Release Notes For GenBank Release 160

GBREL.TXT          Genetic Sequence Data Bank
                         June 15 2007

               NCBI-GenBank Flat File Release 160.0

                    Distribution Release Notes

 73078143 loci, 77248690945 bases, from 73078143 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 160.0
1.2 Cutoff Date
1.3 Important Changes in Release 160.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 160.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 160.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:

	ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/  (Japan)
	ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/  (Korea)
	ftp://bio-mirror.sg.apan.net/biomirrors/genbank/     (Singapore)

1.2 Cutoff Date

  This full release, 160.0, incorporates data available to the collaborating
databases as of June 14, 2007 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 160.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 20 with this release:

  - the BCT division is now comprised of  22 files (+1)
  - the CON division is now comprised of   8 files (+1)
  - the EST division is now comprised of 609 files (+5)
  - the GSS division is now comprised of 261 files (+9)
  - the HTG division is now comprised of  96 files (+3)
  - the PAT division is now comprised of  29 files (+1)

1.3.2 Several CON-division files significantly exceed 2GB

  Data generated by the AACY02 metagenomic WGS project:

    PubMed ID 17355176 
    http://www.pubmedcentral.nih.gov/articlerender.fcgi?tool=pubmed&pubmedid=17355176

resulted in the addition of over 3 million CON-division records to GenBank.
Current procedures are not optimized for handling such a large influx, and
as a result, several of the CON-division sequence files exceed 2GB when
uncompressed. For example:

    gbcon6.seq : 7,261,904,050 bytes
    gbcon7.seq : 3,092,551,793 bytes
    gbcon8.seq : 5,859,018,078 bytes

During the next several months, we will work to enhance the processing of
the CON-division of GenBank, such that the records are provided via a
larger number of much smaller files. 

1.3.3 Multiple identifiers for the PROJECT line

  The recently-introduced PROJECT linetype (see Section 3.4.7.2) provides a
way to link GenBank sequences that are part of a sequencing project to the
Entrez Genome Project database, where further details about the project can
be obtained.

  As of June 2007, multiple identifiers are now valid for the PROJECT line.
Here is a mocked-up example of the expected usage:

LOCUS       AANA01000001               2 rc    DNA     linear   BCT 09-FEB-2007
DEFINITION  Polaribacter dokdonensis MED152 whole genome shotgun sequencing
            project.
ACCESSION   AANA01000001
VERSION     AANA01000001.1  GI:85822094
PROJECT     GenomeProject:13543  GenomeProject:99999

  There are several situations in which a record could be considered part
of two different Genome Projects. For example, consider an
environmental-sampling metagenomic WGS project for which the individual
sequence-overlap contigs are not attributed to a specific organism. An
associated Genome Project could exist which provides further details about
the sequencing effort, the centers involved, etc.

  If, in subsequent assembly and annotation phases, scaffold/super-contig/
chromosomal records are created which **are** attributed to a specific
organism, then those CON-division records could have two Genome Project IDs:
one for the WGS sequencing project as a whole; and a second for an
organism-specific Genome Project.

  Additional examples illustrating the use of multiple Genome Project IDs 
will be provided in future release notes, and via the GenBank listserv.

1.3.4 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.5 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
forty-three of the GSS flatfiles in Release 160.0. Consider gbgss219.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                            June 15 2007

                NCBI-GenBank Flat File Release 160.0

                           GSS Sequences (Part 1)

   86834 loci,    64340568 bases, from    86834 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "219" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 Structured /specimen_voucher qualifiers

  As of October 2007, the content of the /specimen_voucher qualifier will
be able to support a structured value consisting of an institution code,
a collection code, and a specimen identifier, as well as the existing
unstructured values. Here is the preliminary new definition of the qualifier:

Qualifier:
specimen_voucher

Definition:
Identifier for the specimen from which the nucleic acid sequenced was obtained.

Value format:
/specimen_voucher="[<institution-code>:[<collection-code>:]]<specimen_id>"

Example:
/specimen_voucher="UAM:Mamm:52179"
/specimen_voucher="AMCC:101706"
/specimen_voucher="USNM:field series 8798"
/specimen_voucher="personal collection:Dan Janzen:99-SRNP-2003"
/specimen_voucher="99-SRNP-2003"

Comment:
The specimen_voucher qualifier is intended to annotate a reference to the
physical specimen that remains after the sequence has been obtained. If the
specimen was destroyed in the process of sequencing, electronic images
(e-vouchers) are an adequate substitute for a physical voucher specimen.
Ideally the specimens will be deposited in a curated museum, herbarium, or
frozen tissue collection, but often they will remain in a personal or
laboratory collection for some time before they are deposited in a curated
collection.

There are three forms of specimen_voucher qualifiers. If the text of the
qualifier includes one or more colons it is a 'structured voucher'. Structured
vouchers include institution-codes (and optional collection-codes) taken from
a controlled vocabulary that denote the museum or herbarium collection where
the specimen resides.

   <specimen_id>
   <institution_code>:<specimen_id>
   <institution_code>:<collection_code>:<specimen_id>

1.4.2 New /culture_collection and /bio_material qualifiers

  As of the December 2007 GenBank release, new qualifiers /culture_collection
and /bio_material qualifiers will be legal for the source feature. These
qualifiers will utilize the same format as /speciment_voucher (see Section
1.4.1 of these release notes). Their preliminary definitions are:

Qualifier:
culture_collection

Definition:
Institution code and identifier for the culture from which the nucleic acid
sequenced was obtained, with optional collection code.

Value format:
/culture_collection="<institution-code>:[<collection-code>:]<culture_id>"

Example:
/culture_collection="ATCC:26370"

Comment:
01234567890123456789012345678901234567890123456789012345678901234567890123456789
The culture_collection qualifier should be used to annotate live microbial and
viral cultures, and cell lines that have been deposited in curated culture
collections. Microbial cultures in personal or laboratory collections should
be annotated in strain qualifiers.

Annotation with a culture_collection qualifier implies that the sequence was
obtained from a sample retrieved (by the submitter or a collaborator) from the
indicated culture collection, or that the sequence was obtained from a sample
that was deposited (by the submitter or a collaborator) in the indicated culture
collection. Annotation with more than one culture_collection qualifier
indicates that the sequence was obtained from a sample that was deposited
(by the submitter or a collaborator) in more than one culture collection.

Culture_id and institution_code are mandatory, collection_code is optional.
Institution code is mandatory where collection code is present.


Qualifier:
bio_material

Definition:
Identifier for the biological material from which the nucleic acid sequenced
was obtained, with optional institution code and collection code for the place
where it is currently stored.

Value format:
/bio_material="[<institution-code>:[<collection-code>:]]<material_id>"

Example:
/bio_material="CGC:CB3912"      <- Caenorhabditis stock center

Comment:
The bio_material qualifier should be used to annotate the identifiers of material
in biological collections that are not appropriate to annotate as either
/specimen_voucher or /culture_collection. These include zoos and aquaria,
stock centers, seed banks, germplasm repositories and DNA banks.

Material_id is mandatory, institution_code and collection_code are optional.
Institution code is mandatory where collection code is present.

1.4.3 /operon qualifiers for protein_bind features

  Due to an oversight, the /operon qualifier is not currently listed 
as a legal qualifier for the protein_bind feature. This will be 
corrected as of October 2007, with an update to the Feature Table
document which includes the qualifier among those that are legal
for protein_bind.

1.4.4 Alignment as EVIDENCE_BASIS for the /inference qualifier

  Several algorithms exist which allow mRNAs to be aligned to genomic
sequence, taking into account introns and splice signals. In order to
document the use of such algorithms for the structured /inference
qualifier, a new class of EVIDENCE_BASIS will be introduced:

	alignment

This addition to the controlled vocabulary of the /inference qualifier
will be legal as of October 2007.

1.4.5 New ncRNA feature 

  A variety of new types of RNA features have been introduced in 
recent years. snRNA, snoRNA, and scRNA are some examples.

  Because the number of non-coding RNA families is quite likely to
continue to expand, a new ncRNA feature that can flexibly 
accomodate them will be introduced as of October 2007.

  This new feature will utilize a new qualifier called
/ncRNA_class, with a controlled vocabulary to indicate what type
of non-coding feature is being represented.

  A complete description of the ncRNA feature and the new
qualifier are not yet available. When details are finalized,
hopefully by June 30, additional details will be distributed
via the GenBank listserv, and in future versions of these
release notes.

1.4.6 New tmRNA feature and /peptide_tag qualifier

  To support the annotation of a class of RNAs that have dual
tRNA-like and mRNA-like behaviors, a new tmRNA feature will be
legal for the Feature Table as of December 2007. The "tmRNA Website"
at Indiana University provides some background information about
the unusual biology of tmRNAs :

	http://www.indiana.edu/~tmrna/ 

Here is a preliminary definition of the new tmRNA feature:

Feature Key           tmRNA
Definition            transfer messenger RNA; tmRNA acts like a tRNA first, 
                      and then an mRNA that encodes a peptide tag. 
                      The ribosome translates this mRNA region of tmRNA and 
                      attaches the encoded peptide tag to the C-terminus of the 
                      unfinished protein. This attached tag targets the protein
                      for destruction or proteolysis
Optional qualifiers   /allele="text"
                      /citation=[number]
                      /db_xref="<database>:<identifier>"
                      /experiment="text"
                      /function="text"
                      /gene="text"
                      /inference="TYPE[ (same species)][:EVIDENCE_BASIS]"
                      /label=feature_label
                      /locus_tag="text" (single token)
                      /map="text"
                      /note="text"
                      /old_locus_tag="text" (single token)
                      /product="text"
                      /pseudo
                      /standard_name="text"

To indicate the nucleotide region encoding the proteolysis tag
peptide, a new /peptide_tag qualifier will be introduced for
the tmRNA feature.

Complete details about this new feature and qualifier will be
distributed via the GenBank listserv, and in future versions of
these release notes.

1.4.7 /organism no longer to be used for misc_recomb

  The /organism qualifier is currently legal for misc_recomb
features. A review of the existing cases in the database has
indicated that all could be better annotated through the use
of multiple source features.

  That work will be completed by October 2007, at which
point /organism will no longer be allowed for the misc_recomb
feature key.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1213 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut3.idx - Index of the entries according to author name, part 3.
19. gbaut4.idx - Index of the entries according to author name, part 4.
20. gbaut5.idx - Index of the entries according to author name, part 5.
21. gbaut6.idx - Index of the entries according to author name, part 6.
22. gbaut7.idx - Index of the entries according to author name, part 7.
23. gbaut8.idx - Index of the entries according to author name, part 8.
24. gbaut9.idx - Index of the entries according to author name, part 9.
25. gbbct1.seq - Bacterial sequence entries, part 1.
26. gbbct10.seq - Bacterial sequence entries, part 10.
27. gbbct11.seq - Bacterial sequence entries, part 11.
28. gbbct12.seq - Bacterial sequence entries, part 12.
29. gbbct13.seq - Bacterial sequence entries, part 13.
30. gbbct14.seq - Bacterial sequence entries, part 14.
31. gbbct15.seq - Bacterial sequence entries, part 15.
32. gbbct16.seq - Bacterial sequence entries, part 16.
33. gbbct17.seq - Bacterial sequence entries, part 17.
34. gbbct18.seq - Bacterial sequence entries, part 18.
35. gbbct19.seq - Bacterial sequence entries, part 19.
36. gbbct2.seq - Bacterial sequence entries, part 2.
37. gbbct20.seq - Bacterial sequence entries, part 20.
38. gbbct21.seq - Bacterial sequence entries, part 21.
39. gbbct22.seq - Bacterial sequence entries, part 22.
40. gbbct3.seq - Bacterial sequence entries, part 3.
41. gbbct4.seq - Bacterial sequence entries, part 4.
42. gbbct5.seq - Bacterial sequence entries, part 5.
43. gbbct6.seq - Bacterial sequence entries, part 6.
44. gbbct7.seq - Bacterial sequence entries, part 7.
45. gbbct8.seq - Bacterial sequence entries, part 8.
46. gbbct9.seq - Bacterial sequence entries, part 9.
47. gbchg.txt - Accession numbers of entries updated since the previous release.
48. gbcon1.seq - Constructed sequence entries, part 1.
49. gbcon2.seq - Constructed sequence entries, part 2.
50. gbcon3.seq - Constructed sequence entries, part 3.
51. gbcon4.seq - Constructed sequence entries, part 4.
52. gbcon5.seq - Constructed sequence entries, part 5.
53. gbcon6.seq - Constructed sequence entries, part 6.
54. gbcon7.seq - Constructed sequence entries, part 7.
55. gbcon8.seq - Constructed sequence entries, part 8.
56. gbdel.txt - Accession numbers of entries deleted since the previous release.
57. gbenv1.seq - Environmental sampling sequence entries, part 1.
58. gbenv2.seq - Environmental sampling sequence entries, part 2.
59. gbenv3.seq - Environmental sampling sequence entries, part 3.
60. gbenv4.seq - Environmental sampling sequence entries, part 4.
61. gbenv5.seq - Environmental sampling sequence entries, part 5.
62. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
63. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
64. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
65. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
66. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
67. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
68. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
69. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
70. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
71. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
72. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
73. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
74. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
75. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
76. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
77. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
78. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
79. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
80. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
81. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
82. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
83. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
84. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
85. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
86. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
87. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
88. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
89. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
90. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
91. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
92. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
93. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
94. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
95. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
96. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
97. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
98. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
99. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
100. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
101. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
102. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
103. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
104. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
105. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
106. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
107. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
108. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
109. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
110. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
111. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
112. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
113. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
114. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
115. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
116. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
117. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
118. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
119. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
120. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
121. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
122. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
123. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
124. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
125. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
126. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
127. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
128. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
129. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
130. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
131. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
132. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
133. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
134. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
135. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
136. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
137. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
138. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
139. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
140. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
141. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
142. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
143. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
144. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
145. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
146. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
147. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
148. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
149. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
150. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
151. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
152. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
153. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
154. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
155. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
156. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
157. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
158. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
159. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
160. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
161. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
162. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
163. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
164. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
165. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
166. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
167. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
168. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
169. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
170. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
171. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
172. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
173. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
174. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
175. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
176. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
177. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
178. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
179. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
180. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
181. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
182. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
183. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
184. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
185. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
186. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
187. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
188. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
189. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
190. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
191. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
192. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
193. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
194. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
195. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
196. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
197. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
198. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
199. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
200. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
201. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
202. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
203. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
204. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
205. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
206. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
207. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
208. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
209. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
210. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
211. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
212. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
213. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
214. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
215. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
216. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
217. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
218. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
219. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
220. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
221. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
222. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
223. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
224. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
225. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
226. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
227. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
228. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
229. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
230. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
231. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
232. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
233. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
234. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
235. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
236. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
237. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
238. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
239. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
240. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
241. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
242. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
243. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
244. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
245. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
246. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
247. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
248. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
249. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
250. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
251. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
252. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
253. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
254. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
255. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
256. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
257. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
258. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
259. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
260. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
261. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
262. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
263. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
264. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
265. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
266. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
267. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
268. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
269. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
270. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
271. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
272. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
273. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
274. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
275. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
276. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
277. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
278. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
279. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
280. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
281. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
282. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
283. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
284. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
285. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
286. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
287. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
288. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
289. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
290. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
291. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
292. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
293. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
294. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
295. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
296. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
297. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
298. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
299. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
300. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
301. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
302. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
303. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
304. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
305. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
306. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
307. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
308. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
309. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
310. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
311. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
312. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
313. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
314. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
315. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
316. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
317. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
318. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
319. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
320. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
321. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
322. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
323. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
324. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
325. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
326. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
327. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
328. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
329. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
330. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
331. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
332. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
333. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
334. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
335. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
336. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
337. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
338. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
339. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
340. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
341. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
342. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
343. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
344. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
345. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
346. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
347. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
348. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
349. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
350. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
351. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
352. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
353. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
354. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
355. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
356. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
357. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
358. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
359. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
360. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
361. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
362. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
363. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
364. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
365. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
366. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
367. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
368. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
369. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
370. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
371. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
372. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
373. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
374. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
375. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
376. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
377. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
378. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
379. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
380. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
381. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
382. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
383. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
384. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
385. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
386. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
387. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
388. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
389. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
390. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
391. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
392. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
393. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
394. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
395. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
396. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
397. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
398. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
399. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
400. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
401. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
402. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
403. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
404. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
405. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
406. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
407. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
408. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
409. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
410. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
411. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
412. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
413. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
414. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
415. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
416. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
417. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
418. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
419. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
420. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
421. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
422. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
423. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
424. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
425. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
426. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
427. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
428. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
429. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
430. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
431. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
432. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
433. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
434. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
435. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
436. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
437. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
438. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
439. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
440. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
441. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
442. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
443. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
444. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
445. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
446. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
447. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
448. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
449. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
450. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
451. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
452. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
453. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
454. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
455. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
456. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
457. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
458. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
459. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
460. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
461. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
462. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
463. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
464. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
465. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
466. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
467. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
468. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
469. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
470. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
471. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
472. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
473. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
474. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
475. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
476. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
477. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
478. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
479. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
480. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
481. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
482. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
483. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
484. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
485. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
486. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
487. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
488. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
489. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
490. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
491. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
492. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
493. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
494. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
495. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
496. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
497. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
498. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
499. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
500. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
501. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
502. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
503. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
504. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
505. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
506. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
507. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
508. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
509. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
510. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
511. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
512. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
513. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
514. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
515. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
516. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
517. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
518. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
519. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
520. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
521. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
522. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
523. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
524. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
525. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
526. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
527. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
528. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
529. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
530. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
531. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
532. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
533. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
534. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
535. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
536. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
537. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
538. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
539. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
540. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
541. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
542. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
543. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
544. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
545. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
546. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
547. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
548. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
549. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
550. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
551. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
552. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
553. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
554. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
555. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
556. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
557. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
558. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
559. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
560. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
561. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
562. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
563. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
564. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
565. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
566. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
567. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
568. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
569. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
570. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
571. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
572. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
573. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
574. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
575. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
576. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
577. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
578. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
579. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
580. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
581. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
582. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
583. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
584. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
585. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
586. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
587. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
588. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
589. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
590. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
591. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
592. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
593. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
594. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
595. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
596. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
597. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
598. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
599. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
600. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
601. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
602. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
603. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
604. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
605. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
606. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
607. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
608. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
609. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
610. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
611. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
612. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
613. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
614. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
615. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
616. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
617. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
618. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
619. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
620. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
621. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
622. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
623. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
624. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
625. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
626. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
627. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
628. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
629. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
630. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
631. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
632. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
633. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
634. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
635. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
636. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
637. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
638. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
639. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
640. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
641. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
642. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
643. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
644. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
645. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
646. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
647. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
648. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
649. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
650. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
651. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
652. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
653. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
654. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
655. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
656. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
657. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
658. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
659. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
660. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
661. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
662. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
663. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
664. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
665. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
666. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
667. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
668. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
669. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
670. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
671. gbgen.idx - Index of the entries according to gene symbols.
672. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
673. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
674. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
675. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
676. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
677. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
678. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
679. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
680. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
681. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
682. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
683. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
684. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
685. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
686. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
687. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
688. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
689. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
690. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
691. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
692. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
693. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
694. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
695. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
696. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
697. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
698. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
699. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
700. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
701. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
702. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
703. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
704. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
705. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
706. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
707. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
708. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
709. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
710. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
711. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
712. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
713. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
714. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
715. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
716. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
717. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
718. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
719. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
720. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
721. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
722. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
723. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
724. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
725. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
726. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
727. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
728. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
729. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
730. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
731. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
732. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
733. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
734. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
735. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
736. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
737. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
738. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
739. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
740. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
741. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
742. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
743. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
744. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
745. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
746. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
747. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
748. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
749. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
750. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
751. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
752. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
753. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
754. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
755. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
756. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
757. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
758. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
759. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
760. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
761. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
762. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
763. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
764. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
765. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
766. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
767. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
768. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
769. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
770. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
771. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
772. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
773. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
774. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
775. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
776. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
777. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
778. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
779. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
780. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
781. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
782. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
783. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
784. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
785. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
786. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
787. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
788. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
789. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
790. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
791. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
792. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
793. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
794. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
795. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
796. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
797. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
798. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
799. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
800. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
801. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
802. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
803. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
804. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
805. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
806. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
807. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
808. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
809. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
810. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
811. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
812. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
813. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
814. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
815. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
816. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
817. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
818. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
819. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
820. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
821. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
822. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
823. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
824. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
825. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
826. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
827. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
828. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
829. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
830. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
831. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
832. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
833. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
834. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
835. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
836. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
837. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
838. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
839. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
840. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
841. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
842. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
843. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
844. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
845. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
846. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
847. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
848. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
849. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
850. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
851. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
852. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
853. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
854. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
855. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
856. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
857. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
858. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
859. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
860. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
861. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
862. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
863. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
864. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
865. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
866. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
867. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
868. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
869. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
870. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
871. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
872. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
873. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
874. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
875. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
876. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
877. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
878. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
879. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
880. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
881. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
882. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
883. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
884. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
885. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
886. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
887. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
888. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
889. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
890. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
891. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
892. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
893. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
894. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
895. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
896. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
897. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
898. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
899. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
900. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
901. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
902. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
903. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
904. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
905. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
906. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
907. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
908. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
909. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
910. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
911. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
912. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
913. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
914. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
915. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
916. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
917. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
918. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
919. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
920. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
921. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
922. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
923. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
924. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
925. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
926. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
927. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
928. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
929. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
930. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
931. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
932. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
933. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
934. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
935. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
936. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
937. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
938. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
939. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
940. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
941. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
942. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
943. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
944. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
945. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
946. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
947. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
948. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
949. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
950. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
951. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
952. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
953. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
954. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
955. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
956. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
957. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
958. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
959. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
960. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
961. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
962. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
963. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
964. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
965. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
966. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
967. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
968. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
969. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
970. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
971. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
972. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
973. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
974. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
975. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
976. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
977. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
978. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
979. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
980. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
981. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
982. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
983. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
984. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
985. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
986. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
987. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
988. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
989. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
990. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
991. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
992. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
993. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
994. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
995. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
996. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
997. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
998. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
999. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1000. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1001. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1002. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1003. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1004. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1005. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1006. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1007. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1008. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1009. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1010. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1011. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1012. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1013. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1014. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1015. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1016. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1017. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1018. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1019. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1020. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1021. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1022. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1023. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1024. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1025. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1026. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1027. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1028. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1029. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1030. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1031. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1032. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1033. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1034. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1035. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1036. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1037. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1038. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1039. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1040. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1041. gbinv1.seq - Invertebrate sequence entries, part 1.
1042. gbinv10.seq - Invertebrate sequence entries, part 10.
1043. gbinv2.seq - Invertebrate sequence entries, part 2.
1044. gbinv3.seq - Invertebrate sequence entries, part 3.
1045. gbinv4.seq - Invertebrate sequence entries, part 4.
1046. gbinv5.seq - Invertebrate sequence entries, part 5.
1047. gbinv6.seq - Invertebrate sequence entries, part 6.
1048. gbinv7.seq - Invertebrate sequence entries, part 7.
1049. gbinv8.seq - Invertebrate sequence entries, part 8.
1050. gbinv9.seq - Invertebrate sequence entries, part 9.
1051. gbjou1.idx - Index of the entries according to journal citation, part 1.
1052. gbjou2.idx - Index of the entries according to journal citation, part 2.
1053. gbjou3.idx - Index of the entries according to journal citation, part 3.
1054. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1055. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1056. gbmam1.seq - Other mammalian sequence entries, part 1.
1057. gbmam2.seq - Other mammalian sequence entries, part 2.
1058. gbmam3.seq - Other mammalian sequence entries, part 3.
1059. gbnew.txt - Accession numbers of entries new since the previous release.
1060. gbpat1.seq - Patent sequence entries, part 1.
1061. gbpat10.seq - Patent sequence entries, part 10.
1062. gbpat11.seq - Patent sequence entries, part 11.
1063. gbpat12.seq - Patent sequence entries, part 12.
1064. gbpat13.seq - Patent sequence entries, part 13.
1065. gbpat14.seq - Patent sequence entries, part 14.
1066. gbpat15.seq - Patent sequence entries, part 15.
1067. gbpat16.seq - Patent sequence entries, part 16.
1068. gbpat17.seq - Patent sequence entries, part 17.
1069. gbpat18.seq - Patent sequence entries, part 18.
1070. gbpat19.seq - Patent sequence entries, part 19.
1071. gbpat2.seq - Patent sequence entries, part 2.
1072. gbpat20.seq - Patent sequence entries, part 20.
1073. gbpat21.seq - Patent sequence entries, part 21.
1074. gbpat22.seq - Patent sequence entries, part 22.
1075. gbpat23.seq - Patent sequence entries, part 23.
1076. gbpat24.seq - Patent sequence entries, part 24.
1077. gbpat25.seq - Patent sequence entries, part 25.
1078. gbpat26.seq - Patent sequence entries, part 26.
1079. gbpat27.seq - Patent sequence entries, part 27.
1080. gbpat28.seq - Patent sequence entries, part 28.
1081. gbpat29.seq - Patent sequence entries, part 29.
1082. gbpat3.seq - Patent sequence entries, part 3.
1083. gbpat4.seq - Patent sequence entries, part 4.
1084. gbpat5.seq - Patent sequence entries, part 5.
1085. gbpat6.seq - Patent sequence entries, part 6.
1086. gbpat7.seq - Patent sequence entries, part 7.
1087. gbpat8.seq - Patent sequence entries, part 8.
1088. gbpat9.seq - Patent sequence entries, part 9.
1089. gbphg.seq - Phage sequence entries.
1090. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1091. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1092. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1093. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1094. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1095. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1096. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1097. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1098. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1099. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1100. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1101. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1102. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1103. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1104. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1105. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1106. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1107. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1108. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1109. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1110. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1111. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1112. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1113. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1114. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1115. gbpri1.seq - Primate sequence entries, part 1.
1116. gbpri10.seq - Primate sequence entries, part 10.
1117. gbpri11.seq - Primate sequence entries, part 11.
1118. gbpri12.seq - Primate sequence entries, part 12.
1119. gbpri13.seq - Primate sequence entries, part 13.
1120. gbpri14.seq - Primate sequence entries, part 14.
1121. gbpri15.seq - Primate sequence entries, part 15.
1122. gbpri16.seq - Primate sequence entries, part 16.
1123. gbpri17.seq - Primate sequence entries, part 17.
1124. gbpri18.seq - Primate sequence entries, part 18.
1125. gbpri19.seq - Primate sequence entries, part 19.
1126. gbpri2.seq - Primate sequence entries, part 2.
1127. gbpri20.seq - Primate sequence entries, part 20.
1128. gbpri21.seq - Primate sequence entries, part 21.
1129. gbpri22.seq - Primate sequence entries, part 22.
1130. gbpri23.seq - Primate sequence entries, part 23.
1131. gbpri24.seq - Primate sequence entries, part 24.
1132. gbpri25.seq - Primate sequence entries, part 25.
1133. gbpri26.seq - Primate sequence entries, part 26.
1134. gbpri27.seq - Primate sequence entries, part 27.
1135. gbpri28.seq - Primate sequence entries, part 28.
1136. gbpri29.seq - Primate sequence entries, part 29.
1137. gbpri3.seq - Primate sequence entries, part 3.
1138. gbpri30.seq - Primate sequence entries, part 30.
1139. gbpri31.seq - Primate sequence entries, part 31.
1140. gbpri32.seq - Primate sequence entries, part 32.
1141. gbpri33.seq - Primate sequence entries, part 33.
1142. gbpri4.seq - Primate sequence entries, part 4.
1143. gbpri5.seq - Primate sequence entries, part 5.
1144. gbpri6.seq - Primate sequence entries, part 6.
1145. gbpri7.seq - Primate sequence entries, part 7.
1146. gbpri8.seq - Primate sequence entries, part 8.
1147. gbpri9.seq - Primate sequence entries, part 9.
1148. gbrel.txt - Release notes (this document).
1149. gbrod1.seq - Rodent sequence entries, part 1.
1150. gbrod10.seq - Rodent sequence entries, part 10.
1151. gbrod11.seq - Rodent sequence entries, part 11.
1152. gbrod12.seq - Rodent sequence entries, part 12.
1153. gbrod13.seq - Rodent sequence entries, part 13.
1154. gbrod14.seq - Rodent sequence entries, part 14.
1155. gbrod15.seq - Rodent sequence entries, part 15.
1156. gbrod16.seq - Rodent sequence entries, part 16.
1157. gbrod17.seq - Rodent sequence entries, part 17.
1158. gbrod18.seq - Rodent sequence entries, part 18.
1159. gbrod19.seq - Rodent sequence entries, part 19.
1160. gbrod2.seq - Rodent sequence entries, part 2.
1161. gbrod20.seq - Rodent sequence entries, part 20.
1162. gbrod21.seq - Rodent sequence entries, part 21.
1163. gbrod22.seq - Rodent sequence entries, part 22.
1164. gbrod23.seq - Rodent sequence entries, part 23.
1165. gbrod24.seq - Rodent sequence entries, part 24.
1166. gbrod25.seq - Rodent sequence entries, part 25.
1167. gbrod3.seq - Rodent sequence entries, part 3.
1168. gbrod4.seq - Rodent sequence entries, part 4.
1169. gbrod5.seq - Rodent sequence entries, part 5.
1170. gbrod6.seq - Rodent sequence entries, part 6.
1171. gbrod7.seq - Rodent sequence entries, part 7.
1172. gbrod8.seq - Rodent sequence entries, part 8.
1173. gbrod9.seq - Rodent sequence entries, part 9.
1174. gbsdr1.txt - Short directory of the data bank, part 1.
1175. gbsdr2.txt - Short directory of the data bank, part 2.
1176. gbsdr3.txt - Short directory of the data bank, part 3.
1177. gbsec.idx - Index of the entries according to secondary accession number.
1178. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1179. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1180. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1181. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1182. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1183. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1184. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1185. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1186. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1187. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1188. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1189. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1190. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1191. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1192. gbsyn.seq - Synthetic and chimeric sequence entries.
1193. gbuna.seq - Unannotated sequence entries.
1194. gbvrl1.seq - Viral sequence entries, part 1.
1195. gbvrl2.seq - Viral sequence entries, part 2.
1196. gbvrl3.seq - Viral sequence entries, part 3.
1197. gbvrl4.seq - Viral sequence entries, part 4.
1198. gbvrl5.seq - Viral sequence entries, part 5.
1199. gbvrl6.seq - Viral sequence entries, part 6.
1200. gbvrl7.seq - Viral sequence entries, part 7.
1201. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1202. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1203. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1204. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1205. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1206. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1207. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1208. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1209. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1210. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1211. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1212. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1213. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 160.0 flatfiles require roughly 280 GB (sequence
files only) or 293 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 430959167     gbacc1.idx
1427415108     gbacc2.idx
 545339460     gbacc3.idx
 189144845     gbaut1.idx
 184221599     gbaut10.idx
 183345870     gbaut11.idx
 189391351     gbaut12.idx
 185785400     gbaut13.idx
 183414631     gbaut14.idx
 185457825     gbaut15.idx
 183994768     gbaut16.idx
 183317618     gbaut17.idx
 184865860     gbaut18.idx
 183539465     gbaut19.idx
 185633026     gbaut2.idx
 183705768     gbaut20.idx
  86474324     gbaut21.idx
 183458396     gbaut3.idx
 183500836     gbaut4.idx
 183853079     gbaut5.idx
 185579607     gbaut6.idx
 186484306     gbaut7.idx
 183537419     gbaut8.idx
 183700752     gbaut9.idx
 255906566     gbbct1.seq
 258048351     gbbct10.seq
 251238395     gbbct11.seq
 250528447     gbbct12.seq
 250181651     gbbct13.seq
 260156168     gbbct14.seq
 251577075     gbbct15.seq
 251316887     gbbct16.seq
 253728545     gbbct17.seq
 259885258     gbbct18.seq
 253253687     gbbct19.seq
 251668114     gbbct2.seq
 250000546     gbbct20.seq
 250002948     gbbct21.seq
 161898486     gbbct22.seq
 251991272     gbbct3.seq
 250004664     gbbct4.seq
 255760258     gbbct5.seq
 256957519     gbbct6.seq
 255272428     gbbct7.seq
 250000890     gbbct8.seq
 263987359     gbbct9.seq
   6293996     gbchg.txt
 311597264     gbcon1.seq
 221657823     gbcon2.seq
1325459171     gbcon3.seq
1589218719     gbcon4.seq
  20056249     gbcon5.seq
2966936754     gbcon6.seq
3092551793     gbcon7.seq
1564050782     gbcon8.seq
    147642     gbdel.txt
 250001721     gbenv1.seq
 250003012     gbenv2.seq
 250001632     gbenv3.seq
 250001927     gbenv4.seq
 170761339     gbenv5.seq
 230690048     gbest1.seq
 230690195     gbest10.seq
 230688016     gbest100.seq
 230690339     gbest101.seq
 230689667     gbest102.seq
 230689241     gbest103.seq
 230687582     gbest104.seq
 230689957     gbest105.seq
 230687721     gbest106.seq
 230689511     gbest107.seq
 230687670     gbest108.seq
 230689039     gbest109.seq
 230687653     gbest11.seq
 230688924     gbest110.seq
 230687577     gbest111.seq
 230688760     gbest112.seq
 230688283     gbest113.seq
 230690319     gbest114.seq
 230689824     gbest115.seq
 230689109     gbest116.seq
 230614424     gbest117.seq
 230689760     gbest118.seq
 230689329     gbest119.seq
 230690386     gbest12.seq
 230688039     gbest120.seq
 230688512     gbest121.seq
 230687660     gbest122.seq
 230687686     gbest123.seq
 230689561     gbest124.seq
 230690556     gbest125.seq
 230689571     gbest126.seq
 230688322     gbest127.seq
 230691098     gbest128.seq
 230689180     gbest129.seq
 230688027     gbest13.seq
 230690687     gbest130.seq
 230690255     gbest131.seq
 230689919     gbest132.seq
 230689372     gbest133.seq
 230690266     gbest134.seq
 230689450     gbest135.seq
 230690887     gbest136.seq
 230690996     gbest137.seq
 230690224     gbest138.seq
 230690348     gbest139.seq
 230689696     gbest14.seq
 230689942     gbest140.seq
 230689626     gbest141.seq
 230689607     gbest142.seq
 230688006     gbest143.seq
 230690378     gbest144.seq
 230688630     gbest145.seq
 230687949     gbest146.seq
 230688944     gbest147.seq
 230687889     gbest148.seq
 230688482     gbest149.seq
 230688265     gbest15.seq
 230689380     gbest150.seq
 230687568     gbest151.seq
 230691217     gbest152.seq
 230688234     gbest153.seq
 230688659     gbest154.seq
 230689987     gbest155.seq
 230690654     gbest156.seq
 230687871     gbest157.seq
 230688551     gbest158.seq
 230688460     gbest159.seq
 230689787     gbest16.seq
 230688189     gbest160.seq
 230688727     gbest161.seq
 230688697     gbest162.seq
 230691021     gbest163.seq
 230689709     gbest164.seq
 230688849     gbest165.seq
 230689216     gbest166.seq
 230688146     gbest167.seq
 230688870     gbest168.seq
 230689722     gbest169.seq
 230687935     gbest17.seq
 230689546     gbest170.seq
 230689685     gbest171.seq
 230689064     gbest172.seq
 230688139     gbest173.seq
 230687691     gbest174.seq
 230689463     gbest175.seq
 230687572     gbest176.seq
 230688675     gbest177.seq
 230687975     gbest178.seq
 229062025     gbest179.seq
 230688364     gbest18.seq
 230688504     gbest180.seq
 230689029     gbest181.seq
 230690309     gbest182.seq
 230690724     gbest183.seq
 230687621     gbest184.seq
 230689492     gbest185.seq
 230690825     gbest186.seq
 230689831     gbest187.seq
 230690027     gbest188.seq
 230689481     gbest189.seq
 230687676     gbest19.seq
 230691607     gbest190.seq
 230687668     gbest191.seq
 230688257     gbest192.seq
 230688775     gbest193.seq
 230690222     gbest194.seq
 230689579     gbest195.seq
 230690490     gbest196.seq
 230688729     gbest197.seq
 230689329     gbest198.seq
 230687917     gbest199.seq
 230690014     gbest2.seq
 230687609     gbest20.seq
 230688427     gbest200.seq
 230690380     gbest201.seq
 230688945     gbest202.seq
 230688764     gbest203.seq
 230689247     gbest204.seq
 230689404     gbest205.seq
 230690628     gbest206.seq
 230690603     gbest207.seq
 230688096     gbest208.seq
 230688432     gbest209.seq
 230687941     gbest21.seq
 230690777     gbest210.seq
 230687689     gbest211.seq
 230688616     gbest212.seq
 230689243     gbest213.seq
 230688755     gbest214.seq
 230689626     gbest215.seq
 230689114     gbest216.seq
 230689590     gbest217.seq
 230688075     gbest218.seq
 230688947     gbest219.seq
 230689319     gbest22.seq
 230688597     gbest220.seq
 230690058     gbest221.seq
 230690502     gbest222.seq
 230687943     gbest223.seq
 230688188     gbest224.seq
 230689054     gbest225.seq
 230689766     gbest226.seq
 230689719     gbest227.seq
 230689570     gbest228.seq
 198199816     gbest229.seq
 230689740     gbest23.seq
 162949484     gbest230.seq
 162899735     gbest231.seq
 170549511     gbest232.seq
 169262408     gbest233.seq
 165341087     gbest234.seq
 165329430     gbest235.seq
 164870426     gbest236.seq
 164174071     gbest237.seq
 164633440     gbest238.seq
 164205809     gbest239.seq
 230687893     gbest24.seq
 164381988     gbest240.seq
 163225280     gbest241.seq
 167902477     gbest242.seq
 163407182     gbest243.seq
 162459356     gbest244.seq
 166298648     gbest245.seq
 168126058     gbest246.seq
 166446234     gbest247.seq
 165724543     gbest248.seq
 165636278     gbest249.seq
 230689109     gbest25.seq
 165264906     gbest250.seq
 164448827     gbest251.seq
 164260118     gbest252.seq
 164858998     gbest253.seq
 165101558     gbest254.seq
 177361706     gbest255.seq
 174699464     gbest256.seq
 177882501     gbest257.seq
 230692768     gbest258.seq
 230688520     gbest259.seq
 230688851     gbest26.seq
 230689335     gbest260.seq
 230687532     gbest261.seq
 230687545     gbest262.seq
 230690308     gbest263.seq
 230687946     gbest264.seq
 230689289     gbest265.seq
 230689502     gbest266.seq
 230688221     gbest267.seq
 230691100     gbest268.seq
 230689285     gbest269.seq
 230687535     gbest27.seq
 230687534     gbest270.seq
 230690097     gbest271.seq
 230688306     gbest272.seq
 230689368     gbest273.seq
 230690606     gbest274.seq
 230689668     gbest275.seq
 230690072     gbest276.seq
 230690377     gbest277.seq
 230690834     gbest278.seq
 230690981     gbest279.seq
 230689194     gbest28.seq
 230688423     gbest280.seq
 230688288     gbest281.seq
 230688773     gbest282.seq
 230688262     gbest283.seq
 230689011     gbest284.seq
 230690072     gbest285.seq
 230689696     gbest286.seq
 230689233     gbest287.seq
 230690048     gbest288.seq
 209810888     gbest289.seq
 230689673     gbest29.seq
 230687963     gbest290.seq
 230687667     gbest291.seq
 230689210     gbest292.seq
 230690004     gbest293.seq
 230688481     gbest294.seq
 230689217     gbest295.seq
 230690216     gbest296.seq
 230688018     gbest297.seq
 230689558     gbest298.seq
 230689480     gbest299.seq
 230690086     gbest3.seq
 230688580     gbest30.seq
 230687993     gbest300.seq
 230687781     gbest301.seq
 230687902     gbest302.seq
 230689763     gbest303.seq
 230689645     gbest304.seq
 230689862     gbest305.seq
 230687737     gbest306.seq
 230688868     gbest307.seq
 230690646     gbest308.seq
 230688715     gbest309.seq
 230689237     gbest31.seq
 230687718     gbest310.seq
 230691760     gbest311.seq
 230691524     gbest312.seq
 230689489     gbest313.seq
 230689856     gbest314.seq
 230688573     gbest315.seq
 230690307     gbest316.seq
 230688315     gbest317.seq
 230687634     gbest318.seq
 230688757     gbest319.seq
 230689375     gbest32.seq
 230687510     gbest320.seq
 230688702     gbest321.seq
 230689487     gbest322.seq
 230688267     gbest323.seq
 230689962     gbest324.seq
 230690608     gbest325.seq
 230690731     gbest326.seq
 230689322     gbest327.seq
 230688774     gbest328.seq
 230688106     gbest329.seq
 230689881     gbest33.seq
 230688179     gbest330.seq
 230689241     gbest331.seq
 230688354     gbest332.seq
 230689055     gbest333.seq
 230689777     gbest334.seq
 230689175     gbest335.seq
 230688223     gbest336.seq
 230689488     gbest337.seq
 230687490     gbest338.seq
 230690489     gbest339.seq
 230690410     gbest34.seq
 230687900     gbest340.seq
 198306356     gbest341.seq
 230688409     gbest342.seq
 230687768     gbest343.seq
 230689752     gbest344.seq
 230691038     gbest345.seq
 230687572     gbest346.seq
 209011353     gbest347.seq
 142768401     gbest348.seq
 229635577     gbest349.seq
 230688694     gbest35.seq
 230687521     gbest350.seq
 230689536     gbest351.seq
 230689473     gbest352.seq
 230688551     gbest353.seq
 230690053     gbest354.seq
 230689584     gbest355.seq
 230687733     gbest356.seq
 230691171     gbest357.seq
 230689721     gbest358.seq
 230689690     gbest359.seq
 230689242     gbest36.seq
 230691590     gbest360.seq
 230692187     gbest361.seq
 230689214     gbest362.seq
 230690004     gbest363.seq
 230688202     gbest364.seq
 230687606     gbest365.seq
 230689024     gbest366.seq
 230687851     gbest367.seq
 230690232     gbest368.seq
 230688864     gbest369.seq
 230689933     gbest37.seq
 212269020     gbest370.seq
 230691482     gbest371.seq
 230690074     gbest372.seq
 230688700     gbest373.seq
 230691295     gbest374.seq
 230688835     gbest375.seq
 230688187     gbest376.seq
 230689041     gbest377.seq
 230688454     gbest378.seq
 230689396     gbest379.seq
 230688539     gbest38.seq
 230688304     gbest380.seq
 230691262     gbest381.seq
 230688500     gbest382.seq
 230690240     gbest383.seq
 230689517     gbest384.seq
 230687631     gbest385.seq
 230688944     gbest386.seq
 230690052     gbest387.seq
 230690193     gbest388.seq
 230688329     gbest389.seq
 230688453     gbest39.seq
 230690138     gbest390.seq
 230688016     gbest391.seq
 230694379     gbest392.seq
 230689198     gbest393.seq
 230688486     gbest394.seq
 230689562     gbest395.seq
 230689033     gbest396.seq
 226881673     gbest397.seq
 230691087     gbest398.seq
 230689858     gbest399.seq
 230690304     gbest4.seq
 230689913     gbest40.seq
 230688591     gbest400.seq
 230688844     gbest401.seq
 230688601     gbest402.seq
 230688719     gbest403.seq
 218866240     gbest404.seq
 230688906     gbest405.seq
 230688716     gbest406.seq
 230689040     gbest407.seq
 230689611     gbest408.seq
 230689273     gbest409.seq
 230688832     gbest41.seq
 230689350     gbest410.seq
 230688342     gbest411.seq
 230688897     gbest412.seq
 230690264     gbest413.seq
 230689069     gbest414.seq
 230689933     gbest415.seq
 230690388     gbest416.seq
 230687728     gbest417.seq
 230688068     gbest418.seq
 230690076     gbest419.seq
 230464428     gbest42.seq
 230688493     gbest420.seq
 230689563     gbest421.seq
 210638052     gbest422.seq
 210240817     gbest423.seq
 210113339     gbest424.seq
 210380161     gbest425.seq
 210313883     gbest426.seq
 210463714     gbest427.seq
 211165609     gbest428.seq
 211594282     gbest429.seq
 230688487     gbest43.seq
 211470879     gbest430.seq
 211707137     gbest431.seq
 213804293     gbest432.seq
 211531625     gbest433.seq
 210631869     gbest434.seq
 210725341     gbest435.seq
 210732429     gbest436.seq
 210180382     gbest437.seq
 210192857     gbest438.seq
 210208675     gbest439.seq
 210827016     gbest44.seq
 210155789     gbest440.seq
 216815109     gbest441.seq
 230688605     gbest442.seq
 230689375     gbest443.seq
 230688211     gbest444.seq
 230687519     gbest445.seq
 230689430     gbest446.seq
 230689928     gbest447.seq
 230688306     gbest448.seq
 230688811     gbest449.seq
 192182263     gbest45.seq
 230689513     gbest450.seq
 230689145     gbest451.seq
 230687798     gbest452.seq
 230689782     gbest453.seq
 230687458     gbest454.seq
 230689822     gbest455.seq
 230688911     gbest456.seq
 230691674     gbest457.seq
 230687538     gbest458.seq
 230688398     gbest459.seq
 195650964     gbest46.seq
 230697572     gbest460.seq
 230691186     gbest461.seq
 230689013     gbest462.seq
 230687740     gbest463.seq
 230689165     gbest464.seq
 230689159     gbest465.seq
 230689536     gbest466.seq
 230687550     gbest467.seq
 225335612     gbest468.seq
 230689353     gbest469.seq
 216512807     gbest47.seq
 230688641     gbest470.seq
 230688968     gbest471.seq
 230691661     gbest472.seq
 230689138     gbest473.seq
 230688886     gbest474.seq
 230689646     gbest475.seq
 230688570     gbest476.seq
 230687532     gbest477.seq
 230688930     gbest478.seq
 230688246     gbest479.seq
 216126590     gbest48.seq
 230687482     gbest480.seq
 230687850     gbest481.seq
 230689288     gbest482.seq
 230688086     gbest483.seq
 230690481     gbest484.seq
 230690772     gbest485.seq
 230688834     gbest486.seq
 230687465     gbest487.seq
 230687743     gbest488.seq
 230687946     gbest489.seq
 216170002     gbest49.seq
 230690419     gbest490.seq
 230689382     gbest491.seq
 230688442     gbest492.seq
 230687969     gbest493.seq
 230690026     gbest494.seq
 230689362     gbest495.seq
 230688600     gbest496.seq
 230689923     gbest497.seq
 230689495     gbest498.seq
 230690518     gbest499.seq
 164122838     gbest5.seq
 216815299     gbest50.seq
 230688881     gbest500.seq
 230687849     gbest501.seq
 230687700     gbest502.seq
 230688487     gbest503.seq
 230689523     gbest504.seq
 230689430     gbest505.seq
 230689250     gbest506.seq
 230688443     gbest507.seq
 230687723     gbest508.seq
 230023156     gbest509.seq
 230687928     gbest51.seq
 230687897     gbest510.seq
 230688774     gbest511.seq
 230689833     gbest512.seq
 230689329     gbest513.seq
 230689005     gbest514.seq
 230687973     gbest515.seq
 230688200     gbest516.seq
 230687447     gbest517.seq
 230688619     gbest518.seq
 230689967     gbest519.seq
 230688238     gbest52.seq
 230687463     gbest520.seq
 230689308     gbest521.seq
 230688762     gbest522.seq
 230689682     gbest523.seq
 196039670     gbest524.seq
 206200083     gbest525.seq
 230688964     gbest526.seq
 230687633     gbest527.seq
 230688601     gbest528.seq
 230688569     gbest529.seq
 230687583     gbest53.seq
 230688339     gbest530.seq
 230688096     gbest531.seq
 230688404     gbest532.seq
 230689135     gbest533.seq
 230690096     gbest534.seq
 230688864     gbest535.seq
 230687602     gbest536.seq
 230687784     gbest537.seq
 230687447     gbest538.seq
 222133714     gbest539.seq
 220093897     gbest54.seq
 230688701     gbest540.seq
 230688687     gbest541.seq
 230689118     gbest542.seq
 230687759     gbest543.seq
 230689011     gbest544.seq
 230688400     gbest545.seq
 218963182     gbest546.seq
 215182031     gbest547.seq
 230688713     gbest548.seq
 230689590     gbest549.seq
 230688762     gbest55.seq
 230689859     gbest550.seq
 230688842     gbest551.seq
 230689518     gbest552.seq
 230687935     gbest553.seq
 230689223     gbest554.seq
 230687622     gbest555.seq
 230690447     gbest556.seq
 230688102     gbest557.seq
 230687992     gbest558.seq
 230688016     gbest559.seq
 230688571     gbest56.seq
 230688686     gbest560.seq
 230687952     gbest561.seq
 230689637     gbest562.seq
 230689221     gbest563.seq
 230690706     gbest564.seq
 230689064     gbest565.seq
 230688624     gbest566.seq
 230690373     gbest567.seq
 230687538     gbest568.seq
 230689906     gbest569.seq
 230688933     gbest57.seq
 230688423     gbest570.seq
 230689810     gbest571.seq
 230687833     gbest572.seq
 230689018     gbest573.seq
 230689152     gbest574.seq
 230689654     gbest575.seq
 230687934     gbest576.seq
 217116414     gbest577.seq
 230688213     gbest578.seq
 230687469     gbest579.seq
 230688289     gbest58.seq
 230689796     gbest580.seq
 230691526     gbest581.seq
 230689564     gbest582.seq
 230689816     gbest583.seq
 230688963     gbest584.seq
 230688472     gbest585.seq
 230688966     gbest586.seq
 230688049     gbest587.seq
 230687600     gbest588.seq
 230688093     gbest589.seq
 230688080     gbest59.seq
 230687583     gbest590.seq
 230690893     gbest591.seq
 230689443     gbest592.seq
 230690201     gbest593.seq
 230687487     gbest594.seq
 230688169     gbest595.seq
 230689073     gbest596.seq
 230689261     gbest597.seq
 230690706     gbest598.seq
 230690114     gbest599.seq
 177441792     gbest6.seq
 230687821     gbest60.seq
 230687637     gbest600.seq
 230688429     gbest601.seq
 230688010     gbest602.seq
 230689374     gbest603.seq
 230688112     gbest604.seq
 230688434     gbest605.seq
 230688102     gbest606.seq
 220169768     gbest607.seq
 230688579     gbest608.seq
 215199976     gbest609.seq
 230688536     gbest61.seq
 230690431     gbest62.seq
 230689082     gbest63.seq
 230688348     gbest64.seq
 230688103     gbest65.seq
 230689243     gbest66.seq
 230690720     gbest67.seq
 230688087     gbest68.seq
 230689084     gbest69.seq
 230690089     gbest7.seq
 230689009     gbest70.seq
 209770460     gbest71.seq
 209388568     gbest72.seq
 208414699     gbest73.seq
 209211364     gbest74.seq
 209987510     gbest75.seq
 210041119     gbest76.seq
 208892145     gbest77.seq
 209132352     gbest78.seq
 210315036     gbest79.seq
 230688637     gbest8.seq
 207752047     gbest80.seq
 205713461     gbest81.seq
 208319863     gbest82.seq
 208544102     gbest83.seq
 212641093     gbest84.seq
 228833320     gbest85.seq
 230691892     gbest86.seq
 230690413     gbest87.seq
 218561432     gbest88.seq
 214838093     gbest89.seq
 230688601     gbest9.seq
 215603530     gbest90.seq
 230688809     gbest91.seq
 230688231     gbest92.seq
 230689733     gbest93.seq
 230691289     gbest94.seq
 230690355     gbest95.seq
 230689813     gbest96.seq
 230687465     gbest97.seq
 230687714     gbest98.seq
 230687982     gbest99.seq
  66062398     gbgen.idx
 230690046     gbgss1.seq
 230687925     gbgss10.seq
 230688445     gbgss100.seq
 227786605     gbgss101.seq
 228829791     gbgss102.seq
 228541384     gbgss103.seq
 228597325     gbgss104.seq
 227733862     gbgss105.seq
 230689646     gbgss106.seq
 230688150     gbgss107.seq
 230688910     gbgss108.seq
 230688150     gbgss109.seq
 230689943     gbgss11.seq
 230690384     gbgss110.seq
 230690069     gbgss111.seq
 230689457     gbgss112.seq
 230689061     gbgss113.seq
 230689955     gbgss114.seq
 230688893     gbgss115.seq
 230688819     gbgss116.seq
 230690330     gbgss117.seq
 230689250     gbgss118.seq
 230688772     gbgss119.seq
 230687579     gbgss12.seq
 230687866     gbgss120.seq
 230689807     gbgss121.seq
 230687734     gbgss122.seq
 230688099     gbgss123.seq
 230689318     gbgss124.seq
 230689116     gbgss125.seq
 230688957     gbgss126.seq
 230688846     gbgss127.seq
 230687637     gbgss128.seq
 230690468     gbgss129.seq
 230689530     gbgss13.seq
 230689957     gbgss130.seq
 230687712     gbgss131.seq
 230688944     gbgss132.seq
 230688650     gbgss133.seq
 230688572     gbgss134.seq
 230690138     gbgss135.seq
 230687778     gbgss136.seq
 230688568     gbgss137.seq
 230687971     gbgss138.seq
 230689251     gbgss139.seq
 230689493     gbgss14.seq
 230689665     gbgss140.seq
 230690062     gbgss141.seq
 230687548     gbgss142.seq
 230687564     gbgss143.seq
 230689407     gbgss144.seq
 224178699     gbgss145.seq
 230688539     gbgss146.seq
 230691085     gbgss147.seq
 211581040     gbgss148.seq
 230688916     gbgss149.seq
 230688454     gbgss15.seq
 230689467     gbgss150.seq
 230689047     gbgss151.seq
 230689453     gbgss152.seq
 230687895     gbgss153.seq
 230688940     gbgss154.seq
 230688990     gbgss155.seq
 230687743     gbgss156.seq
 230689016     gbgss157.seq
 230688832     gbgss158.seq
 230688964     gbgss159.seq
 230687986     gbgss16.seq
 230687901     gbgss160.seq
 230688834     gbgss161.seq
 230690139     gbgss162.seq
 230688162     gbgss163.seq
 230689378     gbgss164.seq
 230688559     gbgss165.seq
 230688435     gbgss166.seq
 230687532     gbgss167.seq
 230690744     gbgss168.seq
 230689376     gbgss169.seq
 230689511     gbgss17.seq
 213545714     gbgss170.seq
 207624609     gbgss171.seq
 210221044     gbgss172.seq
 210659198     gbgss173.seq
 209619708     gbgss174.seq
 209324700     gbgss175.seq
 207501723     gbgss176.seq
 207258269     gbgss177.seq
 207715364     gbgss178.seq
 209458106     gbgss179.seq
 230691286     gbgss18.seq
 209307168     gbgss180.seq
 208342832     gbgss181.seq
 205765441     gbgss182.seq
 205639826     gbgss183.seq
 205257716     gbgss184.seq
 205430367     gbgss185.seq
 205294494     gbgss186.seq
 206286978     gbgss187.seq
 207537255     gbgss188.seq
 208584550     gbgss189.seq
 230690261     gbgss19.seq
 207848646     gbgss190.seq
 208005129     gbgss191.seq
 208756042     gbgss192.seq
 208854483     gbgss193.seq
 208740653     gbgss194.seq
 205784904     gbgss195.seq
 206126873     gbgss196.seq
 206435204     gbgss197.seq
 205451088     gbgss198.seq
 206210873     gbgss199.seq
 230687913     gbgss2.seq
 230689570     gbgss20.seq
 207262078     gbgss200.seq
 207162940     gbgss201.seq
 207110808     gbgss202.seq
 207229333     gbgss203.seq
 207023043     gbgss204.seq
 207165452     gbgss205.seq
 206844608     gbgss206.seq
 206969184     gbgss207.seq
 206697880     gbgss208.seq
 207848901     gbgss209.seq
 230688600     gbgss21.seq
 207972186     gbgss210.seq
 209554011     gbgss211.seq
 210071819     gbgss212.seq
 209272321     gbgss213.seq
 210231129     gbgss214.seq
 218725528     gbgss215.seq
 218861105     gbgss216.seq
 230688987     gbgss217.seq
  49833128     gbgss218.seq
 250002921     gbgss219.seq
 230687685     gbgss22.seq
 250000726     gbgss220.seq
 250000067     gbgss221.seq
 250000345     gbgss222.seq
 250001954     gbgss223.seq
 250000662     gbgss224.seq
 250000835     gbgss225.seq
 250001947     gbgss226.seq
 250000440     gbgss227.seq
 250002587     gbgss228.seq
 250001247     gbgss229.seq
 230691328     gbgss23.seq
 250000988     gbgss230.seq
 250003034     gbgss231.seq
 250001796     gbgss232.seq
 250002813     gbgss233.seq
 250000528     gbgss234.seq
 250001729     gbgss235.seq
 250001718     gbgss236.seq
 250001651     gbgss237.seq
 250001847     gbgss238.seq
 250001833     gbgss239.seq
 230689939     gbgss24.seq
 250000039     gbgss240.seq
 250001551     gbgss241.seq
 250001718     gbgss242.seq
 250001617     gbgss243.seq
 250000286     gbgss244.seq
 250000240     gbgss245.seq
 250002081     gbgss246.seq
 250000744     gbgss247.seq
 250002611     gbgss248.seq
 250000064     gbgss249.seq
 230688652     gbgss25.seq
 250001728     gbgss250.seq
 250000263     gbgss251.seq
 250001074     gbgss252.seq
 250001289     gbgss253.seq
 250002350     gbgss254.seq
 250000992     gbgss255.seq
 250000825     gbgss256.seq
 250001859     gbgss257.seq
 250002263     gbgss258.seq
 250002310     gbgss259.seq
 230689524     gbgss26.seq
 250000683     gbgss260.seq
 196558575     gbgss261.seq
 230689394     gbgss27.seq
 230690602     gbgss28.seq
 230689077     gbgss29.seq
 230690350     gbgss3.seq
 230689461     gbgss30.seq
 230689369     gbgss31.seq
 230689720     gbgss32.seq
 230688735     gbgss33.seq
 230689415     gbgss34.seq
 230688931     gbgss35.seq
 230690008     gbgss36.seq
 230687666     gbgss37.seq
 230688429     gbgss38.seq
 230688370     gbgss39.seq
 230689545     gbgss4.seq
 230689378     gbgss40.seq
 230688250     gbgss41.seq
 230688405     gbgss42.seq
 230690577     gbgss43.seq
 230688619     gbgss44.seq
 230689232     gbgss45.seq
 230687556     gbgss46.seq
 230688349     gbgss47.seq
 230687454     gbgss48.seq
 230689175     gbgss49.seq
 230687819     gbgss5.seq
 230688335     gbgss50.seq
 230689117     gbgss51.seq
 230687711     gbgss52.seq
 230690407     gbgss53.seq
 230689490     gbgss54.seq
 230689065     gbgss55.seq
 230687668     gbgss56.seq
 230688562     gbgss57.seq
 230688048     gbgss58.seq
 230688918     gbgss59.seq
 230689999     gbgss6.seq
 230689975     gbgss60.seq
 228993415     gbgss61.seq
 230688778     gbgss62.seq
 230687511     gbgss63.seq
 230687607     gbgss64.seq
 230688416     gbgss65.seq
 230690049     gbgss66.seq
 230687913     gbgss67.seq
 230688471     gbgss68.seq
 230689660     gbgss69.seq
 230687516     gbgss7.seq
 230688367     gbgss70.seq
 230687760     gbgss71.seq
 230688936     gbgss72.seq
 230688026     gbgss73.seq
 230688352     gbgss74.seq
 230688700     gbgss75.seq
 230687803     gbgss76.seq
 230688996     gbgss77.seq
 230689069     gbgss78.seq
 230688537     gbgss79.seq
 230688381     gbgss8.seq
 230689811     gbgss80.seq
 225572717     gbgss81.seq
 194168522     gbgss82.seq
 194316499     gbgss83.seq
 230690064     gbgss84.seq
 230688640     gbgss85.seq
 230687954     gbgss86.seq
 230688550     gbgss87.seq
 230687633     gbgss88.seq
 230687671     gbgss89.seq
 230688662     gbgss9.seq
 230688153     gbgss90.seq
 230690534     gbgss91.seq
 230687474     gbgss92.seq
 230687718     gbgss93.seq
 230689584     gbgss94.seq
 230690041     gbgss95.seq
 230688128     gbgss96.seq
 230687726     gbgss97.seq
 230688347     gbgss98.seq
 230689824     gbgss99.seq
 250005766     gbhtc1.seq
 250002144     gbhtc10.seq
 250001683     gbhtc11.seq
 114514639     gbhtc12.seq
 250008813     gbhtc2.seq
 250006065     gbhtc3.seq
 250002501     gbhtc4.seq
 250004560     gbhtc5.seq
 250004815     gbhtc6.seq
 250003568     gbhtc7.seq
 250001109     gbhtc8.seq
 250001625     gbhtc9.seq
 250096230     gbhtg1.seq
 250059721     gbhtg10.seq
 250131065     gbhtg11.seq
 250063943     gbhtg12.seq
 250231890     gbhtg13.seq
 250295338     gbhtg14.seq
 250228000     gbhtg15.seq
 250068670     gbhtg16.seq
 250215574     gbhtg17.seq
 250140995     gbhtg18.seq
 250157426     gbhtg19.seq
 250020783     gbhtg2.seq
 250008648     gbhtg20.seq
 250296874     gbhtg21.seq
 250298094     gbhtg22.seq
 250035445     gbhtg23.seq
 250154108     gbhtg24.seq
 250245674     gbhtg25.seq
 250060934     gbhtg26.seq
 250053522     gbhtg27.seq
 250279943     gbhtg28.seq
 250050062     gbhtg29.seq
 250039036     gbhtg3.seq
 250180400     gbhtg30.seq
 250047555     gbhtg31.seq
 250262952     gbhtg32.seq
 250053616     gbhtg33.seq
 250328397     gbhtg34.seq
 250157248     gbhtg35.seq
 250031649     gbhtg36.seq
 250211515     gbhtg37.seq
 250160956     gbhtg38.seq
 250064366     gbhtg39.seq
 250101893     gbhtg4.seq
 250106003     gbhtg40.seq
 250059693     gbhtg41.seq
 250219196     gbhtg42.seq
 250025671     gbhtg43.seq
 250145071     gbhtg44.seq
 250048740     gbhtg45.seq
 250213105     gbhtg46.seq
 250088633     gbhtg47.seq
 250064530     gbhtg48.seq
 250109131     gbhtg49.seq
 250209184     gbhtg5.seq
 250206348     gbhtg50.seq
 250007482     gbhtg51.seq
 250020313     gbhtg52.seq
 250145532     gbhtg53.seq
 250293746     gbhtg54.seq
 250035074     gbhtg55.seq
 250137447     gbhtg56.seq
 250156241     gbhtg57.seq
 250120324     gbhtg58.seq
 250050927     gbhtg59.seq
 250053401     gbhtg6.seq
 250240214     gbhtg60.seq
 250275678     gbhtg61.seq
 250046467     gbhtg62.seq
 250204453     gbhtg63.seq
 250216781     gbhtg64.seq
 250099587     gbhtg65.seq
 250158087     gbhtg66.seq
 250015061     gbhtg67.seq
 250146166     gbhtg68.seq
 250183263     gbhtg69.seq
 250004218     gbhtg7.seq
 250001384     gbhtg70.seq
 250009304     gbhtg71.seq
 250142709     gbhtg72.seq
 250144130     gbhtg73.seq
 250069579     gbhtg74.seq
 250092368     gbhtg75.seq
 250192196     gbhtg76.seq
 250155352     gbhtg77.seq
 250087971     gbhtg78.seq
 250025457     gbhtg79.seq
 250124022     gbhtg8.seq
 250111682     gbhtg80.seq
 250024292     gbhtg81.seq
 250067408     gbhtg82.seq
 250136086     gbhtg83.seq
 250232901     gbhtg84.seq
 250214338     gbhtg85.seq
 250011909     gbhtg86.seq
 250299094     gbhtg87.seq
 250009713     gbhtg88.seq
 250301890     gbhtg89.seq
 250009913     gbhtg9.seq
 250015835     gbhtg90.seq
 250225224     gbhtg91.seq
 250082256     gbhtg92.seq
 250122833     gbhtg93.seq
 250034026     gbhtg94.seq
 250171525     gbhtg95.seq
  67098525     gbhtg96.seq
 250323496     gbinv1.seq
 206376441     gbinv10.seq
 279937828     gbinv2.seq
 250001342     gbinv3.seq
 250000221     gbinv4.seq
 251010356     gbinv5.seq
 250001815     gbinv6.seq
 250001050     gbinv7.seq
 250002027     gbinv8.seq
 250000733     gbinv9.seq
 166726898     gbjou1.idx
 292387896     gbjou2.idx
  47626924     gbjou3.idx
 182877630     gbkey1.idx
  97209856     gbkey2.idx
 250002465     gbmam1.seq
 250099297     gbmam2.seq
 195694940     gbmam3.seq
  20267799     gbnew.txt
 250000101     gbpat1.seq
 250004996     gbpat10.seq
 250000197     gbpat11.seq
 250000359     gbpat12.seq
 250000649     gbpat13.seq
 250000440     gbpat14.seq
 250000617     gbpat15.seq
 250000300     gbpat16.seq
 250003588     gbpat17.seq
 250001862     gbpat18.seq
 250002929     gbpat19.seq
 250000202     gbpat2.seq
 250001659     gbpat20.seq
 250001375     gbpat21.seq
 250143409     gbpat22.seq
 250001105     gbpat23.seq
 250002239     gbpat24.seq
 250001215     gbpat25.seq
 256106879     gbpat26.seq
 250000237     gbpat27.seq
 250003013     gbpat28.seq
  14958841     gbpat29.seq
 250003351     gbpat3.seq
 250002404     gbpat4.seq
 250000082     gbpat5.seq
 250000256     gbpat6.seq
 250001296     gbpat7.seq
 250000377     gbpat8.seq
 250000958     gbpat9.seq
  58817332     gbphg.seq
 250093886     gbpln1.seq
 250015599     gbpln10.seq
 250001548     gbpln11.seq
 250009369     gbpln12.seq
 250124454     gbpln13.seq
 250044924     gbpln14.seq
 260041268     gbpln15.seq
 256259063     gbpln16.seq
 250093740     gbpln17.seq
 250000336     gbpln18.seq
 250001398     gbpln19.seq
 250208646     gbpln2.seq
 250004067     gbpln20.seq
 250063810     gbpln21.seq
 250002821     gbpln22.seq
 250002411     gbpln23.seq
 250001704     gbpln24.seq
 200421238     gbpln25.seq
 250047956     gbpln3.seq
 250002110     gbpln4.seq
 250001488     gbpln5.seq
 250001651     gbpln6.seq
 250008130     gbpln7.seq
 250134565     gbpln8.seq
 250000661     gbpln9.seq
 250016311     gbpri1.seq
 250037794     gbpri10.seq
 250160887     gbpri11.seq
 250036135     gbpri12.seq
 250135180     gbpri13.seq
 250293170     gbpri14.seq
 250012325     gbpri15.seq
 250243231     gbpri16.seq
 250025293     gbpri17.seq
 250294995     gbpri18.seq
 250009068     gbpri19.seq
 250184945     gbpri2.seq
 250005278     gbpri20.seq
 250102157     gbpri21.seq
 250163260     gbpri22.seq
 250103802     gbpri23.seq
 250102007     gbpri24.seq
 250040094     gbpri25.seq
 250306746     gbpri26.seq
 250051642     gbpri27.seq
 250007981     gbpri28.seq
 250000240     gbpri29.seq
 250091155     gbpri3.seq
 250129361     gbpri30.seq
 250001162     gbpri31.seq
 250002942     gbpri32.seq
 135254016     gbpri33.seq
 250155918     gbpri4.seq
 250140948     gbpri5.seq
 250212697     gbpri6.seq
 250081363     gbpri7.seq
 250014883     gbpri8.seq
 250173883     gbpri9.seq
    261290     gbrel.txt
 250172007     gbrod1.seq
 250002015     gbrod10.seq
 250186367     gbrod11.seq
 250185261     gbrod12.seq
 250149962     gbrod13.seq
 250250782     gbrod14.seq
 250074248     gbrod15.seq
 250221389     gbrod16.seq
 250007704     gbrod17.seq
 250023187     gbrod18.seq
 250173104     gbrod19.seq
 250042334     gbrod2.seq
 250097801     gbrod20.seq
 250003753     gbrod21.seq
 250000597     gbrod22.seq
 250151497     gbrod23.seq
 250000002     gbrod24.seq
 230937536     gbrod25.seq
 250047382     gbrod3.seq
 250181559     gbrod4.seq
 250123719     gbrod5.seq
 250222731     gbrod6.seq
 250023945     gbrod7.seq
 250172846     gbrod8.seq
 250117246     gbrod9.seq
 739115955     gbsdr1.txt
3470477590     gbsdr2.txt
1636734994     gbsdr3.txt
   1397176     gbsec.idx
 250001679     gbsts1.seq
 250003545     gbsts10.seq
 250001831     gbsts11.seq
 250000863     gbsts12.seq
 250001731     gbsts13.seq
 174007151     gbsts14.seq
 250001037     gbsts2.seq
 250001378     gbsts3.seq
 250003600     gbsts4.seq
 250000982     gbsts5.seq
 250003096     gbsts6.seq
 250001347     gbsts7.seq
 250000351     gbsts8.seq
 250003375     gbsts9.seq
 242012902     gbsyn.seq
    422714     gbuna.seq
 250001113     gbvrl1.seq
 250002460     gbvrl2.seq
 250000039     gbvrl3.seq
 250003586     gbvrl4.seq
 250011380     gbvrl5.seq
 250001837     gbvrl6.seq
 202794846     gbvrl7.seq
 250033390     gbvrt1.seq
 250005551     gbvrt10.seq
 250065043     gbvrt11.seq
 250000722     gbvrt12.seq
 249789454     gbvrt13.seq
 250011802     gbvrt2.seq
 250058486     gbvrt3.seq
 250001144     gbvrt4.seq
 250002631     gbvrt5.seq
 250135105     gbvrt6.seq
 250011000     gbvrt7.seq
 250094013     gbvrt8.seq
 250039146     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:

Division     Entries    Bases

BCT1         29567      104400486
BCT10        219        97539273
BCT11        73         110923246
BCT12        48         111626856
BCT13        50         113942523
BCT14        61         120730072
BCT15        67         113445468
BCT16        42         111498586
BCT17        54         110578048
BCT18        62         114214463
BCT19        86         111514381
BCT2         4306       109307157
BCT20        23020      96816021
BCT21        70721      83276321
BCT22        26101      60303948
BCT3         160        112232466
BCT4         23043      104071134
BCT5         54354      87491468
BCT6         5397       98481616
BCT7         11617      104673699
BCT8         50484      92345446
BCT9         18946      114282954
ENV1         91100      71117104
ENV2         95327      73419306
ENV3         84984      84579060
ENV4         90281      85608830
ENV5         58095      55465730
EST1         68126      26289737
EST10        76542      29845947
EST100       71620      36569914
EST101       74052      37687918
EST102       73097      39255461
EST103       74653      40682771
EST104       70151      40171319
EST105       68921      36332839
EST106       73047      36351371
EST107       72326      45671320
EST108       72964      45296071
EST109       69405      42551945
EST11        75113      28770746
EST110       72504      33281542
EST111       69685      29562377
EST112       67375      38251261
EST113       68360      36069575
EST114       68342      42526980
EST115       72779      35621250
EST116       75053      34698805
EST117       74549      27207815
EST118       73603      35732710
EST119       74464      34735671
EST12        77630      30773407
EST120       64565      37662987
EST121       80536      44467237
EST122       77725      43873624
EST123       68549      47069188
EST124       67590      40649386
EST125       74435      50586222
EST126       69210      41886265
EST127       75125      44716496
EST128       73301      45675742
EST129       71784      49436314
EST13        77022      29275477
EST130       72433      47864299
EST131       78870      43243568
EST132       75562      31170163
EST133       78204      34715820
EST134       79179      45773906
EST135       74849      43850500
EST136       64213      33553470
EST137       70389      36661067
EST138       68503      38205513
EST139       65658      36605134
EST14        78503      31799444
EST140       71880      42753481
EST141       72603      46558226
EST142       68122      39420727
EST143       69673      39056043
EST144       72690      44757878
EST145       67391      39387310
EST146       64723      37114454
EST147       99281      53994220
EST148       77262      44065238
EST149       85998      44878793
EST15        74666      31555641
EST150       104469     55516536
EST151       105008     56990450
EST152       97203      55704033
EST153       75758      45198316
EST154       93427      55762810
EST155       97811      58761632
EST156       91869      54084030
EST157       77723      45132786
EST158       68848      37150429
EST159       65659      29746016
EST16        75789      33335854
EST160       60116      27857411
EST161       56394      27473988
EST162       64490      31342357
EST163       54293      27273001
EST164       80160      54231530
EST165       68095      36374877
EST166       72203      52636078
EST167       71820      40852590
EST168       60517      30351973
EST169       63849      38188104
EST17        82292      33971583
EST170       65875      32466277
EST171       63341      45875777
EST172       64160      36885298
EST173       104115     46040657
EST174       87830      52092350
EST175       99114      57401978
EST176       101837     57083374
EST177       96654      51987982
EST178       80186      37999235
EST179       92361      40315440
EST18        80898      32232516
EST180       94517      49520324
EST181       89443      34742314
EST182       94726      43011020
EST183       63879      42425711
EST184       68601      37350932
EST185       59848      35244633
EST186       69863      44682958
EST187       70657      29341384
EST188       76371      36480198
EST189       69552      41360619
EST19        78520      31851339
EST190       75953      37671555
EST191       66388      34722394
EST192       69191      49330165
EST193       68092      45838982
EST194       68426      35181425
EST195       68674      45077808
EST196       68955      52669624
EST197       69107      36142940
EST198       70781      42694990
EST199       70272      60868732
EST2         74651      28647346
EST20        74704      30615493
EST200       64546      46924272
EST201       63661      46505865
EST202       63235      46876284
EST203       65244      45220750
EST204       65767      49320391
EST205       62288      42765291
EST206       63281      37827299
EST207       62924      34746689
EST208       66791      38535560
EST209       81974      47947840
EST21        73721      34309621
EST210       83450      53753731
EST211       73542      42816076
EST212       106423     66374460
EST213       108843     65304080
EST214       108676     64447494
EST215       103305     66850413
EST216       107635     57837820
EST217       104712     50564411
EST218       85484      52153826
EST219       92613      41303321
EST22        75379      30237628
EST220       88544      45323200
EST221       73373      48023459
EST222       66893      42256063
EST223       68514      57814755
EST224       68056      58992573
EST225       78984      41329244
EST226       80964      44925319
EST227       74733      52775369
EST228       70889      51962486
EST229       46564      25853795
EST23        77315      32640072
EST230       27767      10564416
EST231       27747      10276149
EST232       26437      9821921
EST233       26717      9074478
EST234       27383      9531041
EST235       27185      10180222
EST236       27175      9751342
EST237       27306      10180850
EST238       27126      12013277
EST239       27210      11266559
EST24        74816      32914705
EST240       27276      10280669
EST241       27583      9361236
EST242       26890      9126462
EST243       27667      11190355
EST244       27830      10772479
EST245       27188      11263673
EST246       26628      12036888
EST247       26986      11299135
EST248       27070      10797843
EST249       26994      11537624
EST25        73840      31767236
EST250       27119      11539495
EST251       27264      11263097
EST252       27267      10807282
EST253       27199      10637146
EST254       27169      10747681
EST255       25002      16684953
EST256       25410      16854017
EST257       36383      18817558
EST258       93339      43675704
EST259       43449      28496735
EST26        75387      31162894
EST260       106433     40323067
EST261       71123      40078391
EST262       68728      44459143
EST263       69329      44588350
EST264       69098      44440449
EST265       66557      39009018
EST266       75305      43680163
EST267       64325      47476133
EST268       65139      34753626
EST269       74463      37098363
EST27        74660      32519961
EST270       101822     47430266
EST271       76546      42909739
EST272       67549      34317493
EST273       67491      32676263
EST274       70439      42142242
EST275       72349      34629745
EST276       68728      33326119
EST277       75562      48456165
EST278       63645      33812474
EST279       68027      38799796
EST28        108051     51190416
EST280       79663      41014628
EST281       77541      43519951
EST282       75871      50381497
EST283       78309      54768466
EST284       107666     48980803
EST285       87457      43650655
EST286       74536      44586297
EST287       72651      41719758
EST288       72321      37477242
EST289       70513      28849360
EST29        97057      46019042
EST290       70838      38431654
EST291       62382      34977785
EST292       62935      41705698
EST293       71991      41246050
EST294       62078      44719683
EST295       61646      32295760
EST296       83099      42934055
EST297       84269      41002022
EST298       74543      48728444
EST299       103905     57811709
EST3         73738      29918375
EST30        98398      53792062
EST300       122890     46946233
EST301       78280      38104030
EST302       67085      35155568
EST303       70119      46234902
EST304       80825      40868243
EST305       71641      41529666
EST306       71118      40660446
EST307       60451      34438946
EST308       60414      37080968
EST309       57142      33541552
EST31        83822      48471566
EST310       71158      49936768
EST311       72300      43861703
EST312       71670      41793454
EST313       71597      36712418
EST314       60671      32039702
EST315       53905      27280650
EST316       52911      27876706
EST317       53046      28404001
EST318       51901      27053794
EST319       53468      27293821
EST32        65516      46331286
EST320       55756      24093541
EST321       55438      23596177
EST322       54369      22288890
EST323       55536      21479625
EST324       54871      21973461
EST325       56317      22517436
EST326       54877      21492258
EST327       56167      20124051
EST328       63306      32144162
EST329       76451      37306629
EST33        72826      54940113
EST330       74485      33940628
EST331       76847      32281580
EST332       74435      31076639
EST333       94582      61058919
EST334       67704      54122671
EST335       91970      55406439
EST336       93205      55654126
EST337       95985      57498734
EST338       101550     54687827
EST339       96769      55388271
EST34        85425      48187796
EST340       64131      36963090
EST341       74154      35990816
EST342       64857      50301870
EST343       64724      49357310
EST344       59919      45812411
EST345       62709      37076890
EST346       69399      42458804
EST347       66845      42751755
EST348       48071      23740612
EST349       67867      35515353
EST35        86489      44024280
EST350       67494      36624420
EST351       60012      29361050
EST352       65622      41921151
EST353       77108      45189799
EST354       76987      40487235
EST355       63626      37129020
EST356       75234      44603325
EST357       65886      44392545
EST358       75407      44534467
EST359       84761      49491739
EST36        95103      51890453
EST360       89478      48648854
EST361       61755      32448838
EST362       64290      40372289
EST363       75779      36915503
EST364       50581      28053222
EST365       59575      32443107
EST366       70326      40497033
EST367       88995      47427221
EST368       86928      43968528
EST369       70015      46975171
EST37        83244      58645355
EST370       65844      46454736
EST371       69446      38645747
EST372       57472      33629488
EST373       95197      39231751
EST374       59942      38295095
EST375       53754      39180291
EST376       62534      35376081
EST377       77968      49261326
EST378       97716      54062890
EST379       65841      39115524
EST38        78479      54576415
EST380       82760      45861234
EST381       57548      33546412
EST382       40724      23337691
EST383       56284      33309843
EST384       82770      48882442
EST385       79743      45597863
EST386       73563      44052581
EST387       78824      46955551
EST388       77037      48749744
EST389       83818      58501669
EST39        88229      52532502
EST390       80464      68262498
EST391       77619      58535260
EST392       71318      40352396
EST393       59739      38893594
EST394       74851      40019482
EST395       52657      32840033
EST396       77513      30731664
EST397       80580      28305144
EST398       70072      44361562
EST399       64494      36945342
EST4         74567      28390970
EST40        63430      49983687
EST400       68298      35415423
EST401       70701      42134945
EST402       69017      45910860
EST403       66278      44887004
EST404       75443      44110647
EST405       58855      32880430
EST406       61572      37870998
EST407       80457      51546489
EST408       83476      48314541
EST409       77977      44271287
EST41        94039      46099919
EST410       58944      41050748
EST411       56784      40968927
EST412       57335      40519557
EST413       61399      38859748
EST414       78383      48323704
EST415       48984      30727822
EST416       64536      39892094
EST417       57867      40233028
EST418       60947      41165657
EST419       56315      42124692
EST42        87543      46085576
EST420       47348      33571632
EST421       89981      42131461
EST422       69396      38623779
EST423       69709      38322501
EST424       69861      38229864
EST425       69578      38744750
EST426       69602      38550471
EST427       69525      38769604
EST428       69009      38317008
EST429       68996      38255717
EST43        104824     46813017
EST430       69020      39257020
EST431       68560      38077686
EST432       67363      38240759
EST433       69297      39130406
EST434       69409      38101992
EST435       69434      38607208
EST436       69437      37897273
EST437       69832      38241965
EST438       69759      38298821
EST439       69727      38275576
EST44        79494      29468514
EST440       69895      37662712
EST441       77857      42389076
EST442       87631      48734628
EST443       79893      35625341
EST444       99853      57476229
EST445       80479      45482331
EST446       78153      48884867
EST447       88383      55716244
EST448       95361      58420381
EST449       76548      45158250
EST45        68734      18358086
EST450       87232      47922132
EST451       83253      46345607
EST452       52272      40185027
EST453       56425      43331652
EST454       74951      42252340
EST455       54318      32994558
EST456       92649      49999780
EST457       107176     58115975
EST458       76220      48249476
EST459       78742      55610793
EST46        72769      19827131
EST460       36948      20089722
EST461       52035      57354524
EST462       48534      57785397
EST463       75155      50118882
EST464       67313      39214701
EST465       74171      42350913
EST466       67714      42147021
EST467       69671      42895524
EST468       60279      52501620
EST469       89062      43714565
EST47        54465      16630875
EST470       109097     48021175
EST471       76956      52866975
EST472       59799      39244546
EST473       57470      41108480
EST474       58776      39278916
EST475       65896      50541358
EST476       63104      44922731
EST477       60973      42171841
EST478       51806      38344043
EST479       56732      38518729
EST48        43742      11910000
EST480       55793      41594181
EST481       68655      37430771
EST482       66353      44130850
EST483       57131      38069380
EST484       61579      42485168
EST485       58449      45728423
EST486       65152      48704213
EST487       63297      41817460
EST488       53448      40851977
EST489       54594      36589569
EST49        43209      11948017
EST490       53102      36296163
EST491       59551      38912078
EST492       67053      39921000
EST493       65201      44755647
EST494       74050      60990378
EST495       73701      50198796
EST496       61535      52624444
EST497       47971      56024636
EST498       60809      52103082
EST499       63939      40841818
EST5         48195      15294033
EST50        43185      11380614
EST500       66936      38290504
EST501       81821      50915467
EST502       81565      54414877
EST503       78015      47612448
EST504       65728      40986950
EST505       67275      41192336
EST506       75984      51559524
EST507       81342      48192623
EST508       75443      63532910
EST509       73472      48649838
EST51        86634      36705518
EST510       68551      48440826
EST511       67603      51997030
EST512       62698      45489752
EST513       62892      45516525
EST514       87825      46034683
EST515       88371      42984029
EST516       122112     40397489
EST517       90667      56498377
EST518       63467      51353362
EST519       50727      50131835
EST52        92390      38251475
EST520       85273      29225627
EST521       99640      11156369
EST522       99716      11031401
EST523       95813      39746194
EST524       87001      31668654
EST525       87195      33843476
EST526       64408      55695798
EST527       80345      56216487
EST528       87152      50636515
EST529       72970      41203769
EST53        94526      42341538
EST530       72037      52367280
EST531       71569      43912458
EST532       86467      54601482
EST533       75637      48519915
EST534       73382      53823350
EST535       65481      48516149
EST536       79888      57899410
EST537       90392      46238382
EST538       82688      47584048
EST539       83234      39637198
EST54        88373      46600420
EST540       75156      40786268
EST541       86091      53092079
EST542       75717      52378007
EST543       70850      53042221
EST544       72710      41836120
EST545       97757      49813591
EST546       112709     46864420
EST547       111122     48520944
EST548       131300     59036946
EST549       111609     54411929
EST55        88045      39707904
EST550       77010      55391852
EST551       84553      25261985
EST552       84292      8741880
EST553       108192     49123772
EST554       128115     62556053
EST555       85151      47236105
EST556       65032      42199789
EST557       72105      46040126
EST558       78346      51985212
EST559       72015      46171920
EST56        104577     54784126
EST560       77913      45318679
EST561       66723      51384287
EST562       83399      54516053
EST563       67455      42371219
EST564       62495      45919038
EST565       93200      58185586
EST566       91653      53810878
EST567       75277      43089450
EST568       82139      41465846
EST569       88844      47480737
EST57        96472      47914384
EST570       87736      47819579
EST571       68420      50321274
EST572       82549      56906990
EST573       89927      55086203
EST574       84951      57062039
EST575       78569      47338742
EST576       76797      38706364
EST577       70074      48703420
EST578       61817      38611122
EST579       90610      26206799
EST58        77086      33228702
EST580       76274      44993697
EST581       50591      33415805
EST582       51413      32549876
EST583       50425      35860490
EST584       74540      49312350
EST585       69110      49717260
EST586       96512      30936764
EST587       122591     11125353
EST588       118234     14519090
EST589       122483     11289585
EST59        67100      29337769
EST590       121657     11919405
EST591       69337      49729685
EST592       67269      52305926
EST593       76723      54115478
EST594       69673      48897774
EST595       73760      44667741
EST596       67476      43895086
EST597       66737      42684611
EST598       77844      39359482
EST599       76582      44776889
EST6         54921      17444496
EST60        73061      32181446
EST600       63806      57140824
EST601       85796      48297790
EST602       78517      37475606
EST603       71158      25629067
EST604       72190      26999487
EST605       73429      26101745
EST606       72068      26104634
EST607       77303      26017315
EST608       71432      28931646
EST609       69855      26295017
EST61        69569      29335923
EST62        82291      33072451
EST63        74545      29909100
EST64        68979      28094898
EST65        66005      29392237
EST66        76357      35544908
EST67        74298      32882446
EST68        74879      28515347
EST69        77627      28384042
EST7         74545      29358198
EST70        81409      37673935
EST71        40532      11649606
EST72        40430      11036116
EST73        40407      12533230
EST74        40789      12683081
EST75        40856      12314808
EST76        40725      12899287
EST77        40598      12793822
EST78        40466      12137595
EST79        40166      12104532
EST8         75833      30592306
EST80        41021      12671434
EST81        41324      11881597
EST82        41031      13054531
EST83        40848      13062778
EST84        42707      12735930
EST85        46223      18122571
EST86        42506      26652207
EST87        42423      18940136
EST88        48863      20093205
EST89        50688      21861624
EST9         77569      29868098
EST90        50429      21732527
EST91        83799      49422287
EST92        77206      37759004
EST93        73322      28068866
EST94        74116      29098186
EST95        74942      41299249
EST96        77286      40694533
EST97        76253      43524906
EST98        76260      34990800
EST99        74382      43258942
GSS1         90402      38650542
GSS10        74873      43594696
GSS100       80664      51903963
GSS101       74567      42664327
GSS102       73358      45723102
GSS103       73691      44884337
GSS104       73270      45649406
GSS105       73258      44839955
GSS106       75266      45640861
GSS107       81312      54661078
GSS108       83844      55515226
GSS109       80877      52549610
GSS11        70608      35929964
GSS110       82482      50218185
GSS111       84199      57805831
GSS112       80139      59814121
GSS113       90981      46136505
GSS114       90186      53567268
GSS115       73547      50024947
GSS116       89781      65307076
GSS117       82196      58897995
GSS118       75952      42225369
GSS119       81753      50639973
GSS12        72867      38288960
GSS120       95080      53332060
GSS121       84392      55609045
GSS122       84948      54772792
GSS123       82520      56164248
GSS124       76059      69621452
GSS125       76814      66081571
GSS126       79580      56124854
GSS127       78698      54671583
GSS128       79068      54060772
GSS129       79353      53688522
GSS13        76701      38974355
GSS130       78316      55286531
GSS131       82600      55940613
GSS132       84351      57436642
GSS133       80337      60421096
GSS134       58661      56683817
GSS135       78783      58813199
GSS136       75744      69156145
GSS137       76833      56328211
GSS138       78487      49995148
GSS139       92874      59388698
GSS14        71317      32131319
GSS140       94651      58128798
GSS141       86679      54570954
GSS142       86146      54910790
GSS143       78656      59527101
GSS144       95929      54898918
GSS145       115808     59172362
GSS146       100381     60998639
GSS147       76134      51421879
GSS148       53127      34214597
GSS149       72560      55176489
GSS15        70050      34744561
GSS150       72990      55905923
GSS151       72995      55897543
GSS152       73006      55878429
GSS153       72989      55905402
GSS154       72974      55933161
GSS155       77157      56620673
GSS156       76449      47248580
GSS157       85720      51228359
GSS158       91385      61755956
GSS159       81870      64722019
GSS16        78481      46288404
GSS160       94101      58400665
GSS161       80869      54393178
GSS162       87902      57201319
GSS163       94668      59260505
GSS164       84716      62770763
GSS165       93225      43223840
GSS166       116911     10728751
GSS167       83328      59630901
GSS168       55397      40216193
GSS169       51210      39249582
GSS17        70907      33296681
GSS170       61523      50961382
GSS171       59053      45384671
GSS172       57672      48568108
GSS173       57499      48762789
GSS174       58236      46459123
GSS175       58448      45820350
GSS176       58842      48479266
GSS177       58951      48415295
GSS178       58631      49401619
GSS179       58199      48365491
GSS18        59084      27955789
GSS180       58627      46114096
GSS181       58863      49463418
GSS182       60164      50142155
GSS183       60260      49906408
GSS184       60526      49107721
GSS185       60406      49468122
GSS186       60500      49184425
GSS187       59925      46864505
GSS188       59168      45304596
GSS189       58436      47610161
GSS19        56793      29073346
GSS190       58951      45999175
GSS191       58840      46346120
GSS192       58316      47986440
GSS193       58248      48200681
GSS194       58308      48548945
GSS195       60103      50079963
GSS196       59867      50789488
GSS197       59865      49245811
GSS198       60698      45685264
GSS199       60171      47314232
GSS2         88922      39302491
GSS20        57668      26711767
GSS200       59441      49573722
GSS201       59512      49358808
GSS202       59546      49252553
GSS203       59464      49504973
GSS204       59606      49070115
GSS205       59507      49371712
GSS206       59733      48686321
GSS207       59643      48956902
GSS208       59830      48304260
GSS209       58898      45871316
GSS21        61407      28964145
GSS210       58817      46158193
GSS211       58365      47726719
GSS212       58241      48162604
GSS213       58731      46214939
GSS214       57888      47995244
GSS215       64725      54652577
GSS216       64818      54767267
GSS217       99221      64438802
GSS218       16894      11281370
GSS219       86834      64340568
GSS22        64809      38246378
GSS220       83577      62754431
GSS221       103078     48150623
GSS222       68607      58517212
GSS223       68308      58775321
GSS224       69367      56630326
GSS225       69630      56119809
GSS226       70347      55379222
GSS227       85863      73179663
GSS228       86399      44944094
GSS229       88633      47125238
GSS23        57539      27055103
GSS230       85063      64770849
GSS231       70303      58967171
GSS232       69830      59920636
GSS233       63571      60896148
GSS234       81782      47152519
GSS235       87374      35525792
GSS236       107287     82097194
GSS237       105510     69614480
GSS238       84077      34011474
GSS239       120025     73824844
GSS24        66073      42002515
GSS240       120084     73762028
GSS241       115988     75258477
GSS242       94681      51364940
GSS243       87315      55418085
GSS244       98977      65364214
GSS245       107931     77900829
GSS246       107178     78840239
GSS247       105841     80272292
GSS248       97195      72722877
GSS249       83558      54678662
GSS25        68295      28341565
GSS250       110401     67135871
GSS251       110251     65959610
GSS252       104854     56801717
GSS253       75989      43357707
GSS254       105713     50476898
GSS255       86712      63966357
GSS256       95248      68681160
GSS257       95883      36586543
GSS258       95438      37237367
GSS259       96614      35260960
GSS26        58182      25340079
GSS260       94603      38634146
GSS261       69152      46568683
GSS27        65220      31888550
GSS28        65628      32592309
GSS29        77075      39617102
GSS3         87408      41798969
GSS30        82956      39733779
GSS31        74196      40401765
GSS32        70532      48278668
GSS33        79797      37819342
GSS34        75878      40340353
GSS35        74093      40090935
GSS36        87332      56001711
GSS37        87599      58170691
GSS38        85511      44950336
GSS39        86886      50521408
GSS4         78863      41012944
GSS40        86223      40151318
GSS41        83188      31659555
GSS42        81245      56935950
GSS43        80202      58163560
GSS44        72026      47499906
GSS45        72032      47437870
GSS46        77658      45788350
GSS47        77835      38607911
GSS48        83194      57974420
GSS49        86561      64612389
GSS5         78780      40537254
GSS50        81571      54575927
GSS51        93902      59236455
GSS52        88545      58803062
GSS53        76735      42453380
GSS54        72692      40311507
GSS55        86587      47167330
GSS56        88049      58404630
GSS57        76575      64123858
GSS58        70896      78090279
GSS59        85693      69155916
GSS6         78152      38866862
GSS60        89533      60167677
GSS61        63444      44826689
GSS62        66063      45395589
GSS63        89645      67196317
GSS64        84956      58411339
GSS65        86106      53001111
GSS66        85506      55697832
GSS67        93375      57842769
GSS68        97854      52541165
GSS69        97525      52978247
GSS7         77741      39121259
GSS70        98231      52043295
GSS71        99181      50783240
GSS72        99215      50739328
GSS73        99072      50929048
GSS74        99684      50116950
GSS75        97772      52649984
GSS76        91855      64690230
GSS77        89861      70745330
GSS78        88911      70097938
GSS79        87853      69641604
GSS8         75713      38106019
GSS80        87885      63943229
GSS81        88277      44782123
GSS82        78272      23284467
GSS83        78150      23572326
GSS84        84150      49120906
GSS85        77313      45465324
GSS86        88952      56158697
GSS87        84315      58639539
GSS88        76357      76793830
GSS89        79379      73092546
GSS9         72102      37149999
GSS90        84492      46459055
GSS91        84778      49510897
GSS92        75625      41885111
GSS93        79333      56691265
GSS94        77180      56468742
GSS95        82097      54156207
GSS96        84748      58286670
GSS97        85366      57702247
GSS98        87367      52198860
GSS99        81439      67169874
HTC1         25064      27057244
HTC10        66720      81580196
HTC11        68222      59039782
HTC12        29423      37255284
HTC2         15992      36040161
HTC3         15968      36540083
HTC4         16191      35387639
HTC5         15926      40287252
HTC6         16011      37280168
HTC7         51319      28421323
HTC8         55941      71510037
HTC9         81456      70193596
HTG1         1318       188929277
HTG10        1300       186477873
HTG11        1437       184183182
HTG12        883        191867533
HTG13        751        192405888
HTG14        743        192375470
HTG15        782        192313879
HTG16        802        192010230
HTG17        768        192318086
HTG18        2050       171319873
HTG19        1054       187981982
HTG2         2465       186071856
HTG20        996        189097368
HTG21        782        192087293
HTG22        925        190510953
HTG23        901        190586664
HTG24        808        191507090
HTG25        780        192166174
HTG26        857        191368821
HTG27        889        190742228
HTG28        948        190117267
HTG29        897        191062364
HTG3         2517       185290576
HTG30        928        190475719
HTG31        872        191308892
HTG32        968        189758540
HTG33        877        191165426
HTG34        858        191667451
HTG35        827        191908957
HTG36        933        190184443
HTG37        934        190902995
HTG38        941        190379296
HTG39        1035       189345169
HTG4         2553       188532563
HTG40        1188       187252423
HTG41        1237       188154870
HTG42        1198       188301143
HTG43        1167       187143152
HTG44        1099       191590258
HTG45        1244       190876680
HTG46        1216       191054080
HTG47        1135       191226449
HTG48        1045       191129962
HTG49        930        189550761
HTG5         1284       185715991
HTG50        1053       189736105
HTG51        904        189535097
HTG52        1043       189532211
HTG53        925        189624939
HTG54        998        189545130
HTG55        917        189182807
HTG56        974        188907614
HTG57        1084       188755133
HTG58        981        189501845
HTG59        1097       185750811
HTG6         1274       185234665
HTG60        1096       189013789
HTG61        989        189296974
HTG62        1013       188879420
HTG63        977        189274183
HTG64        1115       188780023
HTG65        1111       187863402
HTG66        1292       184433881
HTG67        1235       185487613
HTG68        1235       184699619
HTG69        1252       184766282
HTG7         1277       185414872
HTG70        1208       186425569
HTG71        1426       186918415
HTG72        1254       188846392
HTG73        1114       191437750
HTG74        1198       191924250
HTG75        1157       191330635
HTG76        1147       191472384
HTG77        1183       191633891
HTG78        1143       191528959
HTG79        1217       191133373
HTG8         1459       184762119
HTG80        1167       191453724
HTG81        1140       191527768
HTG82        1131       191322933
HTG83        1337       186967029
HTG84        1248       190380070
HTG85        1296       189801859
HTG86        1261       189156458
HTG87        1148       190611802
HTG88        1142       187124040
HTG89        1467       188488753
HTG9         1200       186999351
HTG90        980        193507512
HTG91        750        169259295
HTG92        1095       193977343
HTG93        1111       192344011
HTG94        1088       192747894
HTG95        1114       188698558
HTG96        415        51014860
INV1         38798      129243007
INV10        26734      93283379
INV2         1764       197338358
INV3         13987      137917251
INV4         78152      73765484
INV5         40726      111437881
INV6         62245      84484008
INV7         80672      71117406
INV8         63348      83286490
INV9         83972      69320479
MAM1         23229      152539651
MAM2         60814      87343762
MAM3         54926      75890228
PAT1         222610     70141260
PAT10        125437     99521476
PAT11        141741     62606569
PAT12        105796     59940607
PAT13        103556     50226950
PAT14        121472     53276251
PAT15        113046     61292641
PAT16        145017     54899720
PAT17        155516     69895616
PAT18        97490      122599302
PAT19        147596     87374532
PAT2         194518     84655123
PAT20        117413     104539537
PAT21        123723     103466459
PAT22        119269     106142975
PAT23        111058     93498111
PAT24        106407     73282841
PAT25        99530      77220773
PAT26        118191     68940722
PAT27        103602     77183408
PAT28        161225     102636210
PAT29        15504      3688565
PAT3         171984     95898893
PAT4         153750     106059356
PAT5         184018     85619906
PAT6         156357     93378139
PAT7         152402     81705870
PAT8         104671     119400828
PAT9         143544     89226980
PHG          3416       23721605
PLN1         48046      106127030
PLN10        20464      147535126
PLN11        18492      152306961
PLN12        18274      152591029
PLN13        13330      155170451
PLN14        1263       166194087
PLN15        1045       167464813
PLN16        5          168115057
PLN17        82         167115265
PLN18        63247      68995331
PLN19        78038      76759014
PLN2         1411       165225540
PLN20        74675      77529188
PLN21        16491      124141483
PLN22        52878      114326669
PLN23        76164      78697888
PLN24        103148     57511552
PLN25        41450      75371947
PLN3         1481       165802738
PLN4         19231      144433763
PLN5         75713      79324350
PLN6         74133      76501492
PLN7         40955      53089054
PLN8         28653      84722395
PLN9         12677      133595487
PRI1         29626      121811553
PRI10        1469       182922219
PRI11        1271       178875524
PRI12        1461       178405231
PRI13        1608       179863163
PRI14        1620       182196738
PRI15        1231       192469478
PRI16        1135       194165271
PRI17        1145       193895895
PRI18        37806      128911128
PRI19        66480      83974390
PRI2         1628       172508918
PRI20        28873      105303455
PRI21        2640       179225422
PRI22        2070       182602115
PRI23        1643       183270722
PRI24        2065       182511065
PRI25        2204       180290494
PRI26        11784      161273514
PRI27        12380      159025768
PRI28        55927      86387840
PRI29        33178      63830643
PRI3         1333       184493188
PRI30        16637      139425411
PRI31        40687      127410754
PRI32        74141      80389359
PRI33        31007      57890101
PRI4         1313       184869596
PRI5         1195       181623048
PRI6         1192       179043100
PRI7         1233       181332288
PRI8         1313       175202833
PRI9         1241       175392969
ROD1         10812      166887245
ROD10        975        182154265
ROD11        1030       186610793
ROD12        960        183545752
ROD13        1024       187504897
ROD14        954        181258569
ROD15        964        182163546
ROD16        1035       186307834
ROD17        23664      153318050
ROD18        13435      160635072
ROD19        1163       185608690
ROD2         925        174124404
ROD20        1178       185659573
ROD21        29877      132778430
ROD22        31683      67281232
ROD23        5556       173368549
ROD24        90229      93651118
ROD25        100051     46686798
ROD3         907        173817152
ROD4         905        174095592
ROD5         926        173972238
ROD6         985        181119091
ROD7         971        179736279
ROD8         987        181779730
ROD9         1010       182973926
STS1         82739      35271111
STS10        57923      44595779
STS11        57912      43615295
STS12        65651      42721019
STS13        86618      34268481
STS14        63489      28547756
STS2         85313      48520780
STS3         68499      26956248
STS4         78224      37482332
STS5         54815      32117290
STS6         54828      31989465
STS7         54669      32194056
STS8         55796      36332134
STS9         57855      44563441
SYN          51314      69077963
UNA          211        114018
VRL1         72067      66079823
VRL2         71493      63056989
VRL3         70929      66861677
VRL4         68584      67996002
VRL5         61228      72131788
VRL6         62112      74519912
VRL7         58255      56404550
VRT1         18620      163989832
VRT10        11619      177031363
VRT11        7872       180039184
VRT12        29151      147988517
VRT13        81387      68942064
VRT2         58503      106626532
VRT3         15205      164843314
VRT4         70596      82940878
VRT5         49964      65335138
VRT6         16467      137780719
VRT7         1235       191506964
VRT8         1290       191180295
VRT9         8913       179224438

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 160.0 (excluding chloroplast
and mitochondrial sequences, metagenomic sequences, and Whole Genome Shotgun
sequences):

Entries        Bases   Species

11103627 12649896894   Homo sapiens
6900531   8191906517   Mus musculus
1268979   5748815391   Rattus norvegicus
1856645   3693385829   Bos taurus
2837151   3315419379   Zea mays
1550369   2746510155   Danio rerio
1170719   1514103647   Oryza sativa (japonica cultivar-group)
1286174   1424141849   Sus scrofa
227652    1352195825   Strongylocentrotus purpuratus
1401024   1125373076   Xenopus tropicalis
211999     934298402   Pan troglodytes
719188     889539202   Drosophila melanogaster
1949245    879228118   Arabidopsis thaliana
802323     855887010   Gallus gallus
497528     810255328   Vitis vinifera
75710      688075766   Macaca mulatta
1220121    685124541   Canis lupus familiaris
1006205    657600968   Sorghum bicolor
1101600    647624511   Triticum aestivum
401462     514485883   Medicago truncatula

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files, CON-division sequence files, and the
lists of new, changed, and deleted accession numbers, each of the files of a
GenBank release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 June 2007

                NCBI-GenBank Flat File Release 160.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 PROJECT Format

  This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
PROJECT     GenomeProject:18787

  A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second 
contains the actual project identifier ("18787").

  PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 160.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
	Andrea Gocke, Manzour Hazbon, Anjanette Johnston, Mark Landree,
	Richard McVeigh, Leonie Misquitta, Ilene Mizrachi, DeAnne Olsen Cravaritis,
	Chris O'Sullivan, Leigh Riley, Gert Roosen, Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Ben Slade

User Support
	Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
	Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
	Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
	David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center