Release Notes For GenBank Release 161

GBREL.TXT          Genetic Sequence Data Bank
                         August 15 2007

               NCBI-GenBank Flat File Release 161.0

                    Distribution Release Notes

 76146236 loci, 79525559650 bases, from 76146236 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 161.0
1.2 Cutoff Date
1.3 Important Changes in Release 161.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 161.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 161.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:

	ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/  (Japan)
	ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/  (Korea)
	ftp://bio-mirror.sg.apan.net/biomirrors/genbank/     (Singapore)

1.2 Cutoff Date

  This full release, 161.0, incorporates data available to the collaborating
databases as of August 14, 2007 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 161.0

1.3.1 CON division organizational changes

  As mentioned in the release notes for GenBank 160.0, the processing
for "constructed" CON division records has been changed so that they
are provided via a larger number of much smaller files. 

  Consequently, there are now 82 gbcon*.seq sequence files, in contrast
to the eight of Release 160.0. And there are other impacts:

  - accession numbers for CON records now appear in gbacc1.txt,
    gbnew.txt, gbchg.txt, and gbdel.txt 

  - the Author Index files (gbaut*.idx) now reflect the content of
    CON division records, and the number of those files has increased
    from 21 to 47

  These changes were necessitated by the influx of 3 million CON division
records from the AACY02 metagenomic WGS project:

    PubMed ID 17355176 
    ntral.nih.gov/articlerender.fcgi?tool=pubmed&pubmedid=17355176

  Although the CON division sequence files have headers which include
the number of records and basepairs in each file, CON records are
excluded from the statistics reported in Sections 2.2.6, 2.2.7, 2.2.8,
and the file header of the GenBank release notes.

  The reason for this is that CON division records are constructed by
referring to basepair intervals on other (non-CON) records. Hence, their
inclusion in overall release statistics would be a form of double-counting.

  The procedures for generating the ASN.1-format release files will be
similarly modified by October 2007, and a much larger number of smaller
gbcon*.aso files will result.

  The dramatic increase in the number of Author Index files illustrates
the inefficiencies of the current index file data products. Note the
discussion in Section 1.3.3, below.

1.3.2 Organizational changes

  The total number of sequence data files increased by 119 with this release:

  - the BCT division is now comprised of  24 files (+2)
  - the CON division is now comprised of  82 files (+74)
  - the EST division is now comprised of 635 files (+26)
  - the GSS division is now comprised of 264 files (+3)
  - the ENV division is now comprised of   6 files (+1)
  - the HTG division is now comprised of  98 files (+2)
  - the INV division is now comprised of  11 files (+1)
  - the PAT division is now comprised of  30 files (+1)
  - the PLN division is now comprised of  26 files (+1)
  - the PRI division is now comprised of  34 files (+1)
  - the ROD division is now comprised of  26 files (+1)
  - the SYN division is now comprised of   5 files (+4)
  - the VRL division is now comprised of   8 files (+1)
  - the VRT division is now comprised of  14 files (+1)

  The total number of index files increased by 28 with this release:

  - the AUT (Author Name) index is now comprised of 47 files  (+26)
  - the JOU (Journal Name) index is now comprised of 4 files   (+1)
  - the Key (Keyword Phrase) index is now comprised of 3 files (+1)

1.3.3 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.5 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
forty-three of the GSS flatfiles in Release 160.0. Consider gbgss219.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                            June 15 2007

                NCBI-GenBank Flat File Release 160.0

                           GSS Sequences (Part 1)

   86834 loci,    64340568 bases, from    86834 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "219" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 Structured /specimen_voucher qualifiers

  As of October 2007, the content of the /specimen_voucher qualifier will
be able to support a structured value consisting of an institution code,
a collection code, and a specimen identifier, as well as the existing
unstructured values. Here is the preliminary new definition of the qualifier:

Qualifier:
specimen_voucher

Definition:
Identifier for the specimen from which the nucleic acid sequenced was obtained.

Value format:
/specimen_voucher="[<institution-code>:[<collection-code>:]]<specimen_id>"

Example:
/specimen_voucher="UAM:Mamm:52179"
/specimen_voucher="AMCC:101706"
/specimen_voucher="USNM:field series 8798"
/specimen_voucher="personal collection:Dan Janzen:99-SRNP-2003"
/specimen_voucher="99-SRNP-2003"

Comment:
The specimen_voucher qualifier is intended to annotate a reference to the
physical specimen that remains after the sequence has been obtained. If the
specimen was destroyed in the process of sequencing, electronic images
(e-vouchers) are an adequate substitute for a physical voucher specimen.
Ideally the specimens will be deposited in a curated museum, herbarium, or
frozen tissue collection, but often they will remain in a personal or
laboratory collection for some time before they are deposited in a curated
collection.

There are three forms of specimen_voucher qualifiers. If the text of the
qualifier includes one or more colons it is a 'structured voucher'. Structured
vouchers include institution-codes (and optional collection-codes) taken from
a controlled vocabulary that denote the museum or herbarium collection where
the specimen resides.

   <specimen_id>
   <institution_code>:<specimen_id>
   <institution_code>:<collection_code>:<specimen_id>

1.4.2 New /culture_collection and /bio_material qualifiers

  As of the December 2007 GenBank release, new qualifiers /culture_collection
and /bio_material qualifiers will be legal for the source feature. These
qualifiers will utilize the same format as /speciment_voucher (see Section
1.4.1 of these release notes). Their preliminary definitions are:

Qualifier:
culture_collection

Definition:
Institution code and identifier for the culture from which the nucleic acid
sequenced was obtained, with optional collection code.

Value format:
/culture_collection="<institution-code>:[<collection-code>:]<culture_id>"

Example:
/culture_collection="ATCC:26370"

Comment:
The culture_collection qualifier should be used to annotate live microbial and
viral cultures, and cell lines that have been deposited in curated culture
collections. Microbial cultures in personal or laboratory collections should
be annotated in strain qualifiers.

Annotation with a culture_collection qualifier implies that the sequence was
obtained from a sample retrieved (by the submitter or a collaborator) from the
indicated culture collection, or that the sequence was obtained from a sample
that was deposited (by the submitter or a collaborator) in the indicated culture
collection. Annotation with more than one culture_collection qualifier
indicates that the sequence was obtained from a sample that was deposited
(by the submitter or a collaborator) in more than one culture collection.

Culture_id and institution_code are mandatory, collection_code is optional.
Institution code is mandatory where collection code is present.


Qualifier:
bio_material

Definition:
Identifier for the biological material from which the nucleic acid sequenced
was obtained, with optional institution code and collection code for the place
where it is currently stored.

Value format:
/bio_material="[<institution-code>:[<collection-code>:]]<material_id>"

Example:
/bio_material="CGC:CB3912"      <- Caenorhabditis stock center

Comment:
The bio_material qualifier should be used to annotate the identifiers of material
in biological collections that are not appropriate to annotate as either
/specimen_voucher or /culture_collection. These include zoos and aquaria,
stock centers, seed banks, germplasm repositories and DNA banks.

Material_id is mandatory, institution_code and collection_code are optional.
Institution code is mandatory where collection code is present.

1.4.3 /operon qualifiers for protein_bind features

  Due to an oversight, the /operon qualifier is not currently listed 
as a legal qualifier for the protein_bind feature. This will be 
corrected as of October 2007, with an update to the Feature Table
document which includes the qualifier among those that are legal
for protein_bind.

1.4.4 Alignment as EVIDENCE_BASIS for the /inference qualifier

  Several algorithms exist which allow mRNAs to be aligned to genomic
sequence, taking into account introns and splice signals. In order to
document the use of such algorithms for the structured /inference
qualifier, a new class of EVIDENCE_BASIS will be introduced:

	alignment

This addition to the controlled vocabulary of the /inference qualifier
will be legal as of October 2007.

1.4.5 New ncRNA feature 

  A variety of new types of RNA features have been introduced in 
recent years. snRNA, snoRNA, and scRNA are some examples.

  Because the number of non-coding RNA families is quite likely to
continue to expand, a new ncRNA feature that can flexibly 
accomodate them will be introduced as of October 2007.

  This new feature will utilize a new qualifier called
/ncRNA_class, with a controlled vocabulary to indicate what type
of non-coding feature is being represented.

  Here is the preliminary definition of the ncRNA feature and
/ncRNA_class :

Feature Key           ncRNA
Definition            a non-protein-coding gene, other than ribosomal RNA and transfer RNA,
                      the functional molecule of which is the RNA transcript.
Optional qualifiers   /allele="text"
                      /citation=[number]
                      /db_xref="<database>:<identifier>"
                      /experiment="text"
                      /function="text"
                      /gene="text"
                      /inference="TYPE[ (same species)][:EVIDENCE_BASIS]"
                      /label=feature_label
                      /locus_tag="text" (single token)
                      /map="text"
                      /note="text"
                      /old_locus_tag="text" (single token)
                      /product="text"
                      /pseudo
                      /standard_name="text"
                      /trans_splicing
                      /operon="text"
Mandatory qualifiers  /ncRNA_class="TYPE"
Comment               The ncRNA feature is not used for ribosomal and
                      transfer RNA annotation, for which the rRNA and tRNA feature keys
                      should be used, respectively.


Qualifier       /ncRNA_class=
Definition      a structured description of the classification of the
                non-protein-coding RNA described by the ncRNA parent key
Value format   "TYPE"
where TYPE is one of the following terms:

"antisense_RNA"
"autocatalytically_spliced_intron" 
"hammerhead_ribozyme" 
"RNase_P_RNA"
"RNase_MRP_RNA"
"telomerase_RNA"
"guide_RNA"
"rasiRNA"
"scRNA"
"siRNA"
"miRNA"
"snoRNA"
"snRNA"
"SRP_RNA"
"vault_RNA"
"Y_RNA"
"other"

Example         /ncRNA_class="miRNA"
                /ncRNA_class="siRNA"
                /ncRNA_class="scRNA"       

Comment         ncRNA classes not found in the restricted vocabulary list can be 
                annotated by entering '/ncRNA_class="other"' with
                '/note="[brief explanation of novel ncRNA_class]"'

1.4.6 New tmRNA feature and /peptide_tag qualifier

  To support the annotation of a class of RNAs that have dual
tRNA-like and mRNA-like behaviors, a new tmRNA feature will be
legal for the Feature Table as of December 2007. The "tmRNA Website"
at Indiana University provides some background information about
the unusual biology of tmRNAs :

	http://www.indiana.edu/~tmrna/ 

Here is a preliminary definition of the new tmRNA feature:

Feature Key           tmRNA
Definition            transfer messenger RNA; tmRNA acts like a tRNA first, 
                      and then an mRNA that encodes a peptide tag. 
                      The ribosome translates this mRNA region of tmRNA and 
                      attaches the encoded peptide tag to the C-terminus of the 
                      unfinished protein. This attached tag targets the protein
                      for destruction or proteolysis
Optional qualifiers   /allele="text"
                      /citation=[number]
                      /db_xref="<database>:<identifier>"
                      /experiment="text"
                      /function="text"
                      /gene="text"
                      /inference="TYPE[ (same species)][:EVIDENCE_BASIS]"
                      /label=feature_label
                      /locus_tag="text" (single token)
                      /map="text"
                      /note="text"
                      /old_locus_tag="text" (single token)
                      /product="text"
                      /pseudo
                      /standard_name="text"

To indicate the nucleotide region encoding the proteolysis tag
peptide, a new /peptide_tag qualifier will be introduced for
the tmRNA feature.

Complete details about this new feature and qualifier will be
distributed via the GenBank listserv, and in future versions of
these release notes.

1.4.7 /organism no longer to be used for misc_recomb

  The /organism qualifier is currently legal for misc_recomb
features. A review of the existing cases in the database has
indicated that all could be better annotated through the use
of multiple source features.

  That work will be completed by October 2007, at which
point /organism will no longer be allowed for the misc_recomb
feature key.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1360 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut5.idx - Index of the entries according to author name, part 5.
47. gbaut6.idx - Index of the entries according to author name, part 6.
48. gbaut7.idx - Index of the entries according to author name, part 7.
49. gbaut8.idx - Index of the entries according to author name, part 8.
50. gbaut9.idx - Index of the entries according to author name, part 9.
51. gbbct1.seq - Bacterial sequence entries, part 1.
52. gbbct10.seq - Bacterial sequence entries, part 10.
53. gbbct11.seq - Bacterial sequence entries, part 11.
54. gbbct12.seq - Bacterial sequence entries, part 12.
55. gbbct13.seq - Bacterial sequence entries, part 13.
56. gbbct14.seq - Bacterial sequence entries, part 14.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct16.seq - Bacterial sequence entries, part 16.
59. gbbct17.seq - Bacterial sequence entries, part 17.
60. gbbct18.seq - Bacterial sequence entries, part 18.
61. gbbct19.seq - Bacterial sequence entries, part 19.
62. gbbct2.seq - Bacterial sequence entries, part 2.
63. gbbct20.seq - Bacterial sequence entries, part 20.
64. gbbct21.seq - Bacterial sequence entries, part 21.
65. gbbct22.seq - Bacterial sequence entries, part 22.
66. gbbct23.seq - Bacterial sequence entries, part 23.
67. gbbct24.seq - Bacterial sequence entries, part 24.
68. gbbct3.seq - Bacterial sequence entries, part 3.
69. gbbct4.seq - Bacterial sequence entries, part 4.
70. gbbct5.seq - Bacterial sequence entries, part 5.
71. gbbct6.seq - Bacterial sequence entries, part 6.
72. gbbct7.seq - Bacterial sequence entries, part 7.
73. gbbct8.seq - Bacterial sequence entries, part 8.
74. gbbct9.seq - Bacterial sequence entries, part 9.
75. gbchg.txt - Accession numbers of entries updated since the previous release.
76. gbcon1.seq - Constructed sequence entries, part 1.
77. gbcon10.seq - Constructed sequence entries, part 10.
78. gbcon11.seq - Constructed sequence entries, part 11.
79. gbcon12.seq - Constructed sequence entries, part 12.
80. gbcon13.seq - Constructed sequence entries, part 13.
81. gbcon14.seq - Constructed sequence entries, part 14.
82. gbcon15.seq - Constructed sequence entries, part 15.
83. gbcon16.seq - Constructed sequence entries, part 16.
84. gbcon17.seq - Constructed sequence entries, part 17.
85. gbcon18.seq - Constructed sequence entries, part 18.
86. gbcon19.seq - Constructed sequence entries, part 19.
87. gbcon2.seq - Constructed sequence entries, part 2.
88. gbcon20.seq - Constructed sequence entries, part 20.
89. gbcon21.seq - Constructed sequence entries, part 21.
90. gbcon22.seq - Constructed sequence entries, part 22.
91. gbcon23.seq - Constructed sequence entries, part 23.
92. gbcon24.seq - Constructed sequence entries, part 24.
93. gbcon25.seq - Constructed sequence entries, part 25.
94. gbcon26.seq - Constructed sequence entries, part 26.
95. gbcon27.seq - Constructed sequence entries, part 27.
96. gbcon28.seq - Constructed sequence entries, part 28.
97. gbcon29.seq - Constructed sequence entries, part 29.
98. gbcon3.seq - Constructed sequence entries, part 3.
99. gbcon30.seq - Constructed sequence entries, part 30.
100. gbcon31.seq - Constructed sequence entries, part 31.
101. gbcon32.seq - Constructed sequence entries, part 32.
102. gbcon33.seq - Constructed sequence entries, part 33.
103. gbcon34.seq - Constructed sequence entries, part 34.
104. gbcon35.seq - Constructed sequence entries, part 35.
105. gbcon36.seq - Constructed sequence entries, part 36.
106. gbcon37.seq - Constructed sequence entries, part 37.
107. gbcon38.seq - Constructed sequence entries, part 38.
108. gbcon39.seq - Constructed sequence entries, part 39.
109. gbcon4.seq - Constructed sequence entries, part 4.
110. gbcon40.seq - Constructed sequence entries, part 40.
111. gbcon41.seq - Constructed sequence entries, part 41.
112. gbcon42.seq - Constructed sequence entries, part 42.
113. gbcon43.seq - Constructed sequence entries, part 43.
114. gbcon44.seq - Constructed sequence entries, part 44.
115. gbcon45.seq - Constructed sequence entries, part 45.
116. gbcon46.seq - Constructed sequence entries, part 46.
117. gbcon47.seq - Constructed sequence entries, part 47.
118. gbcon48.seq - Constructed sequence entries, part 48.
119. gbcon49.seq - Constructed sequence entries, part 49.
120. gbcon5.seq - Constructed sequence entries, part 5.
121. gbcon50.seq - Constructed sequence entries, part 50.
122. gbcon51.seq - Constructed sequence entries, part 51.
123. gbcon52.seq - Constructed sequence entries, part 52.
124. gbcon53.seq - Constructed sequence entries, part 53.
125. gbcon54.seq - Constructed sequence entries, part 54.
126. gbcon55.seq - Constructed sequence entries, part 55.
127. gbcon56.seq - Constructed sequence entries, part 56.
128. gbcon57.seq - Constructed sequence entries, part 57.
129. gbcon58.seq - Constructed sequence entries, part 58.
130. gbcon59.seq - Constructed sequence entries, part 59.
131. gbcon6.seq - Constructed sequence entries, part 6.
132. gbcon60.seq - Constructed sequence entries, part 60.
133. gbcon61.seq - Constructed sequence entries, part 61.
134. gbcon62.seq - Constructed sequence entries, part 62.
135. gbcon63.seq - Constructed sequence entries, part 63.
136. gbcon64.seq - Constructed sequence entries, part 64.
137. gbcon65.seq - Constructed sequence entries, part 65.
138. gbcon66.seq - Constructed sequence entries, part 66.
139. gbcon67.seq - Constructed sequence entries, part 67.
140. gbcon68.seq - Constructed sequence entries, part 68.
141. gbcon69.seq - Constructed sequence entries, part 69.
142. gbcon7.seq - Constructed sequence entries, part 7.
143. gbcon70.seq - Constructed sequence entries, part 70.
144. gbcon71.seq - Constructed sequence entries, part 71.
145. gbcon72.seq - Constructed sequence entries, part 72.
146. gbcon73.seq - Constructed sequence entries, part 73.
147. gbcon74.seq - Constructed sequence entries, part 74.
148. gbcon75.seq - Constructed sequence entries, part 75.
149. gbcon76.seq - Constructed sequence entries, part 76.
150. gbcon77.seq - Constructed sequence entries, part 77.
151. gbcon78.seq - Constructed sequence entries, part 78.
152. gbcon79.seq - Constructed sequence entries, part 79.
153. gbcon8.seq - Constructed sequence entries, part 8.
154. gbcon80.seq - Constructed sequence entries, part 80.
155. gbcon81.seq - Constructed sequence entries, part 81.
156. gbcon82.seq - Constructed sequence entries, part 82.
157. gbcon9.seq - Constructed sequence entries, part 9.
158. gbdel.txt - Accession numbers of entries deleted since the previous release.
159. gbenv1.seq - Environmental sampling sequence entries, part 1.
160. gbenv2.seq - Environmental sampling sequence entries, part 2.
161. gbenv3.seq - Environmental sampling sequence entries, part 3.
162. gbenv4.seq - Environmental sampling sequence entries, part 4.
163. gbenv5.seq - Environmental sampling sequence entries, part 5.
164. gbenv6.seq - Environmental sampling sequence entries, part 6.
165. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
166. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
167. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
168. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
169. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
170. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
171. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
172. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
173. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
174. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
175. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
176. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
177. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
178. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
179. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
180. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
181. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
182. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
183. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
184. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
185. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
186. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
187. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
188. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
189. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
190. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
191. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
192. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
193. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
194. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
195. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
196. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
197. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
198. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
199. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
200. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
201. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
202. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
203. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
204. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
205. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
206. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
207. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
208. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
209. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
210. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
211. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
212. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
213. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
214. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
215. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
216. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
217. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
218. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
219. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
220. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
221. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
222. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
223. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
224. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
225. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
226. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
227. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
228. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
229. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
230. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
231. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
232. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
233. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
234. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
235. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
236. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
237. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
238. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
239. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
240. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
241. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
242. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
243. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
244. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
245. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
246. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
247. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
248. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
249. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
250. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
251. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
252. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
253. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
254. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
255. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
256. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
257. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
258. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
259. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
260. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
261. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
262. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
263. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
264. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
265. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
266. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
267. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
268. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
269. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
270. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
271. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
272. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
273. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
274. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
275. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
276. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
277. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
278. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
279. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
280. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
281. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
282. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
283. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
284. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
285. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
286. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
287. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
288. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
289. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
290. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
291. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
292. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
293. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
294. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
295. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
296. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
297. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
298. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
299. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
300. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
301. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
302. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
303. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
304. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
305. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
306. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
307. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
308. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
309. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
310. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
311. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
312. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
313. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
314. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
315. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
316. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
317. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
318. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
319. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
320. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
321. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
322. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
323. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
324. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
325. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
326. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
327. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
328. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
329. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
330. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
331. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
332. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
333. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
334. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
335. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
336. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
337. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
338. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
339. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
340. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
341. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
342. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
343. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
344. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
345. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
346. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
347. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
348. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
349. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
350. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
351. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
352. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
353. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
354. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
355. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
356. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
357. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
358. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
359. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
360. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
361. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
362. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
363. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
364. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
365. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
366. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
367. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
368. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
369. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
370. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
371. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
372. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
373. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
374. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
375. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
376. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
377. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
378. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
379. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
380. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
381. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
382. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
383. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
384. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
385. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
386. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
387. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
388. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
389. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
390. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
391. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
392. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
393. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
394. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
395. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
396. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
397. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
398. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
399. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
400. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
401. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
402. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
403. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
404. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
405. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
406. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
407. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
408. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
409. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
410. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
411. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
412. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
413. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
414. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
415. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
416. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
417. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
418. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
419. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
420. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
421. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
422. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
423. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
424. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
425. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
426. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
427. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
428. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
429. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
430. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
431. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
432. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
433. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
434. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
435. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
436. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
437. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
438. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
439. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
440. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
441. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
442. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
443. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
444. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
445. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
446. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
447. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
448. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
449. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
450. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
451. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
452. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
453. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
454. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
455. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
456. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
457. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
458. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
459. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
460. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
461. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
462. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
463. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
464. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
465. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
466. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
467. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
468. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
469. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
470. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
471. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
472. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
473. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
474. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
475. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
476. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
477. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
478. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
479. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
480. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
481. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
482. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
483. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
484. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
485. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
486. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
487. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
488. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
489. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
490. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
491. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
492. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
493. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
494. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
495. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
496. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
497. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
498. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
499. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
500. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
501. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
502. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
503. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
504. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
505. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
506. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
507. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
508. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
509. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
510. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
511. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
512. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
513. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
514. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
515. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
516. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
517. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
518. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
519. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
520. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
521. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
522. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
523. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
524. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
525. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
526. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
527. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
528. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
529. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
530. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
531. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
532. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
533. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
534. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
535. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
536. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
537. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
538. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
539. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
540. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
541. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
542. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
543. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
544. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
545. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
546. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
547. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
548. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
549. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
550. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
551. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
552. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
553. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
554. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
555. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
556. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
557. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
558. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
559. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
560. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
561. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
562. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
563. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
564. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
565. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
566. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
567. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
568. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
569. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
570. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
571. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
572. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
573. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
574. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
575. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
576. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
577. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
578. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
579. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
580. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
581. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
582. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
583. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
584. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
585. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
586. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
587. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
588. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
589. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
590. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
591. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
592. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
593. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
594. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
595. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
596. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
597. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
598. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
599. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
600. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
601. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
602. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
603. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
604. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
605. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
606. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
607. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
608. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
609. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
610. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
611. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
612. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
613. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
614. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
615. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
616. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
617. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
618. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
619. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
620. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
621. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
622. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
623. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
624. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
625. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
626. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
627. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
628. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
629. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
630. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
631. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
632. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
633. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
634. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
635. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
636. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
637. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
638. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
639. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
640. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
641. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
642. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
643. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
644. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
645. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
646. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
647. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
648. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
649. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
650. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
651. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
652. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
653. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
654. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
655. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
656. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
657. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
658. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
659. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
660. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
661. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
662. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
663. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
664. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
665. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
666. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
667. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
668. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
669. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
670. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
671. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
672. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
673. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
674. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
675. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
676. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
677. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
678. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
679. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
680. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
681. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
682. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
683. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
684. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
685. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
686. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
687. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
688. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
689. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
690. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
691. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
692. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
693. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
694. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
695. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
696. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
697. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
698. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
699. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
700. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
701. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
702. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
703. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
704. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
705. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
706. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
707. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
708. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
709. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
710. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
711. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
712. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
713. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
714. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
715. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
716. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
717. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
718. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
719. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
720. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
721. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
722. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
723. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
724. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
725. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
726. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
727. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
728. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
729. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
730. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
731. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
732. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
733. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
734. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
735. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
736. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
737. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
738. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
739. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
740. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
741. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
742. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
743. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
744. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
745. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
746. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
747. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
748. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
749. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
750. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
751. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
752. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
753. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
754. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
755. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
756. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
757. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
758. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
759. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
760. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
761. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
762. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
763. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
764. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
765. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
766. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
767. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
768. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
769. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
770. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
771. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
772. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
773. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
774. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
775. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
776. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
777. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
778. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
779. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
780. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
781. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
782. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
783. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
784. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
785. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
786. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
787. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
788. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
789. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
790. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
791. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
792. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
793. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
794. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
795. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
796. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
797. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
798. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
799. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
800. gbgen.idx - Index of the entries according to gene symbols.
801. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
802. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
803. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
804. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
805. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
806. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
807. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
808. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
809. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
810. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
811. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
812. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
813. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
814. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
815. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
816. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
817. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
818. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
819. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
820. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
821. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
822. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
823. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
824. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
825. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
826. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
827. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
828. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
829. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
830. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
831. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
832. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
833. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
834. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
835. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
836. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
837. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
838. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
839. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
840. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
841. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
842. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
843. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
844. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
845. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
846. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
847. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
848. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
849. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
850. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
851. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
852. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
853. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
854. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
855. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
856. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
857. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
858. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
859. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
860. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
861. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
862. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
863. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
864. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
865. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
866. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
867. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
868. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
869. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
870. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
871. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
872. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
873. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
874. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
875. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
876. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
877. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
878. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
879. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
880. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
881. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
882. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
883. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
884. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
885. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
886. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
887. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
888. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
889. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
890. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
891. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
892. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
893. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
894. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
895. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
896. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
897. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
898. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
899. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
900. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
901. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
902. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
903. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
904. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
905. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
906. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
907. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
908. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
909. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
910. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
911. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
912. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
913. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
914. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
915. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
916. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
917. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
918. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
919. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
920. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
921. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
922. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
923. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
924. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
925. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
926. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
927. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
928. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
929. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
930. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
931. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
932. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
933. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
934. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
935. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
936. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
937. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
938. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
939. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
940. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
941. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
942. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
943. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
944. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
945. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
946. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
947. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
948. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
949. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
950. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
951. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
952. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
953. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
954. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
955. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
956. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
957. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
958. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
959. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
960. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
961. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
962. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
963. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
964. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
965. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
966. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
967. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
968. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
969. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
970. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
971. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
972. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
973. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
974. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
975. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
976. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
977. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
978. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
979. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
980. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
981. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
982. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
983. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
984. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
985. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
986. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
987. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
988. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
989. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
990. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
991. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
992. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
993. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
994. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
995. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
996. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
997. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
998. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
999. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1000. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1001. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1002. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1003. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1004. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1005. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1006. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1007. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1008. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1009. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1010. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1011. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1012. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1013. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1014. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1015. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1016. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1017. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1018. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1019. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1020. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1021. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1022. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1023. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1024. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1025. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1026. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1027. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1028. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1029. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1030. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1031. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1032. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1033. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1034. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1035. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1036. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1037. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1038. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1039. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1040. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1041. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1042. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1043. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1044. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1045. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1046. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1047. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1048. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1049. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1050. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1051. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1052. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1053. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1054. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1055. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1056. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1057. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1058. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1059. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1060. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1061. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1062. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1063. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1064. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1065. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1066. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1067. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1068. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1069. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1070. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1071. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1072. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1073. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1074. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1075. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1076. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1077. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1078. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1079. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1080. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1081. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1082. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1083. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1084. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1085. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1086. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1087. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1088. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1089. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1090. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1091. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1092. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1093. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1094. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1095. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1096. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1097. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1098. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1099. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1100. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1101. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1102. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1103. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1104. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1105. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1106. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1107. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1108. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1109. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1110. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1111. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1112. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1113. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1114. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1115. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1116. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1117. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1118. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1119. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1120. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1121. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1122. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1123. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1124. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1125. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1126. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1127. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1128. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1129. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1130. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1131. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1132. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1133. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1134. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1135. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1136. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1137. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1138. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1139. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1140. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1141. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1142. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1143. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1144. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1145. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1146. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1147. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1148. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1149. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1150. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1151. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1152. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1153. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1154. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1155. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1156. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1157. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1158. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1159. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1160. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1161. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1162. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1163. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1164. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1165. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1166. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1167. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1168. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1169. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1170. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1171. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1172. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1173. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1174. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1175. gbinv1.seq - Invertebrate sequence entries, part 1.
1176. gbinv10.seq - Invertebrate sequence entries, part 10.
1177. gbinv11.seq - Invertebrate sequence entries, part 11.
1178. gbinv2.seq - Invertebrate sequence entries, part 2.
1179. gbinv3.seq - Invertebrate sequence entries, part 3.
1180. gbinv4.seq - Invertebrate sequence entries, part 4.
1181. gbinv5.seq - Invertebrate sequence entries, part 5.
1182. gbinv6.seq - Invertebrate sequence entries, part 6.
1183. gbinv7.seq - Invertebrate sequence entries, part 7.
1184. gbinv8.seq - Invertebrate sequence entries, part 8.
1185. gbinv9.seq - Invertebrate sequence entries, part 9.
1186. gbjou1.idx - Index of the entries according to journal citation, part 1.
1187. gbjou2.idx - Index of the entries according to journal citation, part 2.
1188. gbjou3.idx - Index of the entries according to journal citation, part 3.
1189. gbjou4.idx - Index of the entries according to journal citation, part 4.
1190. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1191. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1192. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1193. gbmam1.seq - Other mammalian sequence entries, part 1.
1194. gbmam2.seq - Other mammalian sequence entries, part 2.
1195. gbmam3.seq - Other mammalian sequence entries, part 3.
1196. gbnew.txt - Accession numbers of entries new since the previous release.
1197. gbpat1.seq - Patent sequence entries, part 1.
1198. gbpat10.seq - Patent sequence entries, part 10.
1199. gbpat11.seq - Patent sequence entries, part 11.
1200. gbpat12.seq - Patent sequence entries, part 12.
1201. gbpat13.seq - Patent sequence entries, part 13.
1202. gbpat14.seq - Patent sequence entries, part 14.
1203. gbpat15.seq - Patent sequence entries, part 15.
1204. gbpat16.seq - Patent sequence entries, part 16.
1205. gbpat17.seq - Patent sequence entries, part 17.
1206. gbpat18.seq - Patent sequence entries, part 18.
1207. gbpat19.seq - Patent sequence entries, part 19.
1208. gbpat2.seq - Patent sequence entries, part 2.
1209. gbpat20.seq - Patent sequence entries, part 20.
1210. gbpat21.seq - Patent sequence entries, part 21.
1211. gbpat22.seq - Patent sequence entries, part 22.
1212. gbpat23.seq - Patent sequence entries, part 23.
1213. gbpat24.seq - Patent sequence entries, part 24.
1214. gbpat25.seq - Patent sequence entries, part 25.
1215. gbpat26.seq - Patent sequence entries, part 26.
1216. gbpat27.seq - Patent sequence entries, part 27.
1217. gbpat28.seq - Patent sequence entries, part 28.
1218. gbpat29.seq - Patent sequence entries, part 29.
1219. gbpat3.seq - Patent sequence entries, part 3.
1220. gbpat30.seq - Patent sequence entries, part 30.
1221. gbpat4.seq - Patent sequence entries, part 4.
1222. gbpat5.seq - Patent sequence entries, part 5.
1223. gbpat6.seq - Patent sequence entries, part 6.
1224. gbpat7.seq - Patent sequence entries, part 7.
1225. gbpat8.seq - Patent sequence entries, part 8.
1226. gbpat9.seq - Patent sequence entries, part 9.
1227. gbphg.seq - Phage sequence entries.
1228. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1229. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1230. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1231. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1232. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1233. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1234. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1235. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1236. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1237. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1238. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1239. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1240. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1241. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1242. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1243. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1244. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1245. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1246. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1247. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1248. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1249. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1250. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1251. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1252. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1253. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1254. gbpri1.seq - Primate sequence entries, part 1.
1255. gbpri10.seq - Primate sequence entries, part 10.
1256. gbpri11.seq - Primate sequence entries, part 11.
1257. gbpri12.seq - Primate sequence entries, part 12.
1258. gbpri13.seq - Primate sequence entries, part 13.
1259. gbpri14.seq - Primate sequence entries, part 14.
1260. gbpri15.seq - Primate sequence entries, part 15.
1261. gbpri16.seq - Primate sequence entries, part 16.
1262. gbpri17.seq - Primate sequence entries, part 17.
1263. gbpri18.seq - Primate sequence entries, part 18.
1264. gbpri19.seq - Primate sequence entries, part 19.
1265. gbpri2.seq - Primate sequence entries, part 2.
1266. gbpri20.seq - Primate sequence entries, part 20.
1267. gbpri21.seq - Primate sequence entries, part 21.
1268. gbpri22.seq - Primate sequence entries, part 22.
1269. gbpri23.seq - Primate sequence entries, part 23.
1270. gbpri24.seq - Primate sequence entries, part 24.
1271. gbpri25.seq - Primate sequence entries, part 25.
1272. gbpri26.seq - Primate sequence entries, part 26.
1273. gbpri27.seq - Primate sequence entries, part 27.
1274. gbpri28.seq - Primate sequence entries, part 28.
1275. gbpri29.seq - Primate sequence entries, part 29.
1276. gbpri3.seq - Primate sequence entries, part 3.
1277. gbpri30.seq - Primate sequence entries, part 30.
1278. gbpri31.seq - Primate sequence entries, part 31.
1279. gbpri32.seq - Primate sequence entries, part 32.
1280. gbpri33.seq - Primate sequence entries, part 33.
1281. gbpri34.seq - Primate sequence entries, part 34.
1282. gbpri4.seq - Primate sequence entries, part 4.
1283. gbpri5.seq - Primate sequence entries, part 5.
1284. gbpri6.seq - Primate sequence entries, part 6.
1285. gbpri7.seq - Primate sequence entries, part 7.
1286. gbpri8.seq - Primate sequence entries, part 8.
1287. gbpri9.seq - Primate sequence entries, part 9.
1288. gbrel.txt - Release notes (this document).
1289. gbrod1.seq - Rodent sequence entries, part 1.
1290. gbrod10.seq - Rodent sequence entries, part 10.
1291. gbrod11.seq - Rodent sequence entries, part 11.
1292. gbrod12.seq - Rodent sequence entries, part 12.
1293. gbrod13.seq - Rodent sequence entries, part 13.
1294. gbrod14.seq - Rodent sequence entries, part 14.
1295. gbrod15.seq - Rodent sequence entries, part 15.
1296. gbrod16.seq - Rodent sequence entries, part 16.
1297. gbrod17.seq - Rodent sequence entries, part 17.
1298. gbrod18.seq - Rodent sequence entries, part 18.
1299. gbrod19.seq - Rodent sequence entries, part 19.
1300. gbrod2.seq - Rodent sequence entries, part 2.
1301. gbrod20.seq - Rodent sequence entries, part 20.
1302. gbrod21.seq - Rodent sequence entries, part 21.
1303. gbrod22.seq - Rodent sequence entries, part 22.
1304. gbrod23.seq - Rodent sequence entries, part 23.
1305. gbrod24.seq - Rodent sequence entries, part 24.
1306. gbrod25.seq - Rodent sequence entries, part 25.
1307. gbrod26.seq - Rodent sequence entries, part 26.
1308. gbrod3.seq - Rodent sequence entries, part 3.
1309. gbrod4.seq - Rodent sequence entries, part 4.
1310. gbrod5.seq - Rodent sequence entries, part 5.
1311. gbrod6.seq - Rodent sequence entries, part 6.
1312. gbrod7.seq - Rodent sequence entries, part 7.
1313. gbrod8.seq - Rodent sequence entries, part 8.
1314. gbrod9.seq - Rodent sequence entries, part 9.
1315. gbsdr1.txt - Short directory of the data bank, part 1.
1316. gbsdr2.txt - Short directory of the data bank, part 2.
1317. gbsdr3.txt - Short directory of the data bank, part 3.
1318. gbsec.idx - Index of the entries according to secondary accession number.
1319. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1320. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1321. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1322. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1323. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1324. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1325. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1326. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1327. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1328. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1329. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1330. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1331. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1332. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1333. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1334. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1335. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1336. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1337. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1338. gbuna.seq - Unannotated sequence entries.
1339. gbvrl1.seq - Viral sequence entries, part 1.
1340. gbvrl2.seq - Viral sequence entries, part 2.
1341. gbvrl3.seq - Viral sequence entries, part 3.
1342. gbvrl4.seq - Viral sequence entries, part 4.
1343. gbvrl5.seq - Viral sequence entries, part 5.
1344. gbvrl6.seq - Viral sequence entries, part 6.
1345. gbvrl7.seq - Viral sequence entries, part 7.
1346. gbvrl8.seq - Viral sequence entries, part 8.
1347. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1348. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1349. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1350. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1351. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1352. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1353. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1354. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1355. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1356. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1357. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1358. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1359. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1360. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 161.0 flatfiles require roughly 299 GB (sequence
files only) or 319 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 595647490     gbacc1.idx
1494569481     gbacc2.idx
 550973979     gbacc3.idx
 183864021     gbaut1.idx
 193477968     gbaut10.idx
 247166375     gbaut11.idx
 184540858     gbaut12.idx
 183746125     gbaut13.idx
 183911259     gbaut14.idx
 187292386     gbaut15.idx
 185634500     gbaut16.idx
 183615314     gbaut17.idx
 188312907     gbaut18.idx
 183918981     gbaut19.idx
 183880496     gbaut2.idx
 209915694     gbaut20.idx
 183786693     gbaut21.idx
 183667690     gbaut22.idx
 225528285     gbaut23.idx
 197228582     gbaut24.idx
 198567768     gbaut25.idx
 190234668     gbaut26.idx
 183846986     gbaut27.idx
 217473377     gbaut28.idx
 184239703     gbaut29.idx
 213032074     gbaut3.idx
 184101555     gbaut30.idx
 183782238     gbaut31.idx
 184954370     gbaut32.idx
 183837874     gbaut33.idx
 187161766     gbaut34.idx
 183785648     gbaut35.idx
 251966369     gbaut36.idx
 185676629     gbaut37.idx
 185122260     gbaut38.idx
 252133633     gbaut39.idx
 183766428     gbaut4.idx
 241043348     gbaut40.idx
 249540284     gbaut41.idx
 254395215     gbaut42.idx
 183989857     gbaut43.idx
 183856518     gbaut44.idx
 183875165     gbaut45.idx
 217351962     gbaut46.idx
  82957341     gbaut47.idx
 185596616     gbaut5.idx
 184051751     gbaut6.idx
 183709057     gbaut7.idx
 240976159     gbaut8.idx
 239437084     gbaut9.idx
 260270678     gbbct1.seq
 250420726     gbbct10.seq
 257976005     gbbct11.seq
 251877235     gbbct12.seq
 254031614     gbbct13.seq
 255531725     gbbct14.seq
 266914947     gbbct15.seq
 251518136     gbbct16.seq
 253450956     gbbct17.seq
 254230242     gbbct18.seq
 250595739     gbbct19.seq
 251691117     gbbct2.seq
 253816563     gbbct20.seq
 250001050     gbbct21.seq
 250001021     gbbct22.seq
 250002467     gbbct23.seq
  29056689     gbbct24.seq
 251989929     gbbct3.seq
 250001016     gbbct4.seq
 256072936     gbbct5.seq
 257018026     gbbct6.seq
 252252257     gbbct7.seq
 250260864     gbbct8.seq
 254164244     gbbct9.seq
  13289203     gbchg.txt
 250626943     gbcon1.seq
 257316594     gbcon10.seq
 250004323     gbcon11.seq
 250047112     gbcon12.seq
 250003283     gbcon13.seq
 250003642     gbcon14.seq
 250000750     gbcon15.seq
 250001602     gbcon16.seq
 250006774     gbcon17.seq
 250003661     gbcon18.seq
 250004360     gbcon19.seq
 251258493     gbcon2.seq
 250002526     gbcon20.seq
 250005362     gbcon21.seq
 250001998     gbcon22.seq
 250002095     gbcon23.seq
 250003560     gbcon24.seq
 250000630     gbcon25.seq
 250000491     gbcon26.seq
 250000253     gbcon27.seq
 250001496     gbcon28.seq
 250001287     gbcon29.seq
 250379220     gbcon3.seq
 250003059     gbcon30.seq
 250000171     gbcon31.seq
 250003387     gbcon32.seq
 250000973     gbcon33.seq
 250002202     gbcon34.seq
 250000579     gbcon35.seq
 250000310     gbcon36.seq
 250000894     gbcon37.seq
 250003138     gbcon38.seq
 250000142     gbcon39.seq
 250001411     gbcon4.seq
 250004081     gbcon40.seq
 250002012     gbcon41.seq
 250003747     gbcon42.seq
 250003462     gbcon43.seq
 250001625     gbcon44.seq
 250003798     gbcon45.seq
 250003415     gbcon46.seq
 250002751     gbcon47.seq
 250002734     gbcon48.seq
 250001265     gbcon49.seq
 250000611     gbcon5.seq
 250001399     gbcon50.seq
 250003694     gbcon51.seq
 250001646     gbcon52.seq
 250002752     gbcon53.seq
 250000441     gbcon54.seq
 250002210     gbcon55.seq
 250003173     gbcon56.seq
 250003064     gbcon57.seq
 250000819     gbcon58.seq
 250000722     gbcon59.seq
 250002457     gbcon6.seq
 250000193     gbcon60.seq
 250001639     gbcon61.seq
 250002309     gbcon62.seq
 250001283     gbcon63.seq
 250002616     gbcon64.seq
 250004076     gbcon65.seq
 250000794     gbcon66.seq
 250002872     gbcon67.seq
 250007480     gbcon68.seq
 250004840     gbcon69.seq
 250002666     gbcon7.seq
 250004064     gbcon70.seq
 250002193     gbcon71.seq
 250000245     gbcon72.seq
 250002806     gbcon73.seq
 250001020     gbcon74.seq
 250008969     gbcon75.seq
 250002734     gbcon76.seq
 250006399     gbcon77.seq
 250005675     gbcon78.seq
 250009558     gbcon79.seq
 250000534     gbcon8.seq
 250004695     gbcon80.seq
 250000190     gbcon81.seq
  19154357     gbcon82.seq
 250390283     gbcon9.seq
    333013     gbdel.txt
 250001877     gbenv1.seq
 250000506     gbenv2.seq
 250001291     gbenv3.seq
 250003309     gbenv4.seq
 250001567     gbenv5.seq
 246566610     gbenv6.seq
 230688948     gbest1.seq
 230690211     gbest10.seq
 230690082     gbest100.seq
 230690296     gbest101.seq
 230688631     gbest102.seq
 230691386     gbest103.seq
 230688058     gbest104.seq
 230689930     gbest105.seq
 230689428     gbest106.seq
 230690750     gbest107.seq
 230687754     gbest108.seq
 230688050     gbest109.seq
 230687664     gbest11.seq
 230689088     gbest110.seq
 230690943     gbest111.seq
 230688514     gbest112.seq
 230690027     gbest113.seq
 230689950     gbest114.seq
 230688896     gbest115.seq
 230689360     gbest116.seq
 230649922     gbest117.seq
 230688282     gbest118.seq
 230688780     gbest119.seq
 230688787     gbest12.seq
 230689898     gbest120.seq
 230689228     gbest121.seq
 230689073     gbest122.seq
 230688859     gbest123.seq
 230688193     gbest124.seq
 230690156     gbest125.seq
 230688799     gbest126.seq
 230688255     gbest127.seq
 230689166     gbest128.seq
 230688328     gbest129.seq
 230687733     gbest13.seq
 230690239     gbest130.seq
 230688764     gbest131.seq
 230690416     gbest132.seq
 230688070     gbest133.seq
 230687724     gbest134.seq
 230690068     gbest135.seq
 230689525     gbest136.seq
 230689408     gbest137.seq
 230690414     gbest138.seq
 230690660     gbest139.seq
 230691034     gbest14.seq
 230688140     gbest140.seq
 230688542     gbest141.seq
 230688458     gbest142.seq
 230688670     gbest143.seq
 230690227     gbest144.seq
 230688903     gbest145.seq
 230687606     gbest146.seq
 230689793     gbest147.seq
 230689304     gbest148.seq
 230689147     gbest149.seq
 230687859     gbest15.seq
 230689075     gbest150.seq
 230689181     gbest151.seq
 230688915     gbest152.seq
 230687478     gbest153.seq
 230689712     gbest154.seq
 230688683     gbest155.seq
 230689423     gbest156.seq
 230688062     gbest157.seq
 230688921     gbest158.seq
 230690548     gbest159.seq
 230689432     gbest16.seq
 230690513     gbest160.seq
 230691269     gbest161.seq
 230688111     gbest162.seq
 230688197     gbest163.seq
 230688395     gbest164.seq
 230688572     gbest165.seq
 230689963     gbest166.seq
 230689014     gbest167.seq
 230687783     gbest168.seq
 230690593     gbest169.seq
 230690078     gbest17.seq
 230688883     gbest170.seq
 230690759     gbest171.seq
 230688049     gbest172.seq
 230688916     gbest173.seq
 230687754     gbest174.seq
 230688120     gbest175.seq
 230688013     gbest176.seq
 230688197     gbest177.seq
 230689187     gbest178.seq
 225406245     gbest179.seq
 230688499     gbest18.seq
 230689056     gbest180.seq
 230689811     gbest181.seq
 230687698     gbest182.seq
 230688081     gbest183.seq
 230689179     gbest184.seq
 230694165     gbest185.seq
 230690758     gbest186.seq
 230688666     gbest187.seq
 230690803     gbest188.seq
 230688927     gbest189.seq
 230688215     gbest19.seq
 230692243     gbest190.seq
 230689812     gbest191.seq
 230689248     gbest192.seq
 230688798     gbest193.seq
 230688183     gbest194.seq
 230689840     gbest195.seq
 230689284     gbest196.seq
 230688518     gbest197.seq
 230690150     gbest198.seq
 230688310     gbest199.seq
 230690014     gbest2.seq
 230689587     gbest20.seq
 230688799     gbest200.seq
 230687517     gbest201.seq
 230689700     gbest202.seq
 230689528     gbest203.seq
 230689327     gbest204.seq
 230690845     gbest205.seq
 230690063     gbest206.seq
 230688650     gbest207.seq
 230688218     gbest208.seq
 230688615     gbest209.seq
 230690422     gbest21.seq
 230690194     gbest210.seq
 230688066     gbest211.seq
 230688424     gbest212.seq
 230688207     gbest213.seq
 230688883     gbest214.seq
 230689012     gbest215.seq
 230688474     gbest216.seq
 230687540     gbest217.seq
 230688628     gbest218.seq
 230688297     gbest219.seq
 230688773     gbest22.seq
 230689390     gbest220.seq
 230691002     gbest221.seq
 230690102     gbest222.seq
 230689698     gbest223.seq
 230688900     gbest224.seq
 230689022     gbest225.seq
 230687686     gbest226.seq
 230689940     gbest227.seq
 230688784     gbest228.seq
 207827917     gbest229.seq
 230687447     gbest23.seq
 163061283     gbest230.seq
 162578626     gbest231.seq
 169924735     gbest232.seq
 168808555     gbest233.seq
 165858728     gbest234.seq
 165834553     gbest235.seq
 164880240     gbest236.seq
 164317378     gbest237.seq
 164520996     gbest238.seq
 164240290     gbest239.seq
 230688150     gbest24.seq
 164424971     gbest240.seq
 163311820     gbest241.seq
 167156020     gbest242.seq
 164374306     gbest243.seq
 162152925     gbest244.seq
 165750049     gbest245.seq
 168369501     gbest246.seq
 166596583     gbest247.seq
 165687887     gbest248.seq
 165717360     gbest249.seq
 230688493     gbest25.seq
 165198942     gbest250.seq
 164579193     gbest251.seq
 164256205     gbest252.seq
 164730964     gbest253.seq
 165201393     gbest254.seq
 175701020     gbest255.seq
 175726981     gbest256.seq
 175863438     gbest257.seq
 230691940     gbest258.seq
 230691061     gbest259.seq
 230687701     gbest26.seq
 230688297     gbest260.seq
 230690624     gbest261.seq
 230688257     gbest262.seq
 230690346     gbest263.seq
 230690155     gbest264.seq
 230687950     gbest265.seq
 230688608     gbest266.seq
 230690012     gbest267.seq
 230688016     gbest268.seq
 230688772     gbest269.seq
 230687897     gbest27.seq
 230688722     gbest270.seq
 230689971     gbest271.seq
 230687539     gbest272.seq
 230687968     gbest273.seq
 230689152     gbest274.seq
 230689683     gbest275.seq
 230690563     gbest276.seq
 230690325     gbest277.seq
 230687786     gbest278.seq
 230688968     gbest279.seq
 230688115     gbest28.seq
 230687968     gbest280.seq
 230690890     gbest281.seq
 230687517     gbest282.seq
 230688504     gbest283.seq
 230688003     gbest284.seq
 230688030     gbest285.seq
 230687817     gbest286.seq
 230689584     gbest287.seq
 230690591     gbest288.seq
 212814589     gbest289.seq
 230688729     gbest29.seq
 230688209     gbest290.seq
 230688423     gbest291.seq
 230689041     gbest292.seq
 230688504     gbest293.seq
 230687677     gbest294.seq
 230690503     gbest295.seq
 230690018     gbest296.seq
 230690108     gbest297.seq
 230688011     gbest298.seq
 230688074     gbest299.seq
 230690086     gbest3.seq
 230689830     gbest30.seq
 230688122     gbest300.seq
 230690989     gbest301.seq
 230687749     gbest302.seq
 230687923     gbest303.seq
 230689992     gbest304.seq
 230687714     gbest305.seq
 230688981     gbest306.seq
 230688936     gbest307.seq
 230692002     gbest308.seq
 230687549     gbest309.seq
 230688682     gbest31.seq
 230688735     gbest310.seq
 230690269     gbest311.seq
 230691153     gbest312.seq
 230688495     gbest313.seq
 230689438     gbest314.seq
 230691361     gbest315.seq
 230691591     gbest316.seq
 230690743     gbest317.seq
 230690310     gbest318.seq
 230691040     gbest319.seq
 230690108     gbest32.seq
 230688734     gbest320.seq
 230691077     gbest321.seq
 230688991     gbest322.seq
 230691513     gbest323.seq
 230689476     gbest324.seq
 230688399     gbest325.seq
 230687783     gbest326.seq
 230688086     gbest327.seq
 230690110     gbest328.seq
 230688943     gbest329.seq
 230689805     gbest33.seq
 230687611     gbest330.seq
 230690372     gbest331.seq
 230689328     gbest332.seq
 230688799     gbest333.seq
 230689132     gbest334.seq
 230687690     gbest335.seq
 230687845     gbest336.seq
 230688827     gbest337.seq
 230687702     gbest338.seq
 230689582     gbest339.seq
 230688664     gbest34.seq
 230689722     gbest340.seq
 197122418     gbest341.seq
 230691101     gbest342.seq
 230689349     gbest343.seq
 230689017     gbest344.seq
 230688377     gbest345.seq
 230690848     gbest346.seq
 230689907     gbest347.seq
 143196042     gbest348.seq
 201303471     gbest349.seq
 230688754     gbest35.seq
 230690494     gbest350.seq
 230688916     gbest351.seq
 230689690     gbest352.seq
 230687822     gbest353.seq
 230688421     gbest354.seq
 230691278     gbest355.seq
 230688239     gbest356.seq
 230687717     gbest357.seq
 230689100     gbest358.seq
 230689430     gbest359.seq
 230688267     gbest36.seq
 230687990     gbest360.seq
 230689361     gbest361.seq
 230688785     gbest362.seq
 230687930     gbest363.seq
 230689983     gbest364.seq
 230687572     gbest365.seq
 230691623     gbest366.seq
 230688774     gbest367.seq
 230688834     gbest368.seq
 230689886     gbest369.seq
 230690003     gbest37.seq
 223336441     gbest370.seq
 230688707     gbest371.seq
 230690556     gbest372.seq
 230688718     gbest373.seq
 230688630     gbest374.seq
 230691258     gbest375.seq
 230690353     gbest376.seq
 230689408     gbest377.seq
 230689083     gbest378.seq
 230687857     gbest379.seq
 230689464     gbest38.seq
 230688401     gbest380.seq
 230693167     gbest381.seq
 230691277     gbest382.seq
 230689147     gbest383.seq
 230689112     gbest384.seq
 230690139     gbest385.seq
 230688868     gbest386.seq
 230688714     gbest387.seq
 230687874     gbest388.seq
 230688920     gbest389.seq
 230689158     gbest39.seq
 230688626     gbest390.seq
 230689058     gbest391.seq
 230688784     gbest392.seq
 230690918     gbest393.seq
 230688988     gbest394.seq
 230689152     gbest395.seq
 230688309     gbest396.seq
 222336499     gbest397.seq
 230690902     gbest398.seq
 230688245     gbest399.seq
 230690304     gbest4.seq
 230690839     gbest40.seq
 230689887     gbest400.seq
 230690188     gbest401.seq
 230690142     gbest402.seq
 230688278     gbest403.seq
 230689207     gbest404.seq
 230691224     gbest405.seq
 230688975     gbest406.seq
 230688714     gbest407.seq
 230687460     gbest408.seq
 230690796     gbest409.seq
 230690708     gbest41.seq
 230689421     gbest410.seq
 230687648     gbest411.seq
 230689946     gbest412.seq
 230690072     gbest413.seq
 230688059     gbest414.seq
 230687879     gbest415.seq
 230689856     gbest416.seq
 230689844     gbest417.seq
 230690906     gbest418.seq
 230690644     gbest419.seq
 230011102     gbest42.seq
 230695772     gbest420.seq
 230688538     gbest421.seq
 220665992     gbest422.seq
 210404826     gbest423.seq
 210102002     gbest424.seq
 210383419     gbest425.seq
 210237678     gbest426.seq
 210477156     gbest427.seq
 210410625     gbest428.seq
 212010405     gbest429.seq
 230688399     gbest43.seq
 211584227     gbest430.seq
 211055677     gbest431.seq
 213875319     gbest432.seq
 211833746     gbest433.seq
 210815087     gbest434.seq
 210979333     gbest435.seq
 210821270     gbest436.seq
 210150924     gbest437.seq
 210145781     gbest438.seq
 210283283     gbest439.seq
 214241179     gbest44.seq
 210314084     gbest440.seq
 209774894     gbest441.seq
 230688015     gbest442.seq
 230688184     gbest443.seq
 230689704     gbest444.seq
 230689910     gbest445.seq
 230688443     gbest446.seq
 230688142     gbest447.seq
 230689768     gbest448.seq
 230687532     gbest449.seq
 192220280     gbest45.seq
 230688790     gbest450.seq
 230687890     gbest451.seq
 230691036     gbest452.seq
 230688019     gbest453.seq
 230688190     gbest454.seq
 230691451     gbest455.seq
 230687528     gbest456.seq
 230688479     gbest457.seq
 230688599     gbest458.seq
 230689827     gbest459.seq
 193526106     gbest46.seq
 230690366     gbest460.seq
 230690164     gbest461.seq
 230691748     gbest462.seq
 230690684     gbest463.seq
 230687567     gbest464.seq
 230687503     gbest465.seq
 230688191     gbest466.seq
 230689613     gbest467.seq
 230688042     gbest468.seq
 230687751     gbest469.seq
 217162256     gbest47.seq
 230687790     gbest470.seq
 230690332     gbest471.seq
 230690757     gbest472.seq
 230689226     gbest473.seq
 230690484     gbest474.seq
 230689634     gbest475.seq
 230689220     gbest476.seq
 230689821     gbest477.seq
 230690411     gbest478.seq
 230690751     gbest479.seq
 216175630     gbest48.seq
 230688097     gbest480.seq
 230690783     gbest481.seq
 230689834     gbest482.seq
 230688227     gbest483.seq
 230690635     gbest484.seq
 230688127     gbest485.seq
 230688359     gbest486.seq
 230690719     gbest487.seq
 230691362     gbest488.seq
 230689135     gbest489.seq
 216019919     gbest49.seq
 230690607     gbest490.seq
 230689879     gbest491.seq
 230689078     gbest492.seq
 230688401     gbest493.seq
 230688689     gbest494.seq
 227312840     gbest495.seq
 230691546     gbest496.seq
 230690519     gbest497.seq
 230690869     gbest498.seq
 230689729     gbest499.seq
 164122838     gbest5.seq
 216888618     gbest50.seq
 230691222     gbest500.seq
 230689377     gbest501.seq
 230690474     gbest502.seq
 230689920     gbest503.seq
 230688869     gbest504.seq
 230688546     gbest505.seq
 230688077     gbest506.seq
 230688043     gbest507.seq
 230688475     gbest508.seq
 224989949     gbest509.seq
 230688968     gbest51.seq
 223359641     gbest510.seq
 230689450     gbest511.seq
 230689414     gbest512.seq
 230689841     gbest513.seq
 230689851     gbest514.seq
 230690982     gbest515.seq
 230687978     gbest516.seq
 230688821     gbest517.seq
 230689725     gbest518.seq
 230691272     gbest519.seq
 230687673     gbest52.seq
 230688234     gbest520.seq
 230689674     gbest521.seq
 230688804     gbest522.seq
 230687725     gbest523.seq
 218359203     gbest524.seq
 196069217     gbest525.seq
 230176774     gbest526.seq
 230688430     gbest527.seq
 230687958     gbest528.seq
 230689940     gbest529.seq
 230689031     gbest53.seq
 230687616     gbest530.seq
 230687748     gbest531.seq
 230689068     gbest532.seq
 230687820     gbest533.seq
 230688259     gbest534.seq
 230688840     gbest535.seq
 230687473     gbest536.seq
 230689288     gbest537.seq
 230689183     gbest538.seq
 221862881     gbest539.seq
 222073416     gbest54.seq
 227072080     gbest540.seq
 230687703     gbest541.seq
 230689474     gbest542.seq
 230689245     gbest543.seq
 230689790     gbest544.seq
 230687953     gbest545.seq
 230687467     gbest546.seq
 220021305     gbest547.seq
 230687852     gbest548.seq
 230687818     gbest549.seq
 230689946     gbest55.seq
 230688113     gbest550.seq
 230689156     gbest551.seq
 230689935     gbest552.seq
 230689357     gbest553.seq
 230687458     gbest554.seq
 230689218     gbest555.seq
 230688928     gbest556.seq
 230689491     gbest557.seq
 230690297     gbest558.seq
 230688491     gbest559.seq
 230688653     gbest56.seq
 230688471     gbest560.seq
 230689769     gbest561.seq
 230687798     gbest562.seq
 230687595     gbest563.seq
 230689250     gbest564.seq
 230690102     gbest565.seq
 230687698     gbest566.seq
 230689307     gbest567.seq
 230687968     gbest568.seq
 230690312     gbest569.seq
 230691197     gbest57.seq
 230688752     gbest570.seq
 230687679     gbest571.seq
 230688618     gbest572.seq
 230687622     gbest573.seq
 230687536     gbest574.seq
 230688736     gbest575.seq
 230687687     gbest576.seq
 230688529     gbest577.seq
 230689059     gbest578.seq
 230690433     gbest579.seq
 230691189     gbest58.seq
 230690884     gbest580.seq
 230687841     gbest581.seq
 230687671     gbest582.seq
 230690105     gbest583.seq
 230690550     gbest584.seq
 230691460     gbest585.seq
 230689174     gbest586.seq
 230690658     gbest587.seq
 230688888     gbest588.seq
 230688741     gbest589.seq
 230688565     gbest59.seq
 230687945     gbest590.seq
 230689062     gbest591.seq
 230687993     gbest592.seq
 230689007     gbest593.seq
 230689102     gbest594.seq
 230687715     gbest595.seq
 230687921     gbest596.seq
 230689415     gbest597.seq
 230688000     gbest598.seq
 230688394     gbest599.seq
 177441792     gbest6.seq
 230688139     gbest60.seq
 230690738     gbest600.seq
 230690998     gbest601.seq
 230687587     gbest602.seq
 230688329     gbest603.seq
 230689597     gbest604.seq
 230689740     gbest605.seq
 230689776     gbest606.seq
 230688148     gbest607.seq
 230689257     gbest608.seq
 230690559     gbest609.seq
 230691781     gbest61.seq
 230687919     gbest610.seq
 230688431     gbest611.seq
 230690152     gbest612.seq
 230689617     gbest613.seq
 230690380     gbest614.seq
 230688500     gbest615.seq
 217222328     gbest616.seq
 230687533     gbest617.seq
 229590276     gbest618.seq
 189396953     gbest619.seq
 230688372     gbest62.seq
 189142872     gbest620.seq
 191802005     gbest621.seq
 191041703     gbest622.seq
 190178710     gbest623.seq
 190455388     gbest624.seq
 191777254     gbest625.seq
 190486940     gbest626.seq
 189940737     gbest627.seq
 223476063     gbest628.seq
 230689867     gbest629.seq
 230688089     gbest63.seq
 230689753     gbest630.seq
 230689240     gbest631.seq
 230688656     gbest632.seq
 215382116     gbest633.seq
 230690683     gbest634.seq
 152465416     gbest635.seq
 230688493     gbest64.seq
 230689677     gbest65.seq
 230688808     gbest66.seq
 230690345     gbest67.seq
 230688984     gbest68.seq
 230687747     gbest69.seq
 230690509     gbest7.seq
 230688325     gbest70.seq
 209739209     gbest71.seq
 209425297     gbest72.seq
 208401422     gbest73.seq
 209184260     gbest74.seq
 209947448     gbest75.seq
 210131076     gbest76.seq
 209263852     gbest77.seq
 208835832     gbest78.seq
 210220921     gbest79.seq
 230689080     gbest8.seq
 208073319     gbest80.seq
 205510742     gbest81.seq
 208467312     gbest82.seq
 208294136     gbest83.seq
 211916206     gbest84.seq
 227522630     gbest85.seq
 230689770     gbest86.seq
 230688932     gbest87.seq
 219635649     gbest88.seq
 214801083     gbest89.seq
 230688805     gbest9.seq
 214732645     gbest90.seq
 230690858     gbest91.seq
 230690432     gbest92.seq
 230689823     gbest93.seq
 230687807     gbest94.seq
 230688944     gbest95.seq
 230689712     gbest96.seq
 230690639     gbest97.seq
 230689823     gbest98.seq
 230689388     gbest99.seq
  70299220     gbgen.idx
 230689631     gbgss1.seq
 230688990     gbgss10.seq
 230690101     gbgss100.seq
 227773224     gbgss101.seq
 228835127     gbgss102.seq
 228544644     gbgss103.seq
 228593160     gbgss104.seq
 227732342     gbgss105.seq
 230689114     gbgss106.seq
 230688747     gbgss107.seq
 230688043     gbgss108.seq
 230688443     gbgss109.seq
 230687697     gbgss11.seq
 230688393     gbgss110.seq
 230687682     gbgss111.seq
 230688948     gbgss112.seq
 230688758     gbgss113.seq
 230688996     gbgss114.seq
 230687891     gbgss115.seq
 230687983     gbgss116.seq
 230689979     gbgss117.seq
 230689689     gbgss118.seq
 230689349     gbgss119.seq
 230688133     gbgss12.seq
 230687935     gbgss120.seq
 230688241     gbgss121.seq
 230689862     gbgss122.seq
 230689903     gbgss123.seq
 230687983     gbgss124.seq
 230688210     gbgss125.seq
 230689610     gbgss126.seq
 230687940     gbgss127.seq
 230687775     gbgss128.seq
 230688870     gbgss129.seq
 230689916     gbgss13.seq
 230688140     gbgss130.seq
 230688865     gbgss131.seq
 230688806     gbgss132.seq
 230688509     gbgss133.seq
 230689780     gbgss134.seq
 230688427     gbgss135.seq
 230689557     gbgss136.seq
 230687666     gbgss137.seq
 230689810     gbgss138.seq
 230688427     gbgss139.seq
 230690192     gbgss14.seq
 230687532     gbgss140.seq
 230688375     gbgss141.seq
 230688918     gbgss142.seq
 230690436     gbgss143.seq
 230688190     gbgss144.seq
 224192950     gbgss145.seq
 230688936     gbgss146.seq
 230691687     gbgss147.seq
 210524063     gbgss148.seq
 230688095     gbgss149.seq
 230688237     gbgss15.seq
 230688223     gbgss150.seq
 230688513     gbgss151.seq
 230687643     gbgss152.seq
 230689872     gbgss153.seq
 230689940     gbgss154.seq
 230689467     gbgss155.seq
 230690048     gbgss156.seq
 230688544     gbgss157.seq
 230689783     gbgss158.seq
 230687554     gbgss159.seq
 230690298     gbgss16.seq
 230688784     gbgss160.seq
 230689371     gbgss161.seq
 230688017     gbgss162.seq
 230687829     gbgss163.seq
 230687907     gbgss164.seq
 230688155     gbgss165.seq
 230688935     gbgss166.seq
 230687709     gbgss167.seq
 230689735     gbgss168.seq
 230689051     gbgss169.seq
 230689871     gbgss17.seq
 230689079     gbgss170.seq
 211594711     gbgss171.seq
 207690338     gbgss172.seq
 210610770     gbgss173.seq
 210598491     gbgss174.seq
 209498820     gbgss175.seq
 209145573     gbgss176.seq
 207391371     gbgss177.seq
 207330367     gbgss178.seq
 207589928     gbgss179.seq
 230689025     gbgss18.seq
 209964424     gbgss180.seq
 209316086     gbgss181.seq
 207560951     gbgss182.seq
 205670190     gbgss183.seq
 205670934     gbgss184.seq
 205301625     gbgss185.seq
 205405536     gbgss186.seq
 205087396     gbgss187.seq
 207039320     gbgss188.seq
 207565021     gbgss189.seq
 230690179     gbgss19.seq
 208491141     gbgss190.seq
 207768593     gbgss191.seq
 208180891     gbgss192.seq
 208734891     gbgss193.seq
 208844584     gbgss194.seq
 208263633     gbgss195.seq
 205871127     gbgss196.seq
 206091399     gbgss197.seq
 206167093     gbgss198.seq
 205320966     gbgss199.seq
 230687773     gbgss2.seq
 230687622     gbgss20.seq
 206877128     gbgss200.seq
 207126094     gbgss201.seq
 207220131     gbgss202.seq
 207137948     gbgss203.seq
 207248573     gbgss204.seq
 206947455     gbgss205.seq
 207158034     gbgss206.seq
 206872858     gbgss207.seq
 206874191     gbgss208.seq
 207051181     gbgss209.seq
 230689903     gbgss21.seq
 207339517     gbgss210.seq
 208150304     gbgss211.seq
 210102961     gbgss212.seq
 209973084     gbgss213.seq
 209376727     gbgss214.seq
 211648524     gbgss215.seq
 218857795     gbgss216.seq
 220296078     gbgss217.seq
 230689844     gbgss218.seq
 230689648     gbgss219.seq
 230689122     gbgss22.seq
  56740687     gbgss220.seq
 250002696     gbgss221.seq
 250000084     gbgss222.seq
 250001637     gbgss223.seq
 250001185     gbgss224.seq
 250001961     gbgss225.seq
 250003415     gbgss226.seq
 250002426     gbgss227.seq
 250000926     gbgss228.seq
 250000185     gbgss229.seq
 230688286     gbgss23.seq
 250002501     gbgss230.seq
 250001728     gbgss231.seq
 250001061     gbgss232.seq
 250003223     gbgss233.seq
 250001214     gbgss234.seq
 250000384     gbgss235.seq
 250000380     gbgss236.seq
 250000317     gbgss237.seq
 250001233     gbgss238.seq
 250001837     gbgss239.seq
 230688682     gbgss24.seq
 250001832     gbgss240.seq
 250000354     gbgss241.seq
 250001206     gbgss242.seq
 250000464     gbgss243.seq
 250002897     gbgss244.seq
 250000911     gbgss245.seq
 250002186     gbgss246.seq
 250000690     gbgss247.seq
 250000496     gbgss248.seq
 250000358     gbgss249.seq
 230687623     gbgss25.seq
 250002259     gbgss250.seq
 250000396     gbgss251.seq
 250001270     gbgss252.seq
 250000655     gbgss253.seq
 250001707     gbgss254.seq
 250001261     gbgss255.seq
 250000680     gbgss256.seq
 250002608     gbgss257.seq
 250002176     gbgss258.seq
 250002308     gbgss259.seq
 230690034     gbgss26.seq
 250000604     gbgss260.seq
 250001263     gbgss261.seq
 250000193     gbgss262.seq
 250003158     gbgss263.seq
  84269524     gbgss264.seq
 230689447     gbgss27.seq
 230690553     gbgss28.seq
 230688763     gbgss29.seq
 230690143     gbgss3.seq
 230690445     gbgss30.seq
 230690124     gbgss31.seq
 230688264     gbgss32.seq
 230687623     gbgss33.seq
 230689148     gbgss34.seq
 230687994     gbgss35.seq
 230687902     gbgss36.seq
 230688853     gbgss37.seq
 230688577     gbgss38.seq
 230690882     gbgss39.seq
 230690055     gbgss4.seq
 230689221     gbgss40.seq
 230689706     gbgss41.seq
 230688291     gbgss42.seq
 230690000     gbgss43.seq
 230689090     gbgss44.seq
 230687775     gbgss45.seq
 230690054     gbgss46.seq
 230689912     gbgss47.seq
 230688216     gbgss48.seq
 230687721     gbgss49.seq
 230687548     gbgss5.seq
 230689649     gbgss50.seq
 230687581     gbgss51.seq
 230689939     gbgss52.seq
 230689142     gbgss53.seq
 230690024     gbgss54.seq
 230687647     gbgss55.seq
 230688469     gbgss56.seq
 230690060     gbgss57.seq
 230689017     gbgss58.seq
 230689559     gbgss59.seq
 230689498     gbgss6.seq
 230688329     gbgss60.seq
 228964074     gbgss61.seq
 230688694     gbgss62.seq
 230688955     gbgss63.seq
 230688212     gbgss64.seq
 230688876     gbgss65.seq
 230689217     gbgss66.seq
 230688149     gbgss67.seq
 230687538     gbgss68.seq
 230687844     gbgss69.seq
 230690186     gbgss7.seq
 230688832     gbgss70.seq
 230689447     gbgss71.seq
 230689567     gbgss72.seq
 230689058     gbgss73.seq
 230688568     gbgss74.seq
 230688333     gbgss75.seq
 230687441     gbgss76.seq
 230689745     gbgss77.seq
 230688635     gbgss78.seq
 230688734     gbgss79.seq
 230689868     gbgss8.seq
 230688923     gbgss80.seq
 225860965     gbgss81.seq
 194152518     gbgss82.seq
 194328850     gbgss83.seq
 230689279     gbgss84.seq
 230688815     gbgss85.seq
 230688546     gbgss86.seq
 230690084     gbgss87.seq
 230689441     gbgss88.seq
 230687988     gbgss89.seq
 230688713     gbgss9.seq
 230689138     gbgss90.seq
 230688167     gbgss91.seq
 230687492     gbgss92.seq
 230687946     gbgss93.seq
 230688805     gbgss94.seq
 230688249     gbgss95.seq
 230689611     gbgss96.seq
 230689764     gbgss97.seq
 230689491     gbgss98.seq
 230688294     gbgss99.seq
 250009676     gbhtc1.seq
 250001380     gbhtc10.seq
 250002181     gbhtc11.seq
 172744890     gbhtc12.seq
 250003026     gbhtc2.seq
 250007563     gbhtc3.seq
 250001027     gbhtc4.seq
 250013856     gbhtc5.seq
 250002649     gbhtc6.seq
 250003024     gbhtc7.seq
 250005251     gbhtc8.seq
 250002550     gbhtc9.seq
 250096231     gbhtg1.seq
 250059722     gbhtg10.seq
 250129582     gbhtg11.seq
 250063944     gbhtg12.seq
 250231891     gbhtg13.seq
 250295339     gbhtg14.seq
 250227804     gbhtg15.seq
 250068671     gbhtg16.seq
 250215575     gbhtg17.seq
 250140996     gbhtg18.seq
 250157427     gbhtg19.seq
 250020784     gbhtg2.seq
 250008649     gbhtg20.seq
 250296875     gbhtg21.seq
 250298095     gbhtg22.seq
 250035446     gbhtg23.seq
 250154109     gbhtg24.seq
 250245675     gbhtg25.seq
 250060935     gbhtg26.seq
 250053531     gbhtg27.seq
 250298768     gbhtg28.seq
 250050062     gbhtg29.seq
 250039037     gbhtg3.seq
 250178611     gbhtg30.seq
 250048075     gbhtg31.seq
 250260909     gbhtg32.seq
 250053651     gbhtg33.seq
 250328400     gbhtg34.seq
 250157249     gbhtg35.seq
 250031551     gbhtg36.seq
 250219249     gbhtg37.seq
 250160957     gbhtg38.seq
 250011987     gbhtg39.seq
 250101894     gbhtg4.seq
 250107751     gbhtg40.seq
 250111323     gbhtg41.seq
 250121950     gbhtg42.seq
 250301163     gbhtg43.seq
 250363391     gbhtg44.seq
 250018253     gbhtg45.seq
 250001520     gbhtg46.seq
 250289428     gbhtg47.seq
 250090035     gbhtg48.seq
 250232367     gbhtg49.seq
 250209185     gbhtg5.seq
 250120806     gbhtg50.seq
 250090052     gbhtg51.seq
 250008804     gbhtg52.seq
 250050300     gbhtg53.seq
 250224716     gbhtg54.seq
 250175332     gbhtg55.seq
 250206109     gbhtg56.seq
 250173164     gbhtg57.seq
 250229161     gbhtg58.seq
 250225972     gbhtg59.seq
 250053402     gbhtg6.seq
 250167967     gbhtg60.seq
 250121062     gbhtg61.seq
 250149700     gbhtg62.seq
 250099420     gbhtg63.seq
 250008284     gbhtg64.seq
 250203136     gbhtg65.seq
 250158697     gbhtg66.seq
 250045718     gbhtg67.seq
 250112312     gbhtg68.seq
 250119789     gbhtg69.seq
 250004219     gbhtg7.seq
 250044221     gbhtg70.seq
 250025935     gbhtg71.seq
 250014589     gbhtg72.seq
 250225598     gbhtg73.seq
 250050699     gbhtg74.seq
 250149153     gbhtg75.seq
 250077133     gbhtg76.seq
 250181291     gbhtg77.seq
 250077523     gbhtg78.seq
 250182635     gbhtg79.seq
 250124023     gbhtg8.seq
 250173453     gbhtg80.seq
 250130641     gbhtg81.seq
 250034196     gbhtg82.seq
 250209694     gbhtg83.seq
 250023295     gbhtg84.seq
 250149084     gbhtg85.seq
 250180112     gbhtg86.seq
 250172814     gbhtg87.seq
 250019641     gbhtg88.seq
 250154300     gbhtg89.seq
 250009914     gbhtg9.seq
 250005333     gbhtg90.seq
 250361632     gbhtg91.seq
 252166652     gbhtg92.seq
 250149752     gbhtg93.seq
 250170284     gbhtg94.seq
 250028376     gbhtg95.seq
 250148089     gbhtg96.seq
 250050836     gbhtg97.seq
 115025280     gbhtg98.seq
 250203670     gbinv1.seq
 250035361     gbinv10.seq
  52277582     gbinv11.seq
 250036318     gbinv2.seq
 250001954     gbinv3.seq
 250003574     gbinv4.seq
 250347051     gbinv5.seq
 250000216     gbinv6.seq
 250002705     gbinv7.seq
 250001440     gbinv8.seq
 250000053     gbinv9.seq
 146444414     gbjou1.idx
 139176442     gbjou2.idx
 234916175     gbjou3.idx
 229007465     gbjou4.idx
 185229148     gbkey1.idx
 199637105     gbkey2.idx
   4660297     gbkey3.idx
 250001709     gbmam1.seq
 250054770     gbmam2.seq
 240090064     gbmam3.seq
  50909964     gbnew.txt
 250000281     gbpat1.seq
 250005173     gbpat10.seq
 250000336     gbpat11.seq
 250000589     gbpat12.seq
 250000904     gbpat13.seq
 250000502     gbpat14.seq
 250000650     gbpat15.seq
 250000301     gbpat16.seq
 250003589     gbpat17.seq
 250001863     gbpat18.seq
 250000611     gbpat19.seq
 250000203     gbpat2.seq
 250001141     gbpat20.seq
 250000837     gbpat21.seq
 250158559     gbpat22.seq
 250000369     gbpat23.seq
 250000460     gbpat24.seq
 250000870     gbpat25.seq
 250005853     gbpat26.seq
 250000069     gbpat27.seq
 250097392     gbpat28.seq
 250000926     gbpat29.seq
 250003352     gbpat3.seq
 126429885     gbpat30.seq
 250002405     gbpat4.seq
 250000083     gbpat5.seq
 250000371     gbpat6.seq
 250000232     gbpat7.seq
 250002540     gbpat8.seq
 250001007     gbpat9.seq
  60587477     gbphg.seq
 250062920     gbpln1.seq
 250002254     gbpln10.seq
 250003109     gbpln11.seq
 250011245     gbpln12.seq
 250173651     gbpln13.seq
 250033736     gbpln14.seq
 250125798     gbpln15.seq
 281442227     gbpln16.seq
 286496489     gbpln17.seq
 250001263     gbpln18.seq
 250000351     gbpln19.seq
 250028960     gbpln2.seq
 250004247     gbpln20.seq
 250732540     gbpln21.seq
 250002123     gbpln22.seq
 250002131     gbpln23.seq
 250002238     gbpln24.seq
 250005203     gbpln25.seq
  37443173     gbpln26.seq
 250195906     gbpln3.seq
 250001287     gbpln4.seq
 250035061     gbpln5.seq
 250099512     gbpln6.seq
 250005580     gbpln7.seq
 250113107     gbpln8.seq
 250089870     gbpln9.seq
 250112352     gbpri1.seq
 250037795     gbpri10.seq
 250160888     gbpri11.seq
 250036136     gbpri12.seq
 250135181     gbpri13.seq
 250086757     gbpri14.seq
 250209814     gbpri15.seq
 250114771     gbpri16.seq
 250028987     gbpri17.seq
 250000417     gbpri18.seq
 250002461     gbpri19.seq
 250014330     gbpri2.seq
 250000569     gbpri20.seq
 250003312     gbpri21.seq
 250103019     gbpri22.seq
 250114156     gbpri23.seq
 250010595     gbpri24.seq
 250012568     gbpri25.seq
 250093983     gbpri26.seq
 250036068     gbpri27.seq
 250000786     gbpri28.seq
 250005126     gbpri29.seq
 250139341     gbpri3.seq
 250061976     gbpri30.seq
 250001040     gbpri31.seq
 250090809     gbpri32.seq
 250019508     gbpri33.seq
  28426628     gbpri34.seq
 250127050     gbpri4.seq
 250206444     gbpri5.seq
 250156625     gbpri6.seq
 250141655     gbpri7.seq
 250176569     gbpri8.seq
 250173884     gbpri9.seq
    279173     gbrel.txt
 250229163     gbrod1.seq
 250002016     gbrod10.seq
 250219417     gbrod11.seq
 250185262     gbrod12.seq
 250149963     gbrod13.seq
 250250783     gbrod14.seq
 250074249     gbrod15.seq
 250221637     gbrod16.seq
 250000035     gbrod17.seq
 250131379     gbrod18.seq
 250150976     gbrod19.seq
 250042335     gbrod2.seq
 250078194     gbrod20.seq
 250005132     gbrod21.seq
 250004056     gbrod22.seq
 250222260     gbrod23.seq
 250000782     gbrod24.seq
 250000091     gbrod25.seq
  14573155     gbrod26.seq
 250047383     gbrod3.seq
 250146758     gbrod4.seq
 250123720     gbrod5.seq
 250222732     gbrod6.seq
 250023946     gbrod7.seq
 250172847     gbrod8.seq
 250117247     gbrod9.seq
1134284982     gbsdr1.txt
3633277814     gbsdr2.txt
1654474957     gbsdr3.txt
  96051016     gbsec.idx
 250001929     gbsts1.seq
 250000061     gbsts10.seq
 250004030     gbsts11.seq
 250002193     gbsts12.seq
 250003460     gbsts13.seq
 189300306     gbsts14.seq
 250001367     gbsts2.seq
 250001032     gbsts3.seq
 250001144     gbsts4.seq
 250001827     gbsts5.seq
 250002364     gbsts6.seq
 250001054     gbsts7.seq
 250000861     gbsts8.seq
 250002460     gbsts9.seq
 250000124     gbsyn1.seq
 250000252     gbsyn2.seq
 250002815     gbsyn3.seq
 250000758     gbsyn4.seq
  36304508     gbsyn5.seq
    422715     gbuna.seq
 250000484     gbvrl1.seq
 250000008     gbvrl2.seq
 250001066     gbvrl3.seq
 250003151     gbvrl4.seq
 250000516     gbvrl5.seq
 250005795     gbvrl6.seq
 250001242     gbvrl7.seq
   7530515     gbvrl8.seq
 250108471     gbvrt1.seq
 250019203     gbvrt10.seq
 250048476     gbvrt11.seq
 250001436     gbvrt12.seq
 250048910     gbvrt13.seq
  97059266     gbvrt14.seq
 250001339     gbvrt2.seq
 250218053     gbvrt3.seq
 250000212     gbvrt4.seq
 250003252     gbvrt5.seq
 250032037     gbvrt6.seq
 250175888     gbvrt7.seq
 250067855     gbvrt8.seq
 250034035     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         30781      105745175
BCT10        184        98369365
BCT11        93         111695482
BCT12        46         112988402
BCT13        54         114935705
BCT14        58         118953436
BCT15        71         121564265
BCT16        46         111433948
BCT17        43         111454547
BCT18        60         111634199
BCT19        70         111471083
BCT2         4306       109307157
BCT20        54         110929845
BCT21        1332       103231294
BCT22        70692      85243116
BCT23        52712      90838163
BCT24        3833       10212756
BCT3         160        112232466
BCT4         23022      104062033
BCT5         54381      87629666
BCT6         5423       98413747
BCT7         13755      101262816
BCT8         41831      96925033
BCT9         27620      104680758
ENV1         91007      71076121
ENV2         95863      72372453
ENV3         87123      81457214
ENV4         90919      84788162
ENV5         139133     25252004
ENV6         95982      68025677
EST1         68126      26289737
EST10        76542      29846223
EST100       70769      36501317
EST101       74600      36430441
EST102       72934      41050038
EST103       74293      38619964
EST104       70770      39628141
EST105       68654      37233583
EST106       73343      36503244
EST107       71848      45840723
EST108       72454      45918346
EST109       69884      43313114
EST11        75113      28770331
EST110       73104      33104794
EST111       69908      29446430
EST112       66809      36902596
EST113       68271      36782429
EST114       68640      41702634
EST115       72228      37543575
EST116       75131      34561342
EST117       74516      27287979
EST118       73791      33484979
EST119       73623      36597386
EST12        77564      30747740
EST120       65060      36060313
EST121       80236      45257464
EST122       78266      43276338
EST123       68428      47878061
EST124       68082      39566629
EST125       74538      51210568
EST126       69136      41610847
EST127       74082      44936226
EST128       74271      45566809
EST129       71198      49048096
EST13        76997      29271178
EST130       73086      47986374
EST131       78895      45039989
EST132       75051      31190804
EST133       78060      33347378
EST134       79409      46344516
EST135       74768      42727416
EST136       64532      35099618
EST137       71133      36598821
EST138       67518      36814163
EST139       65996      36483046
EST14        78507      31805402
EST140       71503      43954948
EST141       72791      45454917
EST142       67776      39294885
EST143       68393      39690100
EST144       74933      45508564
EST145       67816      39937205
EST146       62003      35292222
EST147       99172      53957228
EST148       79726      45725747
EST149       83699      43468332
EST15        74647      31548950
EST150       103909     54867851
EST151       105774     57650471
EST152       98875      56210507
EST153       73595      44357644
EST154       93836      55622700
EST155       98811      59049510
EST156       92843      55304655
EST157       77368      43922758
EST158       68981      38621137
EST159       66016      30381022
EST16        75797      33340438
EST160       60847      27746791
EST161       56365      27481669
EST162       65090      31406764
EST163       55089      27746429
EST164       77697      50484567
EST165       67415      38730457
EST166       72029      51911059
EST167       73794      42186290
EST168       59959      30207468
EST169       63670      35542841
EST17        82206      33936328
EST170       65344      35244807
EST171       63921      45619098
EST172       62676      36064841
EST173       104004     46467348
EST174       86496      51083404
EST175       99391      57063410
EST176       100574     57548609
EST177       97306      51645588
EST178       81158      39172001
EST179       91119      38380335
EST18        80842      32238230
EST180       94773      50621974
EST181       89007      35466812
EST182       95601      41738881
EST183       65477      40881425
EST184       68571      40311485
EST185       62005      36207974
EST186       67873      43661255
EST187       69456      29882473
EST188       77021      34480478
EST189       67461      41984381
EST19        78533      31810822
EST190       80853      39916927
EST191       63654      33002866
EST192       68182      49119862
EST193       69179      45766512
EST194       67939      36087736
EST195       68886      44518969
EST196       68726      53105875
EST197       69346      35214538
EST198       70730      41256337
EST199       69848      59935080
EST2         74651      28647346
EST20        74690      30662557
EST200       65264      48404491
EST201       63720      46379514
EST202       63241      46868752
EST203       65202      45412945
EST204       65090      47346863
EST205       63807      46525201
EST206       62089      37505877
EST207       63874      34132409
EST208       63134      36878802
EST209       84727      47722211
EST21        73819      34318970
EST210       83923      54776676
EST211       69591      40693856
EST212       106278     66634002
EST213       108406     65414361
EST214       108988     64546630
EST215       103480     66735253
EST216       107075     59410643
EST217       106609     50389553
EST218       85739      52143672
EST219       91747      42558733
EST22        75251      30166768
EST220       90115      43932054
EST221       75006      49821060
EST222       66858      40627989
EST223       68376      57247454
EST224       68081      58790833
EST225       77091      43592371
EST226       82097      43222672
EST227       74602      53597887
EST228       71071      51156120
EST229       51936      30680789
EST23        77343      32670341
EST230       27761      10561036
EST231       27795      10290088
EST232       26548      9860852
EST233       26784      9198824
EST234       27323      9338709
EST235       27098      10242865
EST236       27177      9725751
EST237       27273      10174778
EST238       27159      11854470
EST239       27205      11313334
EST24        74792      32883879
EST240       27253      10411688
EST241       27567      9395906
EST242       26998      9131108
EST243       27511      11143168
EST244       27875      10739014
EST245       27291      11164492
EST246       26622      11886743
EST247       26935      11531252
EST248       27085      10740657
EST249       26984      11461138
EST25        73913      31818349
EST250       27116      11635234
EST251       27252      11275833
EST252       27267      10805501
EST253       27214      10688927
EST254       27154      10644393
EST255       25291      16299741
EST256       25256      16647684
EST257       33349      18635234
EST258       95779      43128182
EST259       43464      28445986
EST26        75324      31130636
EST260       104486     40979831
EST261       71466      38955661
EST262       68598      44579580
EST263       69346      44630278
EST264       69101      44354303
EST265       65358      38694887
EST266       77428      44581357
EST267       63768      45922058
EST268       65921      37161938
EST269       70400      35429596
EST27        74505      32463178
EST270       102292     47020681
EST271       78362      43622750
EST272       69366      35731380
EST273       66488      32092117
EST274       70061      41904674
EST275       71268      34252376
EST276       68918      33155001
EST277       76822      47672868
EST278       62961      35453416
EST279       68352      39050382
EST28        108109     51184832
EST280       78187      39080782
EST281       79940      44717094
EST282       74583      49788843
EST283       78268      54057894
EST284       104219     49002478
EST285       91026      44891322
EST286       74899      43558345
EST287       70363      44750014
EST288       74488      34256001
EST289       70362      30326918
EST29        97074      45969757
EST290       71406      37467721
EST291       63654      36785792
EST292       60562      39175535
EST293       73558      42785716
EST294       62102      43555640
EST295       61137      33449299
EST296       84298      43741213
EST297       83770      40769680
EST298       71785      46614257
EST299       103733     58351813
EST3         73738      29918375
EST30        98314      53741741
EST300       121528     47704416
EST301       82716      38541890
EST302       65727      35362063
EST303       71518      45636363
EST304       80531      41226372
EST305       70944      41938803
EST306       70475      40756391
EST307       63509      35516193
EST308       61368      37256888
EST309       53298      30096565
EST31        83895      48572455
EST310       72248      52285377
EST311       74103      44073184
EST312       71105      41607784
EST313       68598      36185755
EST314       63431      33001457
EST315       53965      27128922
EST316       53044      27633480
EST317       53058      28227415
EST318       51837      27416921
EST319       53195      27889385
EST32        65535      46132951
EST320       55798      23819802
EST321       55585      23702605
EST322       54288      22277577
EST323       55519      21519871
EST324       54812      21857609
EST325       56367      22698877
EST326       54881      21416309
EST327       56116      20235671
EST328       62022      29545269
EST329       76478      39111609
EST33        72763      55063758
EST330       74457      33909885
EST331       76536      31875979
EST332       74153      31113758
EST333       87715      54768885
EST334       70347      54923740
EST335       88013      54410718
EST336       93211      55899040
EST337       95235      56297038
EST338       101255     56532067
EST339       97957      55506018
EST34        85396      48208266
EST340       67482      37596780
EST341       69541      36728845
EST342       70694      45884392
EST343       65295      52415670
EST344       61629      46984628
EST345       63654      37998339
EST346       67577      43695748
EST347       70993      44758950
EST348       47945      24090303
EST349       57629      30685368
EST35        86480      43988556
EST350       73703      38991833
EST351       56559      28368633
EST352       66309      39590559
EST353       67508      43176209
EST354       83570      40558134
EST355       67862      42499406
EST356       70994      41523641
EST357       65001      39070777
EST358       72608      45696870
EST359       86435      49087914
EST36        94995      51800390
EST360       86745      50199105
EST361       71459      38787355
EST362       58697      37058074
EST363       74864      37715680
EST364       58959      31106600
EST365       49352      25810031
EST366       72665      40469106
EST367       82201      45815437
EST368       96902      48057550
EST369       67711      47338943
EST37        84968      59183949
EST370       68134      44122144
EST371       68669      41507238
EST372       60760      34576656
EST373       89602      38189160
EST374       68451      40353881
EST375       52831      37346658
EST376       63493      37775327
EST377       64334      42399491
EST378       98111      53808958
EST379       73609      39503927
EST38        77240      53716767
EST380       76072      48350633
EST381       65034      33817561
EST382       47137      28985823
EST383       45577      23954919
EST384       81453      55757794
EST385       81664      40671785
EST386       77510      45851025
EST387       75686      46641503
EST388       77626      47876626
EST389       81171      54524027
EST39        89589      53217556
EST390       83044      67245885
EST391       79284      64214850
EST392       74952      40452183
EST393       63881      40196098
EST394       68204      39707958
EST395       63470      37222011
EST396       63618      32765822
EST397       79698      25393882
EST398       75734      38972463
EST399       66170      40154955
EST4         74567      28390970
EST40        63451      49933977
EST400       68368      34115463
EST401       72676      44529225
EST402       69998      45238557
EST403       65477      41951508
EST404       65889      41995392
EST405       67061      37856122
EST406       68257      41060409
EST407       70354      44871329
EST408       80093      48984842
EST409       87010      48710786
EST41        93656      45763749
EST410       60863      39021097
EST411       57745      41283580
EST412       57424      40342961
EST413       58946      40623228
EST414       78705      48096471
EST415       55189      32344664
EST416       53396      35368181
EST417       65239      41054052
EST418       57178      41281629
EST419       60414      42059904
EST42        86411      45683729
EST420       50938      36065782
EST421       64700      40830298
EST422       86054      39129377
EST423       69625      38493796
EST424       69835      38078867
EST425       69614      38891877
EST426       69686      38287536
EST427       69457      38927334
EST428       69464      38407599
EST429       68892      38327803
EST43        103720     47755054
EST430       68779      39158241
EST431       69098      38557402
EST432       67276      38293161
EST433       68970      37478441
EST434       69460      39440439
EST435       69143      38420343
EST436       69428      37775591
EST437       69847      38130375
EST438       69860      38182468
EST439       69638      38498796
EST44        82779      31060580
EST440       69692      38596800
EST441       70450      36848381
EST442       91166      54163122
EST443       80506      36190380
EST444       90984      50280992
EST445       88973      51357453
EST446       77718      42746815
EST447       84047      54715092
EST448       92610      57420094
EST449       87247      51575724
EST45        68743      18301122
EST450       81384      45950050
EST451       85676      47241217
EST452       66735      46133616
EST453       52074      40765571
EST454       68437      44969118
EST455       65965      37815922
EST456       67942      40553552
EST457       107226     54284718
EST458       80623      50047363
EST459       87246      54663321
EST46        70125      18947797
EST460       55681      37785971
EST461       46739      37044316
EST462       46808      58663501
EST463       66807      56356987
EST464       65057      40299366
EST465       72810      42529192
EST466       72496      42774686
EST467       66449      43587525
EST468       67548      43844246
EST469       64437      49757576
EST47        58607      17941203
EST470       109243     47865673
EST471       98496      47862830
EST472       66392      49756057
EST473       54380      39416615
EST474       56904      39312763
EST475       62662      43047967
EST476       64470      47222291
EST477       63339      46545372
EST478       56091      38994006
EST479       51314      39051167
EST48        43732      11947272
EST480       59771      41045453
EST481       58640      37006444
EST482       72125      43056748
EST483       60092      40371071
EST484       56863      38559639
EST485       62381      45944911
EST486       58360      45781877
EST487       69487      47300287
EST488       54940      40474344
EST489       57048      40660061
EST49        43249      11915034
EST490       54667      34285364
EST491       56266      40238371
EST492       54110      35410520
EST493       77433      44047185
EST494       64943      54633193
EST495       71531      52954587
EST496       77256      48434302
EST497       46031      58699790
EST498       54371      49838900
EST499       67857      51675602
EST5         48195      15294033
EST50        43164      11404154
EST500       56450      38678178
EST501       76175      41807929
EST502       84226      54201474
EST503       81767      52981373
EST504       72363      43481550
EST505       58004      38084736
EST506       74526      50091774
EST507       81447      49032411
EST508       78886      59041709
EST509       70464      49263725
EST51        84236      35290044
EST510       71710      51388623
EST511       68249      45991312
EST512       63898      50363002
EST513       62954      44947346
EST514       74573      44199162
EST515       72528      43579576
EST516       108707     44488992
EST517       117383     48602306
EST518       86009      52465234
EST519       50560      50416026
EST52        91692      37936963
EST520       60027      46185998
EST521       95341      17968658
EST522       99724      11015446
EST523       99410      17767208
EST524       91608      41503561
EST525       86977      31714060
EST526       84010      40507628
EST527       63355      61295226
EST528       90760      56438184
EST529       81680      45185238
EST53        94509      42368400
EST530       67675      42839718
EST531       72502      48693772
EST532       77192      50379219
EST533       87242      51670172
EST534       72470      52680362
EST535       68007      48527784
EST536       71104      53715026
EST537       83925      52092324
EST538       85106      45416400
EST539       82837      45551949
EST54        89651      46469920
EST540       84506      39572790
EST541       81442      43995259
EST542       77338      52227964
EST543       73336      56059196
EST544       71344      48940456
EST545       87742      44750785
EST546       102117     47708799
EST547       110840     49318484
EST548       126382     52423133
EST549       132591     58559337
EST55        88719      40573372
EST550       80773      53876230
EST551       80217      48904045
EST552       83218      19448830
EST553       84291      8747239
EST554       111787     54000604
EST555       128072     62339679
EST556       81389      45206383
EST557       63557      40347051
EST558       74908      47293178
EST559       76509      49183371
EST56        103750     53934604
EST560       71567      43319679
EST561       76794      46273231
EST562       67082      51629903
EST563       85471      54698212
EST564       97582      52561649
EST565       75656      43683458
EST566       63236      44130203
EST567       81178      54227047
EST568       101354     59941895
EST569       74507      43292036
EST57        97736      49089607
EST570       76959      40478513
EST571       87981      47022492
EST572       92941      46252881
EST573       70493      50548890
EST574       79623      55917847
EST575       87854      54445213
EST576       85361      56800314
EST577       85188      52455341
EST578       76063      40045406
EST579       74608      45268268
EST58        77716      33529159
EST580       63866      43257644
EST581       66175      35585023
EST582       107959     37322762
EST583       49984      35152793
EST584       51522      31632723
EST585       50789      35219213
EST586       66668      42858931
EST587       71346      50527192
EST588       71639      48846295
EST589       122560     11170945
EST59        65774      28645004
EST590       118192     14583425
EST591       122554     11183337
EST592       122483     11289543
EST593       93667      32179146
EST594       67942      51421150
EST595       75020      49006313
EST596       79229      54407093
EST597       69253      49471581
EST598       73286      43987417
EST599       67096      43773989
EST6         54921      17444496
EST60        73128      32210283
EST600       68089      41491518
EST601       78732      41049912
EST602       71863      46784966
EST603       66479      53395420
EST604       86593      48927407
EST605       70616      39879088
EST606       64739      34559805
EST607       71813      45782266
EST608       106961     46409793
EST609       89153      55173156
EST61        69899      29682910
EST610       61520      47725711
EST611       62515      47070853
EST612       73904      39641859
EST613       79833      45967160
EST614       90611      56204567
EST615       75285      49125031
EST616       71534      46799569
EST617       69336      52053501
EST618       91880      44742859
EST619       79080      26996061
EST62        82701      33214232
EST620       79406      24317788
EST621       77303      29685747
EST622       77977      27334882
EST623       78128      28960015
EST624       77912      29923597
EST625       77356      28887963
EST626       78151      28104915
EST627       78232      29801593
EST628       82911      28197952
EST629       69452      25133370
EST63        73791      29437916
EST630       73151      27459813
EST631       73616      25864071
EST632       78430      27403332
EST633       69071      24274906
EST634       70643      29571844
EST635       51155      18530147
EST64        70299      28399700
EST65        64401      29292864
EST66        76420      34840981
EST67        75198      33393399
EST68        74333      29070561
EST69        76962      27354837
EST7         74544      29357761
EST70        83672      39157479
EST71        40569      11617493
EST72        40435      11031818
EST73        40362      12505883
EST74        40811      12656558
EST75        40825      12297783
EST76        40749      12959188
EST77        40549      12881542
EST78        40521      12117809
EST79        40157      12036082
EST8         75833      30592222
EST80        40960      12710590
EST81        41375      11853191
EST82        41014      13069749
EST83        40860      12962806
EST84        42497      12880225
EST85        46062      17035977
EST86        42684      26805865
EST87        42294      19417704
EST88        48383      19738056
EST89        50650      22052226
EST9         77569      29868234
EST90        50835      21772990
EST91        82701      48603368
EST92        77434      38469717
EST93        72317      27030663
EST94        74479      29508614
EST95        74593      40349286
EST96        77683      41277251
EST97        76976      44126674
EST98        74925      34933715
EST99        75401      43084881
GSS1         90401      38650175
GSS10        74890      43604187
GSS100       80670      52133582
GSS101       74581      42628809
GSS102       73352      45738214
GSS103       73688      44892456
GSS104       73281      45627025
GSS105       73262      44831370
GSS106       75252      45641135
GSS107       81263      54616807
GSS108       83826      55514669
GSS109       80829      52619178
GSS11        70616      35924456
GSS110       82576      50152952
GSS111       84180      57625910
GSS112       80190      60147894
GSS113       90848      45989859
GSS114       90332      53583679
GSS115       73542      50022206
GSS116       89572      65122715
GSS117       82235      59004592
GSS118       75898      42010405
GSS119       81727      50816051
GSS12        72814      38256982
GSS120       95176      53301446
GSS121       84359      55657204
GSS122       84965      54749057
GSS123       82570      56080258
GSS124       76060      69634109
GSS125       76748      66105359
GSS126       79614      56197655
GSS127       78700      54667737
GSS128       79053      54084589
GSS129       79365      53667822
GSS13        76711      38985455
GSS130       78328      55266192
GSS131       82554      55919244
GSS132       84389      57455092
GSS133       80480      60427024
GSS134       58510      56690686
GSS135       78786      58695781
GSS136       75720      69168896
GSS137       76826      56435953
GSS138       78409      49918705
GSS139       92843      59411128
GSS14        71316      32133030
GSS140       94657      58119132
GSS141       86729      54545400
GSS142       87087      55545551
GSS143       78582      59614064
GSS144       95782      54736181
GSS145       115363     58908976
GSS146       100475     60950554
GSS147       76666      51686076
GSS148       52649      33935249
GSS149       72455      54993394
GSS15        70026      34720350
GSS150       72989      55906834
GSS151       72992      55902212
GSS152       73008      55873485
GSS153       72989      55906796
GSS154       72976      55930650
GSS155       77200      56435604
GSS156       76122      47998016
GSS157       85704      50530277
GSS158       91418      61713301
GSS159       81788      64807960
GSS16        78504      46313003
GSS160       94126      58368540
GSS161       84633      58153124
GSS162       82563      57240725
GSS163       90959      58761024
GSS164       95241      61553952
GSS165       83092      60824449
GSS166       98314      34213899
GSS167       109794     20200626
GSS168       80899      55859483
GSS169       53038      38627765
GSS17        70910      33291274
GSS170       54851      43671891
GSS171       60501      49358695
GSS172       59006      45531143
GSS173       57499      48847988
GSS174       57542      48626748
GSS175       58322      46196624
GSS176       58471      46204299
GSS177       58857      48704349
GSS178       58899      48573404
GSS179       58720      49129234
GSS18        59109      27963339
GSS180       58038      48289955
GSS181       58623      46134055
GSS182       59248      49801411
GSS183       60232      49945768
GSS184       60238      49973793
GSS185       60498      49194621
GSS186       60425      49413224
GSS187       60644      48752274
GSS188       59439      46956130
GSS189       59151      45365954
GSS19        56790      29081340
GSS190       58502      47404231
GSS191       59007      45824211
GSS192       58716      46733083
GSS193       58331      47939519
GSS194       58256      48176788
GSS195       58590      49009249
GSS196       60046      50254507
GSS197       59893      50713266
GSS198       60116      48031585
GSS199       60789      45407546
GSS2         88895      39291144
GSS20        57668      26710219
GSS200       59706      48740935
GSS201       59537      49282219
GSS202       59472      49479981
GSS203       59528      49308272
GSS204       59447      49553884
GSS205       59659      48908482
GSS206       59513      49354010
GSS207       59709      48755289
GSS208       59710      48753986
GSS209       59561      48195002
GSS21        61396      28908418
GSS210       59250      44764383
GSS211       58693      46555531
GSS212       58136      48473562
GSS213       58312      47941591
GSS214       58614      46357126
GSS215       58979      49151652
GSS216       64818      54770818
GSS217       66362      54820794
GSS218       99365      63661879
GSS219       83106      44847312
GSS22        64820      38304256
GSS220       18326      14273335
GSS221       86836      64281981
GSS222       83571      62765224
GSS223       103064     48150068
GSS224       68632      58529154
GSS225       68310      58771444
GSS226       69367      56632450
GSS227       69633      56114989
GSS228       70341      55385759
GSS229       85855      73186520
GSS23        57539      27052676
GSS230       86392      44972761
GSS231       88656      47070597
GSS232       85057      64786813
GSS233       70302      58969309
GSS234       69836      59908193
GSS235       63576      60911077
GSS236       81754      47143292
GSS237       87346      35505907
GSS238       107343     82070647
GSS239       105463     69648954
GSS24        66036      41986592
GSS240       84071      34004093
GSS241       120017     73831864
GSS242       120090     73756785
GSS243       115991     75263400
GSS244       94720      51382353
GSS245       87299      55408578
GSS246       98959      65351926
GSS247       107930     77902802
GSS248       107184     78832595
GSS249       105844     80268838
GSS25        68326      28371748
GSS250       97221      72756483
GSS251       83531      54652283
GSS252       110397     67142919
GSS253       110250     65961125
GSS254       104860     56813368
GSS255       75984      43355490
GSS256       105752     50486389
GSS257       86685      63943544
GSS258       95247      68719116
GSS259       95885      36583799
GSS26        58187      25327102
GSS260       95437      37237686
GSS261       96613      35261843
GSS262       94597      38643812
GSS263       91283      58626048
GSS264       28894      15236986
GSS27        65186      31867853
GSS28        65623      32569699
GSS29        76978      39592401
GSS3         87416      41795456
GSS30        83004      39735582
GSS31        74195      40404585
GSS32        70533      48274699
GSS33        79789      37825108
GSS34        75880      40336511
GSS35        74074      40136782
GSS36        87317      55909484
GSS37        87597      58174401
GSS38        85507      44951957
GSS39        86905      50545192
GSS4         78838      41008614
GSS40        86244      40182942
GSS41        83172      31605076
GSS42        81244      56937399
GSS43        80222      58198860
GSS44        72028      47495305
GSS45        72032      47437048
GSS46        77569      45748577
GSS47        77822      38557807
GSS48        83155      57943376
GSS49        86566      64537324
GSS5         78747      40519938
GSS50        81518      54661435
GSS51        93924      59206870
GSS52        88472      58733075
GSS53        76841      42625721
GSS54        72582      40141296
GSS55        86665      47360095
GSS56        88006      58251508
GSS57        76642      64040821
GSS58        70896      78090947
GSS59        85592      69200142
GSS6         78141      38864047
GSS60        89655      60308307
GSS61        63455      44770415
GSS62        65940      45349988
GSS63        89631      67160861
GSS64        84971      58446987
GSS65        86101      53011488
GSS66        85508      55704925
GSS67        93314      57874137
GSS68        97861      52531171
GSS69        97537      52961021
GSS7         77748      39090714
GSS70        98227      52048871
GSS71        99181      50784492
GSS72        99195      50766415
GSS73        99076      50924589
GSS74        99707      50086563
GSS75        97774      52647083
GSS76        91878      64621568
GSS77        89868      70737152
GSS78        88914      70111620
GSS79        87858      69635626
GSS8         75695      38114064
GSS80        87875      64017406
GSS81        88366      44967328
GSS82        78285      23251121
GSS83        78138      23601910
GSS84        84265      48843231
GSS85        77066      45629170
GSS86        89000      56017739
GSS87        84349      58666875
GSS88        76384      76696124
GSS89        79405      73261830
GSS9         72089      37168596
GSS90        84385      46545591
GSS91        84885      49460455
GSS92        75548      41812098
GSS93        79436      56636826
GSS94        77039      56492970
GSS95        82257      54060226
GSS96        84580      58370119
GSS97        85393      57700324
GSS98        87364      52197555
GSS99        81458      67046432
HTC1         24989      26937186
HTC10        64837      83553008
HTC11        68104      59284596
HTC12        45733      50662169
HTC2         15992      36013358
HTC3         15970      36547606
HTC4         16191      35358453
HTC5         15927      40313788
HTC6         16010      37267395
HTC7         51153      28241082
HTC8         81410      60522547
HTC9         76035      71554849
HTG1         1318       188929277
HTG10        1300       186477873
HTG11        1437       184181984
HTG12        883        191867533
HTG13        751        192405888
HTG14        743        192375470
HTG15        782        192313808
HTG16        802        192010230
HTG17        768        192318086
HTG18        2050       171319873
HTG19        1054       187981982
HTG2         2465       186071856
HTG20        996        189097368
HTG21        782        192087293
HTG22        925        190510953
HTG23        901        190586664
HTG24        808        191507090
HTG25        780        192166174
HTG26        857        191368821
HTG27        889        190742228
HTG28        948        190131656
HTG29        897        191062364
HTG3         2517       185290576
HTG30        928        190474469
HTG31        872        191309359
HTG32        968        189757074
HTG33        877        191165426
HTG34        858        191667451
HTG35        827        191908957
HTG36        933        190184365
HTG37        934        190908897
HTG38        941        190379296
HTG39        1035       189294355
HTG4         2553       188532563
HTG40        1187       187261087
HTG41        1246       188161040
HTG42        1189       188237185
HTG43        1166       187391019
HTG44        1102       191749257
HTG45        1265       190810123
HTG46        1194       190949000
HTG47        1135       191359997
HTG48        1043       191198034
HTG49        928        189553998
HTG5         1284       185715991
HTG50        1052       189669575
HTG51        904        189617804
HTG52        1043       189513304
HTG53        926        189566585
HTG54        997        189458177
HTG55        915        189301090
HTG56        977        188973344
HTG57        1081       188777590
HTG58        981        189584177
HTG59        1110       185849272
HTG6         1274       185234665
HTG60        1081       188985196
HTG61        994        189155271
HTG62        1005       188930590
HTG63        980        189154296
HTG64        1119       188612455
HTG65        1116       187719064
HTG66        1293       184432600
HTG67        1227       185533764
HTG68        1238       184675432
HTG69        1251       184705617
HTG7         1277       185414872
HTG70        1217       186717253
HTG71        1420       186571386
HTG72        1244       189101924
HTG73        1120       191445931
HTG74        1210       191918483
HTG75        1136       191253229
HTG76        1147       191388193
HTG77        1193       191321579
HTG78        1125       191576017
HTG79        1238       191015039
HTG8         1459       184762119
HTG80        1151       191375222
HTG81        1140       191513929
HTG82        1230       190168301
HTG83        1300       188342505
HTG84        1209       190736551
HTG85        1249       189601980
HTG86        1188       190273575
HTG87        1360       189758539
HTG88        1367       189329535
HTG89        1091       188385340
HTG9         1200       186999351
HTG90        1380       188691179
HTG91        1246       189829584
HTG92        1037       193050486
HTG93        792        171211053
HTG94        1054       193574971
HTG95        1127       192251483
HTG96        1059       189417637
HTG97        1142       190521277
HTG98        683        87204512
INV1         39977      127051943
INV10        54932      94777723
INV11        2275       27218594
INV2         1737       181239417
INV3         5336       146369659
INV4         75589      76837610
INV5         52381      96705901
INV6         46759      99229546
INV7         80788      71817637
INV8         64283      84613160
INV9         84958      64827659
MAM1         20351      156149279
MAM2         66225      75810434
MAM3         58278      104457344
PAT1         222610     70141260
PAT10        125437     99521476
PAT11        141741     62606569
PAT12        105796     59940607
PAT13        103556     50226950
PAT14        121472     53276251
PAT15        113046     61292641
PAT16        145017     54899720
PAT17        155516     69895616
PAT18        97490      122599302
PAT19        147595     87373266
PAT2         194518     84655123
PAT20        117409     104538409
PAT21        123719     103465157
PAT22        119278     106146671
PAT23        122653     94996984
PAT24        107919     70026836
PAT25        92739      82724536
PAT26        123464     64974844
PAT27        97508      79515999
PAT28        134815     86887375
PAT29        148041     107318700
PAT3         171984     95898893
PAT30        109950     39079100
PAT4         153750     106059356
PAT5         184018     85619906
PAT6         156357     93378139
PAT7         152401     81705419
PAT8         104672     119401279
PAT9         143544     89226980
PHG          3503       24464380
PLN1         49316      104611049
PLN10        18970      140238102
PLN11        18470      152321412
PLN12        18337      152535161
PLN13        16694      153067952
PLN14        1258       165588798
PLN15        1207       164274131
PLN16        44         184184862
PLN17        7          190147207
PLN18        59713      74357447
PLN19        77658      77073566
PLN2         1422       165375381
PLN20        76566      78153156
PLN21        18573      118450740
PLN22        47907      121693181
PLN23        76043      78852496
PLN24        101758     56824724
PLN25        64157      87432075
PLN26        5570       15165566
PLN3         1489       167301281
PLN4         15810      149369175
PLN5         76150      79523211
PLN6         73483      77295881
PLN7         43280      53947312
PLN8         35012      76748708
PLN9         12771      137713171
PRI1         29650      121834122
PRI10        1469       182922219
PRI11        1271       178875524
PRI12        1461       178405231
PRI13        1608       179863163
PRI14        1613       182173589
PRI15        1231       192529531
PRI16        1137       194012387
PRI17        1149       193952749
PRI18        24130      151709400
PRI19        56064      107187995
PRI2         1628       172388735
PRI20        46265      76652174
PRI21        8921       165293865
PRI22        2317       182028608
PRI23        1629       182823733
PRI24        2025       182832528
PRI25        1993       182139964
PRI26        12225      157145845
PRI27        1296       183317979
PRI28        46465      102532343
PRI29        41914      69550250
PRI3         1333       184501390
PRI30        23578      102712136
PRI31        18936      153219963
PRI32        68585      86352419
PRI33        67145      89533227
PRI34        1490       18980244
PRI4         1313       184848742
PRI5         1195       181675133
PRI6         1192       178996734
PRI7         1233       181385298
PRI8         1314       175323214
PRI9         1241       175392969
ROD1         10846      166874882
ROD10        975        182154265
ROD11        1030       186636321
ROD12        960        183545752
ROD13        1024       187504897
ROD14        954        181258569
ROD15        964        182163546
ROD16        1035       186307834
ROD17        22875      154648871
ROD18        14213      158645736
ROD19        1159       184336850
ROD2         925        174124404
ROD20        1166       183904320
ROD21        28770      136507292
ROD22        31471      67908793
ROD23        7514       164640817
ROD24        72126      114028374
ROD25        115982     45567688
ROD26        3895       4465525
ROD3         907        173817152
ROD4         905        174068631
ROD5         926        173972238
ROD6         985        181119091
ROD7         971        179736279
ROD8         987        181779730
ROD9         1010       182973926
STS1         84230      36169375
STS10        57839      44815993
STS11        57926      43638934
STS12        64587      43012584
STS13        87011      34562935
STS14        68100      30374349
STS2         84139      48233259
STS3         69747      27443430
STS4         78862      37487722
STS5         54788      32162172
STS6         54862      31909773
STS7         54669      32202207
STS8         55698      35690726
STS9         57889      44479143
SYN1         54055      66446848
SYN2         83371      28654557
SYN3         84106      27207535
SYN4         84995      25444594
SYN5         10497      8201610
UNA          211        114018
VRL1         72040      66056277
VRL2         71283      63458429
VRL3         71157      66218253
VRL4         69083      67735102
VRL5         59984      72785138
VRL6         62179      72888452
VRL7         70048      70202035
VRL8         3025       1392065
VRT1         18981      163367820
VRT10        11618      176952353
VRT11        7445       181037903
VRT12        8462       179434210
VRT13        82680      67221396
VRT14        30749      28156647
VRT2         56552      110052910
VRT3         17153      161557433
VRT4         68154      86424107
VRT5         51553      65521692
VRT6         17803      131659571
VRT7         1232       191700184
VRT8         1285       191266420
VRT9         8914       179122577

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 161.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:

Entries        Bases   Species

11148092 12700084970   Homo sapiens
7200432   8291244632   Mus musculus
1288005   5766221181   Rattus norvegicus
2026919   3808273911   Bos taurus
2841072   3564487204   Zea mays
1559584   2764828000   Danio rerio
2058320   1863733664   Sus scrofa
1179148   1517127691   Oryza sativa (japonica cultivar-group)
227831    1352463179   Strongylocentrotus purpuratus
1417622   1135336003   Xenopus tropicalis
212172     943046501   Pan troglodytes
734569     897464279   Drosophila melanogaster
1949707    879897433   Arabidopsis thaliana
802461     857512666   Gallus gallus
497579     810324848   Vitis vinifera
75850      708598911   Macaca mulatta
1220300    694494794   Canis lupus familiaris
1006209    657603350   Sorghum bicolor
1102504    655077659   Triticum aestivum
409757     520072874   Medicago truncatula

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 August 2007

                NCBI-GenBank Flat File Release 161.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 PROJECT Format

  This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
PROJECT     GenomeProject:18787

  A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second 
contains the actual project identifier ("18787").

  PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 161.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
	Andrea Gocke, Anjanette Johnston, Mark Landree,	Richard McVeigh,
	Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
	Gert Roosen, Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Joe Pepersack, Ben Slade

User Support
	Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
	Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
	Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
	David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center