gbgss19.seq
 250002341     gbgss190.seq
 250000108     gbgss191.seq
 250001809     gbgss192.seq
 250001761     gbgss193.seq
 250000943     gbgss194.seq
 250001239     gbgss195.seq
 250002209     gbgss196.seq
 250001499     gbgss197.seq
 250000332     gbgss198.seq
 250000358     gbgss199.seq
 230687653     gbgss2.seq
 230688957     gbgss20.seq
 250001344     gbgss200.seq
 250003028     gbgss201.seq
  86806649     gbgss202.seq
 230687987     gbgss21.seq
 230688943     gbgss22.seq
 230687620     gbgss23.seq
 230689870     gbgss24.seq
 230688515     gbgss25.seq
 230688470     gbgss26.seq
 230688168     gbgss27.seq
 230689681     gbgss28.seq
 230688986     gbgss29.seq
 230687885     gbgss3.seq
 230688442     gbgss30.seq
 230689741     gbgss31.seq
 230689007     gbgss32.seq
 230689889     gbgss33.seq
 230688063     gbgss34.seq
 230687621     gbgss35.seq
 230688047     gbgss36.seq
 230689687     gbgss37.seq
 230689118     gbgss38.seq
 230689667     gbgss39.seq
 230689545     gbgss4.seq
 230690351     gbgss40.seq
 230688361     gbgss41.seq
 230688389     gbgss42.seq
 230687598     gbgss43.seq
 230687852     gbgss44.seq
 230688979     gbgss45.seq
 230688503     gbgss46.seq
 230687581     gbgss47.seq
 230688141     gbgss48.seq
 230689395     gbgss49.seq
 230687819     gbgss5.seq
 230688644     gbgss50.seq
 230688678     gbgss51.seq
 230689266     gbgss52.seq
 230690739     gbgss53.seq
 230687622     gbgss54.seq
 230688110     gbgss55.seq
 230688701     gbgss56.seq
 230689435     gbgss57.seq
 230688529     gbgss58.seq
 230689701     gbgss59.seq
 230689999     gbgss6.seq
 230688879     gbgss60.seq
 229121133     gbgss61.seq
 230687872     gbgss62.seq
 230688585     gbgss63.seq
 230688864     gbgss64.seq
 230688551     gbgss65.seq
 230688098     gbgss66.seq
 230688399     gbgss67.seq
 230687773     gbgss68.seq
 230689066     gbgss69.seq
 230687516     gbgss7.seq
 230688869     gbgss70.seq
 230688517     gbgss71.seq
 230688292     gbgss72.seq
 230688982     gbgss73.seq
 230688980     gbgss74.seq
 230689524     gbgss75.seq
 230689127     gbgss76.seq
 230688589     gbgss77.seq
 230687703     gbgss78.seq
 230687897     gbgss79.seq
 230688381     gbgss8.seq
 230688670     gbgss80.seq
 208067168     gbgss81.seq
 194698973     gbgss82.seq
 212057242     gbgss83.seq
 230689417     gbgss84.seq
 230689904     gbgss85.seq
 230688833     gbgss86.seq
 230687953     gbgss87.seq
 230687802     gbgss88.seq
 230689707     gbgss89.seq
 230688662     gbgss9.seq
 230688468     gbgss90.seq
 230690679     gbgss91.seq
 230687485     gbgss92.seq
 230689910     gbgss93.seq
 230689666     gbgss94.seq
 230690133     gbgss95.seq
 230688860     gbgss96.seq
 230689274     gbgss97.seq
 230689898     gbgss98.seq
 230689450     gbgss99.seq
 250005768     gbhtc1.seq
 250001160     gbhtc10.seq
 250003774     gbhtc11.seq
  98409280     gbhtc12.seq
 250008815     gbhtc2.seq
 250006067     gbhtc3.seq
 250002503     gbhtc4.seq
 250004562     gbhtc5.seq
 250004817     gbhtc6.seq
 250002265     gbhtc7.seq
 250002749     gbhtc8.seq
 250002011     gbhtc9.seq
 250174851     gbhtg1.seq
 250177384     gbhtg10.seq
 250145483     gbhtg11.seq
 250212138     gbhtg12.seq
 250055823     gbhtg13.seq
 250194391     gbhtg14.seq
 250222621     gbhtg15.seq
 250063047     gbhtg16.seq
 250221156     gbhtg17.seq
 250071124     gbhtg18.seq
 250142761     gbhtg19.seq
 250047063     gbhtg2.seq
 250100123     gbhtg20.seq
 250263979     gbhtg21.seq
 250028119     gbhtg22.seq
 250035431     gbhtg23.seq
 250154110     gbhtg24.seq
 250245676     gbhtg25.seq
 250060980     gbhtg26.seq
 250048193     gbhtg27.seq
 250280021     gbhtg28.seq
 250050401     gbhtg29.seq
 250012077     gbhtg3.seq
 250180402     gbhtg30.seq
 250040712     gbhtg31.seq
 250075133     gbhtg32.seq
 250054321     gbhtg33.seq
 250059683     gbhtg34.seq
 250032830     gbhtg35.seq
 250108652     gbhtg36.seq
 250102823     gbhtg37.seq
 250144101     gbhtg38.seq
 250260803     gbhtg39.seq
 250018685     gbhtg4.seq
 250006936     gbhtg40.seq
 250015952     gbhtg41.seq
 250002650     gbhtg42.seq
 250310871     gbhtg43.seq
 250113106     gbhtg44.seq
 250102459     gbhtg45.seq
 250020932     gbhtg46.seq
 250011158     gbhtg47.seq
 250100820     gbhtg48.seq
 250086351     gbhtg49.seq
 250070433     gbhtg5.seq
 250194538     gbhtg50.seq
 250276235     gbhtg51.seq
 250059592     gbhtg52.seq
 250060875     gbhtg53.seq
 250274598     gbhtg54.seq
 250326688     gbhtg55.seq
 250062960     gbhtg56.seq
 250353495     gbhtg57.seq
 250176066     gbhtg58.seq
 250035804     gbhtg59.seq
 250053403     gbhtg6.seq
 250020115     gbhtg60.seq
 250174272     gbhtg61.seq
 250239418     gbhtg62.seq
 250155823     gbhtg63.seq
 250089563     gbhtg64.seq
 250151206     gbhtg65.seq
 250111336     gbhtg66.seq
 250129218     gbhtg67.seq
 250164716     gbhtg68.seq
 250156970     gbhtg69.seq
 250134380     gbhtg7.seq
 250044556     gbhtg70.seq
 250199981     gbhtg71.seq
 250148397     gbhtg72.seq
 250006989     gbhtg73.seq
 250050844     gbhtg74.seq
 250002873     gbhtg75.seq
 250148012     gbhtg76.seq
 250043470     gbhtg77.seq
 250196852     gbhtg78.seq
 250000640     gbhtg79.seq
 250119528     gbhtg8.seq
 250044775     gbhtg80.seq
 250105077     gbhtg81.seq
 250211852     gbhtg82.seq
 250120595     gbhtg83.seq
 250290147     gbhtg84.seq
 250010726     gbhtg85.seq
 250159541     gbhtg86.seq
 250085211     gbhtg87.seq
 250083206     gbhtg88.seq
 250077238     gbhtg89.seq
 250000639     gbhtg9.seq
 136627189     gbhtg90.seq
 250139525     gbinv1.seq
 265201321     gbinv2.seq
 250004874     gbinv3.seq
 250001092     gbinv4.seq
 250001574     gbinv5.seq
 250002237     gbinv6.seq
 250000589     gbinv7.seq
 250003524     gbinv8.seq
 205888401     gbinv9.seq
 170976765     gbjou1.idx
 239826454     gbjou2.idx
 191482503     gbkey1.idx
  74470511     gbkey2.idx
 250000677     gbmam1.seq
 250002174     gbmam2.seq
 128498207     gbmam3.seq
  36775548     gbnew.txt
 250000582     gbpat1.seq
 250002995     gbpat10.seq
 250000048     gbpat11.seq
 250000972     gbpat12.seq
 250001273     gbpat13.seq
 250000078     gbpat14.seq
 250000136     gbpat15.seq
 250001737     gbpat16.seq
 250001728     gbpat17.seq
 250008121     gbpat18.seq
 250000229     gbpat19.seq
 250001593     gbpat2.seq
 250000154     gbpat20.seq
 250001197     gbpat21.seq
 250126253     gbpat22.seq
 250000481     gbpat23.seq
 250034896     gbpat24.seq
 250000967     gbpat25.seq
 250003621     gbpat26.seq
 250000684     gbpat27.seq
   4901728     gbpat28.seq
 250000965     gbpat3.seq
 250001545     gbpat4.seq
 250001408     gbpat5.seq
 250000196     gbpat6.seq
 250000696     gbpat7.seq
 250000078     gbpat8.seq
 250000409     gbpat9.seq
  55947478     gbphg.seq
 250064305     gbpln1.seq
 250010418     gbpln10.seq
 250001371     gbpln11.seq
 250053515     gbpln12.seq
 250081646     gbpln13.seq
 310314332     gbpln14.seq
 256261948     gbpln15.seq
 250177361     gbpln16.seq
 250000069     gbpln17.seq
 250001221     gbpln18.seq
 250000644     gbpln19.seq
 250220183     gbpln2.seq
 250003579     gbpln20.seq
 250001804     gbpln21.seq
 250001426     gbpln22.seq
 250015804     gbpln23.seq
  15168386     gbpln24.seq
 250132034     gbpln3.seq
 250000308     gbpln4.seq
 250003111     gbpln5.seq
 250001910     gbpln6.seq
 250001863     gbpln7.seq
 250178417     gbpln8.seq
 250039198     gbpln9.seq
 250088931     gbpri1.seq
 250204306     gbpri10.seq
 250116927     gbpri11.seq
 250011854     gbpri12.seq
 250048145     gbpri13.seq
 250126908     gbpri14.seq
 250100191     gbpri15.seq
 250245052     gbpri16.seq
 250029747     gbpri17.seq
 250001896     gbpri18.seq
 250006841     gbpri19.seq
 250123035     gbpri2.seq
 250062711     gbpri20.seq
 250115124     gbpri21.seq
 250007732     gbpri22.seq
 250065923     gbpri23.seq
 250102092     gbpri24.seq
 250143882     gbpri25.seq
 250056781     gbpri26.seq
 250001889     gbpri27.seq
 250009642     gbpri28.seq
 250190706     gbpri29.seq
 250180864     gbpri3.seq
 250001821     gbpri30.seq
 250000159     gbpri31.seq
 197588163     gbpri32.seq
 250076362     gbpri4.seq
 250154809     gbpri5.seq
 250074140     gbpri6.seq
 250175585     gbpri7.seq
 250101248     gbpri8.seq
 250136205     gbpri9.seq
    239619     gbrel.txt
 250304060     gbrod1.seq
 250263288     gbrod10.seq
 250178218     gbrod11.seq
 250123809     gbrod12.seq
 250050896     gbrod13.seq
 250173213     gbrod14.seq
 250040098     gbrod15.seq
 250057986     gbrod16.seq
 250091164     gbrod17.seq
 250285969     gbrod18.seq
 250237756     gbrod19.seq
 250118153     gbrod2.seq
 250105759     gbrod20.seq
 250003823     gbrod21.seq
 250002934     gbrod22.seq
 250183526     gbrod23.seq
 250001362     gbrod24.seq
 184097860     gbrod25.seq
 250074023     gbrod3.seq
 250031977     gbrod4.seq
 250076953     gbrod5.seq
 250075447     gbrod6.seq
 250125138     gbrod7.seq
 250176883     gbrod8.seq
 250093402     gbrod9.seq
 704427392     gbsdr1.txt
3341237774     gbsdr2.txt
1331873285     gbsdr3.txt
   1409197     gbsec.idx
 250002604     gbsts1.seq
 250001591     gbsts10.seq
 250000100     gbsts11.seq
 250000476     gbsts12.seq
 250002904     gbsts13.seq
 156602273     gbsts14.seq
 250001674     gbsts2.seq
 250001192     gbsts3.seq
 250001619     gbsts4.seq
 250002231     gbsts5.seq
 250004523     gbsts6.seq
 250004235     gbsts7.seq
 250003836     gbsts8.seq
 250003351     gbsts9.seq
 226638791     gbsyn.seq
    422536     gbuna.seq
 250000146     gbvrl1.seq
 250000935     gbvrl2.seq
 250000717     gbvrl3.seq
 250003648     gbvrl4.seq
 250000021     gbvrl5.seq
 250000521     gbvrl6.seq
  93926435     gbvrl7.seq
 250122029     gbvrt1.seq
 250141939     gbvrt10.seq
 250106400     gbvrt11.seq
 250000950     gbvrt12.seq
  60754762     gbvrt13.seq
 250004023     gbvrt2.seq
 250159900     gbvrt3.seq
 250000844     gbvrt4.seq
 250004092     gbvrt5.seq
 250144361     gbvrt6.seq
 250171027     gbvrt7.seq
 250041180     gbvrt8.seq
 250121908     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         27586      105901637
BCT10        190        95674449
BCT11        63         112827230
BCT12        55         112910154
BCT13        46         116009207
BCT14        60         117993630
BCT15        70         113924085
BCT16        42         111722424
BCT17        83         106768567
BCT18        47979      89900630
BCT19        51137      91889906
BCT2         4847       107725890
BCT20        3278       8811908
BCT3         144        112033611
BCT4         24610      103565275
BCT5         52768      87161975
BCT6         5458       95641508
BCT7         13518      104912374
BCT8         64164      84947638
BCT9         76         112707847
ENV1         92139      71719835
ENV2         93291      77097885
ENV3         87505      82353040
ENV4         81522      74976767
EST1         68128      26290229
EST10        76541      29845692
EST100       72053      32175114
EST101       73967      44534271
EST102       66742      36110551
EST103       73036      36611829
EST104       72819      46423671
EST105       72892      42895651
EST106       68905      46165069
EST107       74320      34856551
EST108       70553      29720877
EST109       64581      31292325
EST11        75114      28771931
EST110       68967      41780496
EST111       69666      37485365
EST112       70522      43047334
EST113       75498      34021972
EST114       74316      27657480
EST115       75058      27592523
EST116       73164      41166848
EST117       64485      30451197
EST118       78352      48755163
EST119       78394      44918583
EST12        77704      30805257
EST120       71840      45787713
EST121       68811      41455878
EST122       72687      48650275
EST123       68435      43774652
EST124       72161      44206295
EST125       76555      44083709
EST126       71077      48590765
EST127       74952      47939836
EST128       73897      45956939
EST129       78087      35477352
EST13        77114      29306020
EST130       77894      27285460
EST131       80030      49461257
EST132       74754      42895470
EST133       65613      36448767
EST134       72352      36483905
EST135       66275      36907243
EST136       66758      36498830
EST137       70185      42962617
EST138       72881      42766537
EST139       68160      41969692
EST14        78509      31797414
EST140       68379      40976800
EST141       74703      43727313
EST142       68432      41025213
EST143       59447      34051105
EST144       96315      52013742
EST145       86786      50054455
EST146       76877      39469908
EST147       101140     54276834
EST148       108594     58532248
EST149       98300      54314279
EST15        74841      31633615
EST150       74066      45095049
EST151       94360      55050312
EST152       99441      59840855
EST153       93659      57812668
EST154       79217      43461534
EST155       69072      39270197
EST156       66225      31120440
EST157       61515      27987592
EST158       56784      27331883
EST159       65098      31455655
EST16        75820      33341066
EST160       55436      27987862
EST161       76389      47966212
EST162       67774      41082525
EST163       71247      50898061
EST164       75089      43001701
EST165       59621      30300851
EST166       63702      33933375
EST167       65545      37004038
EST168       63965      45470281
EST169       62738      35957968
EST17        82600      34092888
EST170       102480     46249841
EST171       86212      50561791
EST172       99488      56840893
EST173       99716      57881220
EST174       97729      51263666
EST175       81389      39799737
EST176       90354      37124894
EST177       94769      50831858
EST178       89243      36522405
EST179       95226      40878826
EST18        81030      32199733
EST180       67260      40239273
EST181       68630      42079109
EST182       63902      36969179
EST183       65518      42687513
EST184       69429      30290942
EST185       76952      33617873
EST186       67939      42303117
EST187       82430      41046992
EST188       62642      32530618
EST189       66793      48460578
EST19        78351      31879601
EST190       70421      45698382
EST191       67795      36246379
EST192       68051      44594235
EST193       69202      53797924
EST194       68915      34032726
EST195       71670      41082097
EST196       69956      59839016
EST197       66393      49598492
EST198       64613      47020236
EST199       64122      47546642
EST2         74651      28648016
EST20        74797      30650654
EST200       66069      46050234
EST201       65897      48289761
EST202       63361      45561909
EST203       62551      37472146
EST204       63680      34540136
EST205       64367      37541984
EST206       83949      47761325
EST207       83869      54607997
EST208       70691      41179464
EST209       106330     66545429
EST21        73427      34176548
EST210       108529     65403470
EST211       108944     64438745
EST212       103356     66855835
EST213       107284     58884138
EST214       106411     50413043
EST215       90130      55022134
EST216       98313      44248135
EST217       92521      48255644
EST218       72369      46815993
EST219       67521      44166122
EST22        75839      30423651
EST220       68591      58507653
EST221       68703      57997050
EST222       80140      40032522
EST223       79925      46718297
EST224       74709      52945092
EST225       71041      51790421
EST226       40241      20148875
EST227       27781      10549880
EST228       27667      10231693
EST229       26319      9747231
EST23        77299      32592606
EST230       26637      8976258
EST231       27555      9821315
EST232       27191      10048020
EST233       27176      9758324
EST234       27327      10254971
EST235       27105      12114474
EST236       27215      11228755
EST237       27303      10120673
EST238       27607      9283610
EST239       26839      9182854
EST24        74887      33094820
EST240       27765      11280802
EST241       27772      10810068
EST242       27070      11333006
EST243       26616      11924138
EST244       27064      11363846
EST245       27046      10904079
EST246       27022      11505152
EST247       27134      11549907
EST248       27262      11158114
EST249       27264      10824414
EST25        73588      31538649
EST250       27184      10561218
EST251       27196      10795095
EST252       24657      17248980
EST253       25593      17048788
EST254       40057      19075655
EST255       90729      44520790
EST256       48643      28515276
EST257       103865     40659883
EST258       70997      40764226
EST259       68633      44552742
EST26        75649      31261782
EST260       69436      44542419
EST261       69306      44143666
EST262       67718      39758794
EST263       72909      42558075
EST264       64997      49080757
EST265       64204      32283337
EST266       78957      39099628
EST267       101947     46852914
EST268       73138      42104135
EST269       66376      33589392
EST27        75216      32708007
EST270       68140      32969331
EST271       70190      42394903
EST272       73649      34816421
EST273       70195      35242265
EST274       73389      46780349
EST275       63697      33863542
EST276       67738      38235735
EST277       81959      42990035
EST278       75796      42682884
EST279       79067      51454986
EST28        108389     51534424
EST280       75719      54220580
EST281       111609     49074323
EST282       83737      42503146
EST283       73330      45494565
EST284       73501      40181614
EST285       72229      38165008
EST286       70097      27564038
EST287       70042      41517519
EST288       62141      33836811
EST289       63776      41832069
EST29        97393      46472579
EST290       71419      40536539
EST291       61952      44181409
EST292       63396      31960982
EST293       82421      43427445
EST294       83732      42932217
EST295       77920      49332308
EST296       104295     57311876
EST297       124225     46066330
EST298       73528      37196008
EST299       68101      35379831
EST3         73738      29916603
EST30        98702      53777605
EST300       69580      46606235
EST301       80682      39460750
EST302       71338      42122571
EST303       71677      41400169
EST304       60276      33834967
EST305       56667      35253367
EST306       62469      38362563
EST307       70759      47985110
EST308       69151      42245934
EST309       72102      41890800
EST31        80523      46316101
EST310       73435      37471381
EST311       59035      30786927
EST312       53767      27564393
EST313       52763      28190814
EST314       53018      28298828
EST315       51901      27001440
EST316       53961      26375571
EST317       55685      24461835
EST318       55264      23370544
EST319       54455      22368282
EST32        65599      49341414
EST320       55566      21412420
EST321       54968      22090410
EST322       56143      22359295
EST323       55017      21375393
EST324       56187      20130076
EST325       64950      35693189
EST326       76535      35279168
EST327       74455      33330877
EST328       77253      32953837
EST329       76599      33322791
EST33        73807      53416425
EST330       93141      61547422
EST331       67907      52693491
EST332       92682      56093775
EST333       93011      56026348
EST334       92588      55175770
EST335       66753      37416557
EST336       74149      36810287
EST337       66920      52558732
EST338       64890      49771605
EST339       57892      43792911
EST34        85777      47810127
EST340       61701      35336378
EST341       71397      44163824
EST342       64467      41108567
EST343       48102      23696033
EST344       67847      35757889
EST345       66687      36089506
EST346       60905      29661081
EST347       64853      41535277
EST348       78003      45526356
EST349       77068      41195082
EST35        86999      44523800
EST350       64760      37936937
EST351       74108      43236388
EST352       64548      43962686
EST353       78416      46010140
EST354       84730      49530990
EST355       86626      47187332
EST356       62643      33025494
EST357       65619      39876962
EST358       74977      38982181
EST359       49288      25684870
EST36        96823      52648674
EST360       59665      33486262
EST361       70202      40850529
EST362       92752      47195022
EST363       78730      41119589
EST364       73469      49809935
EST365       68678      46689860
EST366       66027      37265498
EST367       65610      34751400
EST368       88371      39221152
EST369       60101      38832218
EST37        79853      57784455
EST370       53006      38071107
EST371       64773      35872361
EST372       86185      52913332
EST373       92142      51271408
EST374       67088      40194081
EST375       78444      42676812
EST376       57901      38211221
EST377       43512      21352291
EST378       57995      36192644
EST379       83227      45186804
EST38        80794      56598270
EST380       78765      46557855
EST381       73150      44619580
EST382       80351      47145816
EST383       76698      49304324
EST384       75691      55348420
EST385       65055      37986223
EST386       61943      40798062
EST387       74890      39569639
EST388       52872      33038508
EST389       80580      29814111
EST39        100943     49852697
EST390       81733      33060758
EST391       68428      42229677
EST392       64518      36531152
EST393       68877      36506380
EST394       73677      43636257
EST395       65213      45354563
EST396       63821      40964099
EST397       78969      46406191
EST398       58147      33318251
EST399       59255      36803342
EST4         74568      28390131
EST40        93957      45605097
EST400       82234      51919288
EST401       84192      49152448
EST402       74797      42775788
EST403       58872      41143450
EST404       56881      40943962
EST405       57272      40555186
EST406       64163      39432295
EST407       74878      45821167
EST408       52872      33316663
EST409       61426      38914808
EST41        95569      48081362
EST410       57959      40835816
EST411       61465      41212274
EST412       55698      41984537
EST413       46999      33491412
EST414       93163      42408963
EST415       69434      38580994
EST416       69708      38338180
EST417       69866      38223791
EST418       69535      38783552
EST419       69611      38494125
EST42        96624      39454018
EST420       69568      38739343
EST421       68928      38375020
EST422       68889      39135048
EST423       69182      38434027
EST424       68184      37539209
EST425       67688      38699559
EST426       69359      39109561
EST427       69289      38187724
EST428       69439      38463668
EST429       69536      38068975
EST43        68612      18431586
EST430       69865      38141047
EST431       69685      38375997
EST432       69765      38285849
EST433       69958      37348985
EST434       84060      48060029
EST435       84795      44099350
EST436       80987      37400629
EST437       98815      57569755
EST438       80020      43766805
EST439       79091      50236213
EST44        68853      18420527
EST440       89884      57203682
EST441       96703      59215146
EST442       56535      41690094
EST443       51505      40498379
EST444       76938      45396579
EST445       57119      34750847
EST446       80583      47122452
EST447       121280     61006174
EST448       72272      45397081
EST449       81202      57865567
EST45        67435      20367344
EST450       41932      23289379
EST451       49154      51772109
EST452       46533      58547199
EST453       77411      54464875
EST454       64877      36862981
EST455       73245      43566897
EST456       67076      42606417
EST457       68585      42213978
EST458       60234      52678536
EST459       91098      44095758
EST46        43607      11891291
EST460       109209     47896244
EST461       75040      52338003
EST462       59651      39588868
EST463       57236      40961075
EST464       58832      39177804
EST465       65782      50671056
EST466       62653      44927962
EST467       61079      41793545
EST468       51797      38359264
EST469       56887      38635460
EST47        43449      12208578
EST470       55659      41429346
EST471       69187      37588492
EST472       65975      44042884
EST473       57122      38076340
EST474       61926      42877412
EST475       58427      45768487
EST476       65150      48704405
EST477       63151      41707835
EST478       54169      41303293
EST479       53547      35711526
EST48        43217      11488290
EST480       53156      36472243
EST481       59850      38814001
EST482       67680      40181230
EST483       64558      44870395
EST484       75072      61548526
EST485       74638      50230963
EST486       59565      52798098
EST487       48375      55256478
EST488       61448      52550201
EST489       63186      40510828
EST49        69536      26726191
EST490       67393      38023295
EST491       82530      51767176
EST492       81201      54365156
EST493       77390      46924626
EST494       65446      41038447
EST495       67844      41764369
EST496       77287      51300434
EST497       81007      49107860
EST498       75108      62960749
EST499       73266      49062826
EST5         48198      15295086
EST50        97679      44455682
EST500       68723      47992851
EST501       67475      52104534
EST502       62703      45476153
EST503       63055      45197620
EST504       87302      46081811
EST505       89300      43250720
EST506       123375     40724272
EST507       89941      56713317
EST508       61887      51262672
EST509       50783      50210753
EST51        93868      45601366
EST510       86733      28167193
EST511       99641      11153452
EST512       99713      11036046
EST513       97518      40492305
EST514       86999      31675091
EST515       86607      34018248
EST516       64568      56668504
EST517       81266      56072279
EST518       86942      49973853
EST519       72436      41468594
EST52        90301      44403059
EST520       71664      51863650
EST521       72497      44712371
EST522       86969      54469802
EST523       74856      48764792
EST524       73310      52939444
EST525       65760      49303929
EST526       79944      57801956
EST527       89480      45653402
EST528       83538      48094961
EST529       83320      39291043
EST53        99554      49580598
EST530       75338      40783562
EST531       86189      53734698
EST532       75014      52179633
EST533       70278      52348906
EST534       73016      42415452
EST535       99672      49644440
EST536       112330     47316963
EST537       112389     48471611
EST538       131325     59500750
EST539       109415     54080516
EST54        104165     53582072
EST540       77605      54970142
EST541       84439      24096521
EST542       84291      8747725
EST543       109901     51371574
EST544       128764     62016247
EST545       82764      46729020
EST546       63597      40631090
EST547       75807      49262931
EST548       77086      49977426
EST549       71794      45665943
EST55        75973      33392193
EST550       77152      46393022
EST551       66777      51688806
EST552       74168      47632194
EST553       66330      43703929
EST554       72159      53708530
EST555       102848     62452362
EST556       78061      44387011
EST557       77592      41296515
EST558       83794      45747710
EST559       93998      45546768
EST56        67267      28502122
EST560       72487      50320532
EST561       78397      54731911
EST562       81195      54323845
EST563       84071      55779712
EST564       82226      52339576
EST565       79550      38293977
EST566       71043      48914467
EST567       61286      39911519
EST568       65891      39696683
EST569       68200      42672813
EST57        72256      32690249
EST570       50956      32660466
EST571       51356      33024567
EST572       50585      36013042
EST573       78432      52125261
EST574       68567      50339606
EST575       110892     21681972
EST576       120615     14768021
EST577       125177     11373525
EST578       125066     11538692
EST579       106817     24356775
EST58        71216      30167396
EST580       68813      50237394
EST581       68407      49568384
EST582       75861      25800406
EST583       71671      25922692
EST584       73238      26767959
EST585       72732      26354330
EST586       78270      26358818
EST587       72523      28283040
EST588       68723      28133847
EST589       18871      5611945
EST59        78926      32309466
EST6         54921      17444242
EST60        78076      30718328
EST61        70125      28131970
EST62        64240      29479143
EST63        73126      32469132
EST64        79576      35768574
EST65        73558      29266187
EST66        73753      25282579
EST67        87017      42063071
EST68        44310      13027360
EST69        40396      11116221
EST7         74545      29357383
EST70        40399      12320845
EST71        40748      12596577
EST72        40745      12153253
EST73        40805      13215936
EST74        40660      12687208
EST75        40486      12350653
EST76        40101      11933251
EST77        40731      12805346
EST78        41499      11684098
EST79        41028      13177599
EST8         75835      30591559
EST80        40933      12692813
EST81        41552      13279996
EST82        45657      13231393
EST83        43503      27566943
EST84        42001      20707801
EST85        46725      18775082
EST86        50542      23163496
EST87        51109      20951343
EST88        75385      44559973
EST89        78508      39090656
EST9         77569      29867913
EST90        73885      28866029
EST91        76379      28984164
EST92        73450      37839394
EST93        76337      42925303
EST94        76939      44096044
EST95        75696      35441198
EST96        76260      43517214
EST97        71242      37082261
EST98        74952      31902466
EST99        73052      46770039
GSS1         90403      38650982
GSS10        74873      43594696
GSS100       75810      43231204
GSS101       74356      43206739
GSS102       73608      45092575
GSS103       73629      45038170
GSS104       73272      45297711
GSS105       73284      44775941
GSS106       75777      48190154
GSS107       83795      55974348
GSS108       82629      54569481
GSS109       82646      51435711
GSS11        70608      35929964
GSS110       86017      53394087
GSS111       81863      63616271
GSS112       78732      47560409
GSS113       94779      52327129
GSS114       83071      51080237
GSS115       79790      53693392
GSS116       87353      68453691
GSS117       78089      48308490
GSS118       75367      49032947
GSS119       91166      47631879
GSS12        72867      38288960
GSS120       89490      55125120
GSS121       85498      53949272
GSS122       85997      56562476
GSS123       77752      60625063
GSS124       76047      68594386
GSS125       78394      63264070
GSS126       79054      53774152
GSS127       78715      54638659
GSS128       79236      53833881
GSS129       78915      54354604
GSS13        76706      38976659
GSS130       78774      54526516
GSS131       84103      58848781
GSS132       82174      57962358
GSS133       72871      57492909
GSS134       67952      54817422
GSS135       76141      65709270
GSS136       75502      66319514
GSS137       78329      52621574
GSS138       83265      52684145
GSS139       94422      58267005
GSS14        71317      32131575
GSS140       93664      59421152
GSS141       81393      54483747
GSS142       91411      49328437
GSS143       71471      63324533
GSS144       112221     56794978
GSS145       115012     58317130
GSS146       87938      62796819
GSS147       60582      37702932
GSS148       65262      44904309
GSS149       72906      55885064
GSS15        70051      34744962
GSS150       72985      55914938
GSS151       72999      55890600
GSS152       73006      55878093
GSS153       72976      55930053
GSS154       72985      55915683
GSS155       76817      59574051
GSS156       81974      37900297
GSS157       87621      59758899
GSS158       88498      63589356
GSS159       85847      61535054
GSS16        78481      46287362
GSS160       89748      56766857
GSS161       71970      48276534
GSS162       86834      64352152
GSS163       83575      62755583
GSS164       103097     48154460
GSS165       68573      58504175
GSS166       68308      58776118
GSS167       69368      56630047
GSS168       69629      56121839
GSS169       70359      55392866
GSS17        70906      33297270
GSS170       85867      73154326
GSS171       86330      44801801
GSS172       88555      47327143
GSS173       85088      64703508
GSS174       70298      58976642
GSS175       69810      59960783
GSS176       63537      60854074
GSS177       81899      47181123
GSS178       86421      35917394
GSS179       95872      74764383
GSS18        59083      27955126
GSS180       93028      47645401
GSS181       107928     59832338
GSS182       120671     73159279
GSS183       117284     76240757
GSS184       105028     55802038
GSS185       82118      54226893
GSS186       95322      60409618
GSS187       107279     78696621
GSS188       108166     77748178
GSS189       106183     79893796
GSS19        56793      29072986
GSS190       104855     81001984
GSS191       76135      51054952
GSS192       109153     66108331
GSS193       109961     66306217
GSS194       108963     63914808
GSS195       79152      43750476
GSS196       106301     51116121
GSS197       84801      40184974
GSS198       95511      37110395
GSS199       95533      37074218
GSS2         88922      39302459
GSS20        57668      26711291
GSS200       95460      37197279
GSS201       94426      39794364
GSS202       28323      27568615
GSS21        61407      28966548
GSS22        64809      38244472
GSS23        57538      27054876
GSS24        66074      42002910
GSS25        68294      28341003
GSS26        58182      25339251
GSS27        65220      31889902
GSS28        65622      32588692
GSS29        77073      39616607
GSS3         87407      41798561
GSS30        82957      39733837
GSS31        74196      40402021
GSS32        70532      48278528
GSS33        79797      37820178
GSS34        75878      40339244
GSS35        74094      40092533
GSS36        87331      56000162
GSS37        87600      58170874
GSS38        85511      44950825
GSS39        86886      50521806
GSS4         78863      41012944
GSS40        86224      40151618
GSS41        83189      31660038
GSS42        81245      56935935
GSS43        80201      58163386
GSS44        72026      47499324
GSS45        72032      47437663
GSS46        77658      45789103
GSS47        77835      38607298
GSS48        83194      57974590
GSS49        86561      64612160
GSS5         78780      40537254
GSS50        81536      54554514
GSS51        93903      59234791
GSS52        88543      58798172
GSS53        76745      42467666
GSS54        72681      40296625
GSS55        86593      47186323
GSS56        88047      58388246
GSS57        77148      64748338
GSS58        71972      79313341
GSS59        86737      69317920
GSS6         78152      38866862
GSS60        88745      59429850
GSS61        63423      45029358
GSS62        66856      45836083
GSS63        89650      67275380
GSS64        84969      58060146
GSS65        86087      53078397
GSS66        86462      56262073
GSS67        95330      58328118
GSS68        100741     54364794
GSS69        100593     54553245
GSS7         77741      39121259
GSS70        101390     53543296
GSS71        102498     52137046
GSS72        102411     52247199
GSS73        102556     52064026
GSS74        102182     52537709
GSS75        99701      55695364
GSS76        90056      69051171
GSS77        89844      70766431
GSS78        88303      69759468
GSS79        87838      69659268
GSS8         75713      38106019
GSS80        88006      61741659
GSS81        83050      31522362
GSS82        77837      24396876
GSS83        84543      32807455
GSS84        82082      50259670
GSS85        80084      44996273
GSS86        88080      61099017
GSS87        80746      59758720
GSS88        77037      79042622
GSS89        77456      62533851
GSS9         72102      37149999
GSS90        89624      48484097
GSS91        79512      45034033
GSS92        79701      45121447
GSS93        73536      62635195
GSS94        83619      51999491
GSS95        80852      57019056
GSS96        85707      56717996
GSS97        83821      57921883
GSS98        87988      51729071
GSS99        82871      71932140
HTC1         25064      27057244
HTC10        67203      80956363
HTC11        67985      59527109
HTC12        24661      32558302
HTC2         15992      36040161
HTC3         15968      36540083
HTC4         16191      35387639
HTC5         15926      40287252
HTC6         16011      37280168
HTC7         51321      28424545
HTC8         55503      71483552
HTC9         81847      70118593
HTG1         1318       188986678
HTG10        1286       186588947
HTG11        1441       184188034
HTG12        879        191988472
HTG13        750        192274123
HTG14        743        192294826
HTG15        782        192309741
HTG16        802        192005952
HTG17        768        192322607
HTG18        2050       171265536
HTG19        1054       187970767
HTG2         2472       186091978
HTG20        996        189168468
HTG21        782        192060727
HTG22        924        190304687
HTG23        901        190586664
HTG24        808        191507090
HTG25        780        192166174
HTG26        857        191368821
HTG27        889        190738102
HTG28        948        190117267
HTG29        897        191062439
HTG3         2516       185270370
HTG30        928        190475719
HTG31        872        191303806
HTG32        968        189614530
HTG33        877        191166087
HTG34        857        191463999
HTG35        826        191818603
HTG36        933        190240070
HTG37        932        190852950
HTG38        943        190341497
HTG39        1035       189499509
HTG4         2548       188454164
HTG40        1189       187164037
HTG41        1227       188171325
HTG42        1207       188119317
HTG43        1170       187312805
HTG44        1097       191576875
HTG45        1217       191024666
HTG46        1240       190834403
HTG47        1136       191145047
HTG48        1052       191108201
HTG49        937        189647737
HTG5         1282       185626521
HTG50        1050       189710574
HTG51        911        189770667
HTG52        1041       189562388
HTG53        918        189526030
HTG54        1013       189595865
HTG55        920        189397605
HTG56        963        188825868
HTG57        1099       188932980
HTG58        975        189571053
HTG59        1098       185729060
HTG6         1274       185234665
HTG60        1096       188869107
HTG61        993        189259773
HTG62        1024       189003233
HTG63        970        189225063
HTG64        1121       188622284
HTG65        1097       188314252
HTG66        1288       184428644
HTG67        1249       185548775
HTG68        1234       184703189
HTG69        1255       184746888
HTG7         1271       185525698
HTG70        1208       186162121
HTG71        1431       187560233
HTG72        1261       188477121
HTG73        1111       191450264
HTG74        1134       191990864
HTG75        1229       191702133
HTG76        1127       191719155
HTG77        1185       191943653
HTG78        1167       190665429
HTG79        1209       190707850
HTG8         1425       184812159
HTG80        1243       190482067
HTG81        1227       189763692
HTG82        1092       189019804
HTG83        1230       189123831
HTG84        1434       188790235
HTG85        982        193518620
HTG86        744        169299578
HTG87        1114       193866373
HTG88        1097       192615575
HTG89        1169       192131541
HTG9         1200       186995800
HTG90        703        104712729
INV1         21032      155463998
INV2         1421       181651279
INV3         24948      126212196
INV4         79557      71496247
INV5         53487      90275419
INV6         80911      72722674
INV7         63715      85798667
INV8         83745      66502668
INV9         26677      93315034
MAM1         27973      147154123
MAM2         54456      99624296
MAM3         44962      38587309
PAT1         222623     70141546
PAT10        125396     99569402
PAT11        141760     62613496
PAT12        105827     59895234
PAT13        103573     50219401
PAT14        121422     53328684
PAT15        113096     61276623
PAT16        145013     54904631
PAT17        155478     69930723
PAT18        97474      122615235
PAT19        147625     87332832
PAT2         194507     84661262
PAT20        117313     104466646
PAT21        123736     103474698
PAT22        119301     106155650
PAT23        94382      85091179
PAT24        92322      88656589
PAT25        120348     61575783
PAT26        97623      78327581
PAT27        163085     84255002
PAT28        5168       1156893
PAT3         171987     95895459
PAT4         153749     106059248
PAT5         184019     85620296
PAT6         156376     93375370
PAT7         152397     81715411
PAT8         104665     119416000
PAT9         143590     89203025
PHG          3318       22512439
PLN1         45528      109132208
PLN10        19878      164061670
PLN11        19806      164172769
PLN12        17270      164273244
PLN13        1258       165525065
PLN14        1268       200732959
PLN15        5          168115057
PLN16        78         167185296
PLN17        65236      66783500
PLN18        78174      77138610
PLN19        73225      76971312
PLN2         1389       166510646
PLN20        17911      135646232
PLN21        70909      87973627
PLN22        98256      61078339
PLN23        58634      90969468
PLN24        2173       5984979
PLN3         1566       169248190
PLN4         29163      131616420
PLN5         76150      78560935
PLN6         75755      73683178
PLN7         33050      50892445
PLN8         24339      99913230
PLN9         21196      155794800
PRI1         29253      122380619
PRI10        1470       183084277
PRI11        1282       178966681
PRI12        1459       178349681
PRI13        1605       179787753
PRI14        1613       182193741
PRI15        1227       192255509
PRI16        1139       194187435
PRI17        22006      155347761
PRI18        53083      109675151
PRI19        49746      75147321
PRI2         1621       172507945
PRI20        10445      161927711
PRI21        2393       181897317
PRI22        1628       182632195
PRI23        2021       183383245
PRI24        1988       182499964
PRI25        11899      158471073
PRI26        1321       183510970
PRI27        44410      105677566
PRI28        42930      69737413
PRI29        22937      104422459
PRI3         1336       184781033
PRI30        19915      148384981
PRI31        81432      79816090
PRI32        44461      82959269
PRI4         1309       184541895
PRI5         1198       181773765
PRI6         1189       178867850
PRI7         1239       181415845
PRI8         1316       175115155
PRI9         1233       175393236
ROD1         10691      167167360
ROD10        976        182360312
ROD11        1030       186614626
ROD12        960        183496347
ROD13        1023       187430195
ROD14        954        181174779
ROD15        963        182163814
ROD16        1036       186170564
ROD17        25473      150506942
ROD18        11635      163459956
ROD19        1161       186266553
ROD2         926        174178893
ROD20        1187       185807307
ROD21        31074      127606436
ROD22        31706      66823426
ROD23        3353       182534468
ROD24        114297     66686054
ROD25        71840      43256029
ROD3         907        173827689
ROD4         904        174002855
ROD5         926        173942491
ROD6         985        181028879
ROD7         971        179827206
ROD8         987        181763336
ROD9         1010       182971991
STS1         82706      35286435
STS10        57925      44588992
STS11        57911      43613991
STS12        65683      42726657
STS13        86654      32961730
STS14        57824      25939090
STS2         85327      48519486
STS3         68607      26968639
STS4         78107      37468212
STS5         54817      32113573
STS6         54826      31994893
STS7         54670      32193887
STS8         55816      36373072
STS9         57856      44560692
SYN          49262      64876627
UNA          211        114018
VRL1         72061      66147687
VRL2         71896      62453797
VRL3         70993      67059962
VRL4         67019      69135821
VRL5         63414      71182155
VRL6         64523      75342484
VRL7         26296      25634443
VRT1         17477      166100166
VRT10        11049      177997898
VRT11        7410       180546708
VRT12        69175      89321092
VRT13        18974      17957743
VRT2         65392      95062669
VRT3         8281       176347766
VRT4         78589      70874616
VRT5         44494      64092474
VRT6         9674       164857344
VRT7         1281       191756845
VRT8         1288       191629252
VRT9         11280      176789912

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 158.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :

Entries        Bases   Species

10703938 12504459412   Homo sapiens
6784988   8115290614   Mus musculus
1268746   5748343551   Rattus norvegicus
1851261   3687679563   Bos taurus
1541817   2735876665   Danio rerio
2821147   2705770382   Zea mays
1156694   1509097774   Oryza sativa (japonica cultivar-group)
1278077   1259752967   Sus scrofa
226848    1252648032   Strongylocentrotus purpuratus
1242643   1005148047   Xenopus tropicalis
1427408    907622191   Canis familiaris
210615     895897302   Pan troglodytes
1939494    873721852   Arabidopsis thaliana
675944     863775009   Drosophila melanogaster
801476     832657627   Gallus gallus
497203     810163852   Vitis vinifera
74131      589029977   Macaca mulatta
887954     519141294   Triticum aestivum
801836     481941043   Sorghum bicolor
397755     480298800   Medicago truncatula

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, CON-division sequence files, and the
lists of new, changed, and deleted accession numbers, each of the files of a
GenBank release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 February 2007

                NCBI-GenBank Flat File Release 158.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 PROJECT Format

  This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
PROJECT     GenomeProject:18787

  A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second 
contains the actual project identifier ("18787").

  PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 158.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
	Irene Fang, Linda Frisse, Michael Fetchko, Andrea Gocke, Amelie Gubitz
	Anjanette Johnston, Kellie Kelm, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
	Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, WonHee Jang,
	Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Tony Stearman

User Support
	Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
	Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
	Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
	David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center