Release Notes For GenBank Release 162

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2007

               NCBI-GenBank Flat File Release 162.0

                    Distribution Release Notes

 77632813 loci, 81563399765 bases, from 77632813 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 162.0
1.2 Cutoff Date
1.3 Important Changes in Release 162.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 162.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 162.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:

	ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/  (Japan)
	ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/  (Korea)
	ftp://bio-mirror.sg.apan.net/biomirrors/genbank/     (Singapore)

1.2 Cutoff Date

  This full release, 162.0, incorporates data available to the collaborating
databases as of October 19, 2007 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 162.0

1.3.1 Sequences moved from SYN division to GSS division

  Due to a timing problem in the deployment of a software change,
264,607 GSS (Genome Survey Sequence) sequences were mistakenly
included in the SYN-division sequence files for GenBank Release 161.0 .

  The GSS sequences involved are labelled with a /transgenic qualifier
on their source features (see EF711103 for an example). The presence
of that qualifier normally indicates that the SYN division is the most
appropriate place for a record. But this is not the case for GSS records.

  Although a software change was made to accomodate transgenic GSS
records on July 2, the flatfiles had already been generated and stored
in the database that is used to build GenBank releases. Hence they
were dumped to the SYN-division files for August's Release 161.0.

  We have resolved this problem for Release 162.0, and as a result,
the number of SYN-division sequence files has decreased from five
back to two. All the records involved are now in the GSS-division
sequence files.

  Our thanks to the informatics group at The Jackson Laboratory for
reporting this problem.

1.3.2 CON division organizational changes

  As mentioned in the release notes for GenBank 161.0, procedures
for processing the ASN.1 version of CON ('constructed') division
records have been updated such that a much larger number (119) of
smaller (approximately 260MB) gbcon*.aso files are now generated.

  This change parallels a similar change which was made for the
processing of CON division flatfiles (gbcon*.seq) for Release 161.0.
For further details, please see the GenBank 161.0 release notes:

	ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb161.release.notes

1.3.3 Organizational changes

  The total number of sequence data files increased by 25 with this release:

  - the BCT division is now comprised of  25 files (+1)
  - the CON division is now comprised of  83 files (+1)
  - the ENV division is now comprised of   7 files (+1)
  - the EST division is now comprised of 649 files (+14)
  - the GSS division is now comprised of 269 files (+5)
  - the HTG division is now comprised of 102 files (+4)
  - the MAM division is now comprised of   4 files (+1)
  - the PAT division is now comprised of  31 files (+1)
  - the SYN division is now comprised of   2 files (-3)  (See Section 1.3.1)

  The total number of index files increased by 1 with this release:

  - the AUT (Author Name) index is now comprised of 48 files (+1)

1.3.4 Structured /specimen_voucher qualifiers

  As of October 2007, the content of the /specimen_voucher qualifier can
support a structured value consisting of an institution code, a collection
code, and a specimen identifier, as well as the existing unstructured values.
Here is the new definition of the qualifier:

Qualifier       /specimen_voucher=
Definition      identifier for the specimen from which the nucleic acid
                sequenced was obtained
Value format    /specimen_voucher="[<institution-code>:[<collection-code>:]]<specimen_id>"
Example         /specimen_voucher="UAM:Mamm:52179"
                /specimen_voucher="AMCC:101706"
                /specimen_voucher="USNM:field series 8798"
                /specimen_voucher="personal collection:Dan Janzen:99-SRNP-2003"
                /specimen_voucher="99-SRNP-2003"
Comment         the /specimen_voucher qualifier is intended to annotate a
                reference to the physical specimen that remains after the
                sequence has been obtained;
                if the specimen was destroyed in the process of sequencing,
                electronic images (e-vouchers) are an adequate substitute for a
                physical voucher specimen; ideally the specimens will be
                deposited in a curated museum, herbarium, or frozen tissue
                collection, but often they will remain in a personal or
                laboratory collection for some time before they are deposited in
                a curated collection;
                there are three forms of specimen_voucher qualifiers; if the
                text of the qualifier includes one or more colons it is a
                'structured voucher'; structured vouchers include
                institution-codes (and optional collection-codes) taken from a
                controlled vocabulary that denotes the museum or herbarium
                collection where the specimen resides;

1.3.5 /operon qualifiers for protein_bind features

  Due to an oversight, the /operon qualifier was not listed as a legal
qualifier for the protein_bind feature. This has been corrected as of
October 2007, with an update to the Feature Table document which includes
the qualifier among those that are legal for protein_bind.

1.3.6 Alignment as EVIDENCE_BASIS for the /inference qualifier

  Several algorithms exist which allow mRNAs to be aligned to genomic
sequence, taking into account introns and splice signals. In order to
document the use of such algorithms for the structured /inference
qualifier, a new class of EVIDENCE_BASIS will be introduced:

	alignment

This addition to the controlled vocabulary of the /inference qualifier
is legal as of this October 2007 release.

1.3.7 New ncRNA feature 

  A variety of new types of RNA features have been introduced in 
recent years. snRNA, snoRNA, and scRNA are some examples.

  Because the number of non-coding RNA families is quite likely to
continue to expand, a new ncRNA feature has been created, so that
they can be accomodated more flexibly.

  This new feature utilizes a new qualifier called /ncRNA_class,
with a controlled vocabulary to indicate what type of non-coding
RNA is being represented.

  Here are the definitions of the ncRNA feature and /ncRNA_class :

Feature Key           ncRNA
Definition            a non-protein-coding gene, other than ribosomal RNA and
                      transfer RNA, the functional molecule of which is the RNA
                      transcript;
Mandatory qualifiers  /ncRNA_class="TYPE"
Optional qualifiers   /allele="text"
                      /citation=[number]
                      /db_xref="<database>:<identifier>"
                      /experiment="text"
                      /function="text"
                      /gene="text"
                      /inference="TYPE[ (same species)][:EVIDENCE_BASIS]"
                      /label=feature_label
                      /locus_tag="text" (single token)
                      /map="text"
                      /note="text"
                      /old_locus_tag="text" (single token)
                      /product="text"
                      /pseudo
                      /standard_name="text"
                      /trans_splicing
                      /operon="text"
Comment               the ncRNA feature is not used for ribosomal and transfer
                      RNA annotation, for which the rRNA and tRNA feature keys
                      should be used, respectively;

Qualifier       /ncRNA_class=
Definition      a structured description of the classification of the
                non-coding RNA described by the ncRNA parent key
Value format   "TYPE"
Example         /ncRNA_class="miRNA"
                /ncRNA_class="siRNA"
                /ncRNA_class="scRNA"      
Comment         TYPE is a term taken from the INSDC controlled vocabulary for ncRNA
                classes; on 15-Oct-2007, the following terms were valid:

                      "antisense_RNA"
                      "autocatalytically_spliced_intron"
                      "hammerhead_ribozyme"
                      "RNase_P_RNA"
                      "RNase_MRP_RNA"
                      "telomerase_RNA"
                      "guide_RNA"
                      "rasiRNA"
                      "scRNA"
                      "siRNA"
                      "miRNA"
                      "piRNA"
                      "snoRNA"
                      "snRNA"
                      "SRP_RNA"
                      "vault_RNA"
                      "Y_RNA"
                      "other"

                ncRNA classes not yet in the INSDC /ncRNA_class controlled
                vocabulary can be annotated by entering
                '/ncRNA_class="other"' with '/note="[brief explanation of
                novel ncRNA_class]"';

1.3.8 /organism no longer to be used for misc_recomb

  The /organism qualifier had been legal for misc_recomb
features. But a review of the existing cases in the database
indicated that all could be better annotated through the use
of multiple source features.

  That work was completed in October 2007, and at this point
the /organism qualifier is no longer allowed for the misc_recomb
feature key.

1.3.9 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.10 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
forty-eight of the GSS flatfiles in Release 162.0. Consider gbgss222.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                          October 15 2007

                NCBI-GenBank Flat File Release 162.0

                           GSS Sequences (Part 1)

   86842 loci,    64244408 bases, from    86842 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "222" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New /culture_collection and /bio_material qualifiers

  As of the December 2007 GenBank release, new qualifiers /culture_collection
and /bio_material qualifiers will be legal for the source feature. These
qualifiers will utilize the same format as /speciment_voucher (see Section
1.4.1 of these release notes). Their preliminary definitions are:

Qualifier       /culture_collection=
Definition      institution code and identifier for the culture from which the
                nucleic acid sequenced was obtained, with optional collection
                code.
Value format    "<institution-code>:[<collection-code>:]<culture_id>"
Example         /culture_collection="ATCC:26370"
Comment         the /culture_collection qualifier should be used to annotate
                live microbial and viral cultures, and cell lines that have been
                deposited in curated culture collections; microbial cultures in
                personal or laboratory collections should be annotated in strain
                qualifiers;
                annotation with a culture_collection qualifier implies that the
                sequence was obtained from a sample retrieved (by the submitter
                or a collaborator) from the indicated culture collection, or
                that the sequence was obtained from a sample that was deposited
                (by the submitter or a collaborator) in the indicated culture
                collection; annotation with more than one culture_collection
                qualifier indicates that the sequence was obtained from a sample
                that was deposited (by the submitter or a collaborator) in more
                than one culture collection.
                culture_id and institution_code are mandatory, collection_code
                is optional;
                the /culture_collection qualifier becomes legal on 15-Dec-2007;

Qualifier       /bio_material=
Definition      identifier for the biological material from which the nucleic
                acid sequenced was obtained, with optional institution code and
                collection code for the place where it is currently stored.
Value format    "[<institution-code>:[<collection-code>:]]<material_id>"
Example         /bio_material="CGC:CB3912"      <- Caenorhabditis stock centre
Comment         the bio_material qualifier should be used to annotate the
                identifiers of material in biological collections that are not
                appropriate to annotate as either /specimen_voucher or
                /culture_collection; these include zoos and aquaria, stock
                centres, seed banks, germplasm repositories and DNA banks;
                material_id is mandatory, institution_code and collection_code
                are optional; institution code is mandatory where collection
                code is present;
                the /bio_material qualifier becomes legal on 15-Dec-2007;

1.4.2 New tmRNA feature and /peptide_tag qualifier

  To support the annotation of a class of RNAs that have dual
tRNA-like and mRNA-like behaviors, a new tmRNA feature will be
legal for the Feature Table as of December 2007. The "tmRNA Website"
at Indiana University provides some background information about
the unusual biology of tmRNAs :

	http://www.indiana.edu/~tmrna/ 

Here is the definition of the new tmRNA feature:

Feature Key           tmRNA
Definition            transfer messenger RNA; tmRNA acts as a tRNA first,
                      and then as an mRNA that encodes a peptide tag; the
                      ribosome translates this mRNA region of tmRNA and attaches
                      the encoded peptide tag to the C-terminus of the
                      unfinished protein; this attached tag targets the protein for
                      destruction or proteolysis;
Optional qualifiers   /allele="text"
                      /citation=[number]
                      /db_xref="<database>:<identifier>"
                      /experiment="text"
                      /function="text"
                      /gene="text"
                      /inference="TYPE[ (same species)][:EVIDENCE_BASIS]"
                      /label=feature_label
                      /locus_tag="text" (single token)
                      /map="text"
                      /note="text"
                      /old_locus_tag="text" (single token)
                      /product="text"
                      /pseudo
                      /standard_name="text"
                      /tag_peptide=<base_range>
Comment               the tmRNA feature key will become valid on 15-Dec-2007


To indicate the nucleotide region encoding the proteolysis tag
peptide, a new /tag_peptide qualifier will be introduced for
use with the tmRNA feature. The definition of /tag_peptide is:

Qualifier       /tag_peptide=
Definition      base location encoding the polypeptide for proteolysis tag of
                tmRNA and its termination codon;
Value format    <base_range>
Example         /tag_peptide=90..122
Comment         it is recommended that the amino acid sequence corresponding
                to the /tag_peptide be annotated by describing a 5' partial
                CDS feature; e.g. CDS    <90..122;
                the /tag_peptide qualifier (and tmRNA feature) will become
                valid on 15-Dec-2007

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1386 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut5.idx - Index of the entries according to author name, part 5.
48. gbaut6.idx - Index of the entries according to author name, part 6.
49. gbaut7.idx - Index of the entries according to author name, part 7.
50. gbaut8.idx - Index of the entries according to author name, part 8.
51. gbaut9.idx - Index of the entries according to author name, part 9.
52. gbbct1.seq - Bacterial sequence entries, part 1.
53. gbbct10.seq - Bacterial sequence entries, part 10.
54. gbbct11.seq - Bacterial sequence entries, part 11.
55. gbbct12.seq - Bacterial sequence entries, part 12.
56. gbbct13.seq - Bacterial sequence entries, part 13.
57. gbbct14.seq - Bacterial sequence entries, part 14.
58. gbbct15.seq - Bacterial sequence entries, part 15.
59. gbbct16.seq - Bacterial sequence entries, part 16.
60. gbbct17.seq - Bacterial sequence entries, part 17.
61. gbbct18.seq - Bacterial sequence entries, part 18.
62. gbbct19.seq - Bacterial sequence entries, part 19.
63. gbbct2.seq - Bacterial sequence entries, part 2.
64. gbbct20.seq - Bacterial sequence entries, part 20.
65. gbbct21.seq - Bacterial sequence entries, part 21.
66. gbbct22.seq - Bacterial sequence entries, part 22.
67. gbbct23.seq - Bacterial sequence entries, part 23.
68. gbbct24.seq - Bacterial sequence entries, part 24.
69. gbbct25.seq - Bacterial sequence entries, part 25.
70. gbbct3.seq - Bacterial sequence entries, part 3.
71. gbbct4.seq - Bacterial sequence entries, part 4.
72. gbbct5.seq - Bacterial sequence entries, part 5.
73. gbbct6.seq - Bacterial sequence entries, part 6.
74. gbbct7.seq - Bacterial sequence entries, part 7.
75. gbbct8.seq - Bacterial sequence entries, part 8.
76. gbbct9.seq - Bacterial sequence entries, part 9.
77. gbchg.txt - Accession numbers of entries updated since the previous release.
78. gbcon1.seq - Constructed sequence entries, part 1.
79. gbcon10.seq - Constructed sequence entries, part 10.
80. gbcon11.seq - Constructed sequence entries, part 11.
81. gbcon12.seq - Constructed sequence entries, part 12.
82. gbcon13.seq - Constructed sequence entries, part 13.
83. gbcon14.seq - Constructed sequence entries, part 14.
84. gbcon15.seq - Constructed sequence entries, part 15.
85. gbcon16.seq - Constructed sequence entries, part 16.
86. gbcon17.seq - Constructed sequence entries, part 17.
87. gbcon18.seq - Constructed sequence entries, part 18.
88. gbcon19.seq - Constructed sequence entries, part 19.
89. gbcon2.seq - Constructed sequence entries, part 2.
90. gbcon20.seq - Constructed sequence entries, part 20.
91. gbcon21.seq - Constructed sequence entries, part 21.
92. gbcon22.seq - Constructed sequence entries, part 22.
93. gbcon23.seq - Constructed sequence entries, part 23.
94. gbcon24.seq - Constructed sequence entries, part 24.
95. gbcon25.seq - Constructed sequence entries, part 25.
96. gbcon26.seq - Constructed sequence entries, part 26.
97. gbcon27.seq - Constructed sequence entries, part 27.
98. gbcon28.seq - Constructed sequence entries, part 28.
99. gbcon29.seq - Constructed sequence entries, part 29.
100. gbcon3.seq - Constructed sequence entries, part 3.
101. gbcon30.seq - Constructed sequence entries, part 30.
102. gbcon31.seq - Constructed sequence entries, part 31.
103. gbcon32.seq - Constructed sequence entries, part 32.
104. gbcon33.seq - Constructed sequence entries, part 33.
105. gbcon34.seq - Constructed sequence entries, part 34.
106. gbcon35.seq - Constructed sequence entries, part 35.
107. gbcon36.seq - Constructed sequence entries, part 36.
108. gbcon37.seq - Constructed sequence entries, part 37.
109. gbcon38.seq - Constructed sequence entries, part 38.
110. gbcon39.seq - Constructed sequence entries, part 39.
111. gbcon4.seq - Constructed sequence entries, part 4.
112. gbcon40.seq - Constructed sequence entries, part 40.
113. gbcon41.seq - Constructed sequence entries, part 41.
114. gbcon42.seq - Constructed sequence entries, part 42.
115. gbcon43.seq - Constructed sequence entries, part 43.
116. gbcon44.seq - Constructed sequence entries, part 44.
117. gbcon45.seq - Constructed sequence entries, part 45.
118. gbcon46.seq - Constructed sequence entries, part 46.
119. gbcon47.seq - Constructed sequence entries, part 47.
120. gbcon48.seq - Constructed sequence entries, part 48.
121. gbcon49.seq - Constructed sequence entries, part 49.
122. gbcon5.seq - Constructed sequence entries, part 5.
123. gbcon50.seq - Constructed sequence entries, part 50.
124. gbcon51.seq - Constructed sequence entries, part 51.
125. gbcon52.seq - Constructed sequence entries, part 52.
126. gbcon53.seq - Constructed sequence entries, part 53.
127. gbcon54.seq - Constructed sequence entries, part 54.
128. gbcon55.seq - Constructed sequence entries, part 55.
129. gbcon56.seq - Constructed sequence entries, part 56.
130. gbcon57.seq - Constructed sequence entries, part 57.
131. gbcon58.seq - Constructed sequence entries, part 58.
132. gbcon59.seq - Constructed sequence entries, part 59.
133. gbcon6.seq - Constructed sequence entries, part 6.
134. gbcon60.seq - Constructed sequence entries, part 60.
135. gbcon61.seq - Constructed sequence entries, part 61.
136. gbcon62.seq - Constructed sequence entries, part 62.
137. gbcon63.seq - Constructed sequence entries, part 63.
138. gbcon64.seq - Constructed sequence entries, part 64.
139. gbcon65.seq - Constructed sequence entries, part 65.
140. gbcon66.seq - Constructed sequence entries, part 66.
141. gbcon67.seq - Constructed sequence entries, part 67.
142. gbcon68.seq - Constructed sequence entries, part 68.
143. gbcon69.seq - Constructed sequence entries, part 69.
144. gbcon7.seq - Constructed sequence entries, part 7.
145. gbcon70.seq - Constructed sequence entries, part 70.
146. gbcon71.seq - Constructed sequence entries, part 71.
147. gbcon72.seq - Constructed sequence entries, part 72.
148. gbcon73.seq - Constructed sequence entries, part 73.
149. gbcon74.seq - Constructed sequence entries, part 74.
150. gbcon75.seq - Constructed sequence entries, part 75.
151. gbcon76.seq - Constructed sequence entries, part 76.
152. gbcon77.seq - Constructed sequence entries, part 77.
153. gbcon78.seq - Constructed sequence entries, part 78.
154. gbcon79.seq - Constructed sequence entries, part 79.
155. gbcon8.seq - Constructed sequence entries, part 8.
156. gbcon80.seq - Constructed sequence entries, part 80.
157. gbcon81.seq - Constructed sequence entries, part 81.
158. gbcon82.seq - Constructed sequence entries, part 82.
159. gbcon83.seq - Constructed sequence entries, part 83.
160. gbcon9.seq - Constructed sequence entries, part 9.
161. gbdel.txt - Accession numbers of entries deleted since the previous release.
162. gbenv1.seq - Environmental sampling sequence entries, part 1.
163. gbenv2.seq - Environmental sampling sequence entries, part 2.
164. gbenv3.seq - Environmental sampling sequence entries, part 3.
165. gbenv4.seq - Environmental sampling sequence entries, part 4.
166. gbenv5.seq - Environmental sampling sequence entries, part 5.
167. gbenv6.seq - Environmental sampling sequence entries, part 6.
168. gbenv7.seq - Environmental sampling sequence entries, part 7.
169. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
170. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
171. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
172. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
173. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
174. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
175. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
176. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
177. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
178. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
179. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
180. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
181. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
182. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
183. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
184. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
185. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
186. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
187. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
188. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
189. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
190. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
191. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
192. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
193. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
194. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
195. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
196. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
197. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
198. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
199. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
200. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
201. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
202. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
203. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
204. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
205. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
206. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
207. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
208. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
209. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
210. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
211. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
212. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
213. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
214. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
215. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
216. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
217. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
218. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
219. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
220. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
221. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
222. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
223. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
224. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
225. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
226. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
227. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
228. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
229. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
230. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
231. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
232. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
233. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
234. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
235. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
236. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
237. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
238. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
239. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
240. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
241. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
242. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
243. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
244. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
245. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
246. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
247. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
248. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
249. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
250. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
251. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
252. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
253. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
254. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
255. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
256. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
257. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
258. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
259. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
260. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
261. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
262. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
263. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
264. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
265. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
266. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
267. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
268. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
269. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
270. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
271. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
272. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
273. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
274. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
275. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
276. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
277. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
278. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
279. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
280. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
281. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
282. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
283. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
284. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
285. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
286. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
287. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
288. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
289. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
290. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
291. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
292. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
293. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
294. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
295. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
296. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
297. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
298. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
299. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
300. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
301. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
302. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
303. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
304. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
305. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
306. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
307. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
308. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
309. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
310. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
311. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
312. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
313. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
314. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
315. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
316. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
317. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
318. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
319. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
320. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
321. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
322. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
323. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
324. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
325. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
326. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
327. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
328. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
329. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
330. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
331. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
332. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
333. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
334. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
335. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
336. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
337. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
338. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
339. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
340. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
341. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
342. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
343. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
344. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
345. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
346. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
347. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
348. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
349. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
350. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
351. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
352. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
353. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
354. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
355. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
356. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
357. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
358. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
359. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
360. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
361. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
362. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
363. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
364. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
365. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
366. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
367. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
368. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
369. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
370. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
371. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
372. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
373. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
374. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
375. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
376. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
377. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
378. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
379. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
380. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
381. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
382. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
383. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
384. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
385. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
386. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
387. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
388. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
389. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
390. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
391. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
392. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
393. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
394. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
395. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
396. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
397. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
398. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
399. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
400. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
401. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
402. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
403. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
404. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
405. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
406. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
407. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
408. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
409. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
410. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
411. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
412. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
413. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
414. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
415. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
416. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
417. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
418. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
419. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
420. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
421. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
422. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
423. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
424. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
425. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
426. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
427. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
428. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
429. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
430. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
431. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
432. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
433. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
434. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
435. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
436. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
437. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
438. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
439. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
440. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
441. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
442. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
443. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
444. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
445. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
446. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
447. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
448. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
449. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
450. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
451. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
452. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
453. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
454. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
455. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
456. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
457. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
458. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
459. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
460. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
461. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
462. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
463. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
464. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
465. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
466. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
467. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
468. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
469. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
470. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
471. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
472. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
473. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
474. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
475. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
476. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
477. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
478. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
479. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
480. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
481. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
482. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
483. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
484. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
485. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
486. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
487. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
488. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
489. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
490. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
491. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
492. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
493. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
494. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
495. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
496. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
497. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
498. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
499. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
500. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
501. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
502. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
503. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
504. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
505. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
506. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
507. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
508. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
509. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
510. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
511. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
512. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
513. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
514. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
515. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
516. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
517. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
518. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
519. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
520. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
521. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
522. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
523. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
524. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
525. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
526. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
527. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
528. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
529. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
530. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
531. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
532. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
533. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
534. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
535. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
536. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
537. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
538. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
539. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
540. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
541. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
542. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
543. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
544. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
545. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
546. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
547. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
548. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
549. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
550. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
551. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
552. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
553. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
554. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
555. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
556. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
557. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
558. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
559. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
560. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
561. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
562. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
563. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
564. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
565. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
566. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
567. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
568. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
569. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
570. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
571. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
572. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
573. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
574. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
575. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
576. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
577. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
578. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
579. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
580. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
581. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
582. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
583. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
584. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
585. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
586. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
587. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
588. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
589. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
590. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
591. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
592. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
593. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
594. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
595. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
596. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
597. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
598. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
599. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
600. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
601. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
602. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
603. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
604. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
605. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
606. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
607. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
608. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
609. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
610. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
611. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
612. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
613. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
614. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
615. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
616. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
617. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
618. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
619. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
620. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
621. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
622. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
623. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
624. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
625. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
626. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
627. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
628. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
629. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
630. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
631. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
632. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
633. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
634. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
635. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
636. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
637. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
638. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
639. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
640. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
641. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
642. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
643. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
644. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
645. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
646. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
647. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
648. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
649. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
650. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
651. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
652. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
653. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
654. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
655. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
656. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
657. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
658. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
659. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
660. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
661. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
662. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
663. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
664. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
665. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
666. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
667. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
668. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
669. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
670. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
671. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
672. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
673. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
674. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
675. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
676. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
677. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
678. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
679. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
680. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
681. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
682. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
683. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
684. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
685. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
686. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
687. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
688. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
689. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
690. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
691. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
692. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
693. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
694. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
695. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
696. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
697. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
698. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
699. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
700. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
701. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
702. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
703. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
704. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
705. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
706. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
707. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
708. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
709. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
710. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
711. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
712. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
713. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
714. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
715. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
716. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
717. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
718. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
719. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
720. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
721. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
722. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
723. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
724. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
725. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
726. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
727. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
728. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
729. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
730. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
731. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
732. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
733. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
734. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
735. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
736. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
737. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
738. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
739. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
740. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
741. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
742. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
743. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
744. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
745. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
746. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
747. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
748. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
749. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
750. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
751. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
752. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
753. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
754. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
755. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
756. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
757. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
758. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
759. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
760. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
761. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
762. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
763. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
764. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
765. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
766. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
767. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
768. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
769. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
770. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
771. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
772. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
773. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
774. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
775. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
776. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
777. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
778. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
779. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
780. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
781. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
782. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
783. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
784. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
785. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
786. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
787. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
788. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
789. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
790. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
791. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
792. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
793. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
794. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
795. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
796. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
797. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
798. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
799. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
800. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
801. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
802. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
803. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
804. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
805. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
806. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
807. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
808. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
809. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
810. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
811. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
812. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
813. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
814. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
815. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
816. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
817. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
818. gbgen.idx - Index of the entries according to gene symbols.
819. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
820. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
821. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
822. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
823. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
824. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
825. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
826. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
827. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
828. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
829. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
830. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
831. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
832. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
833. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
834. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
835. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
836. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
837. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
838. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
839. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
840. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
841. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
842. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
843. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
844. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
845. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
846. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
847. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
848. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
849. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
850. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
851. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
852. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
853. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
854. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
855. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
856. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
857. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
858. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
859. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
860. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
861. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
862. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
863. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
864. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
865. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
866. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
867. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
868. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
869. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
870. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
871. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
872. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
873. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
874. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
875. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
876. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
877. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
878. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
879. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
880. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
881. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
882. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
883. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
884. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
885. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
886. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
887. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
888. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
889. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
890. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
891. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
892. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
893. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
894. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
895. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
896. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
897. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
898. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
899. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
900. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
901. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
902. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
903. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
904. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
905. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
906. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
907. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
908. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
909. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
910. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
911. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
912. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
913. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
914. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
915. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
916. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
917. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
918. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
919. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
920. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
921. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
922. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
923. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
924. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
925. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
926. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
927. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
928. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
929. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
930. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
931. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
932. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
933. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
934. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
935. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
936. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
937. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
938. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
939. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
940. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
941. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
942. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
943. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
944. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
945. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
946. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
947. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
948. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
949. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
950. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
951. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
952. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
953. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
954. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
955. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
956. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
957. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
958. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
959. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
960. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
961. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
962. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
963. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
964. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
965. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
966. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
967. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
968. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
969. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
970. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
971. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
972. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
973. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
974. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
975. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
976. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
977. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
978. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
979. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
980. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
981. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
982. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
983. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
984. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
985. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
986. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
987. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
988. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
989. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
990. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
991. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
992. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
993. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
994. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
995. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
996. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
997. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
998. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
999. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1000. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1001. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1002. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1003. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1004. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1005. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1006. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1007. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1008. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1009. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1010. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1011. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1012. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1013. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1014. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1015. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1016. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1017. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1018. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1019. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1020. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1021. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1022. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1023. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1024. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1025. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1026. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1027. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1028. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1029. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1030. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1031. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1032. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1033. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1034. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1035. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1036. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1037. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1038. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1039. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1040. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1041. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1042. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1043. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1044. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1045. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1046. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1047. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1048. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1049. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1050. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1051. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1052. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1053. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1054. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1055. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1056. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1057. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1058. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1059. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1060. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1061. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1062. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1063. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1064. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1065. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1066. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1067. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1068. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1069. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1070. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1071. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1072. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1073. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1074. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1075. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1076. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1077. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1078. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1079. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1080. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1081. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1082. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1083. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1084. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1085. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1086. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1087. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1088. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1089. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1090. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1091. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1092. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1093. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1094. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1095. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1096. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1097. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1098. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1099. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1100. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1101. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1102. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1103. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1104. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1105. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1106. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1107. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1108. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1109. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1110. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1111. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1112. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1113. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1114. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1115. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1116. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1117. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1118. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1119. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1120. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1121. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1122. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1123. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1124. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1125. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1126. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1127. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1128. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1129. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1130. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1131. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1132. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1133. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1134. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1135. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1136. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1137. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1138. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1139. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1140. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1141. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1142. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1143. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1144. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1145. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1146. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1147. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1148. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1149. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1150. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1151. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1152. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1153. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1154. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1155. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1156. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1157. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1158. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1159. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1160. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1161. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1162. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1163. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1164. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1165. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1166. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1167. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1168. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1169. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1170. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1171. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1172. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1173. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1174. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1175. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1176. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1177. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1178. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1179. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1180. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1181. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1182. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1183. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1184. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1185. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1186. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1187. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1188. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1189. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1190. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1191. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1192. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1193. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1194. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1195. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1196. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1197. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1198. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1199. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1200. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1201. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1202. gbinv1.seq - Invertebrate sequence entries, part 1.
1203. gbinv10.seq - Invertebrate sequence entries, part 10.
1204. gbinv11.seq - Invertebrate sequence entries, part 11.
1205. gbinv2.seq - Invertebrate sequence entries, part 2.
1206. gbinv3.seq - Invertebrate sequence entries, part 3.
1207. gbinv4.seq - Invertebrate sequence entries, part 4.
1208. gbinv5.seq - Invertebrate sequence entries, part 5.
1209. gbinv6.seq - Invertebrate sequence entries, part 6.
1210. gbinv7.seq - Invertebrate sequence entries, part 7.
1211. gbinv8.seq - Invertebrate sequence entries, part 8.
1212. gbinv9.seq - Invertebrate sequence entries, part 9.
1213. gbjou1.idx - Index of the entries according to journal citation, part 1.
1214. gbjou2.idx - Index of the entries according to journal citation, part 2.
1215. gbjou3.idx - Index of the entries according to journal citation, part 3.
1216. gbjou4.idx - Index of the entries according to journal citation, part 4.
1217. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1218. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1219. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1220. gbmam1.seq - Other mammalian sequence entries, part 1.
1221. gbmam2.seq - Other mammalian sequence entries, part 2.
1222. gbmam3.seq - Other mammalian sequence entries, part 3.
1223. gbmam4.seq - Other mammalian sequence entries, part 4.
1224. gbnew.txt - Accession numbers of entries new since the previous release.
1225. gbpat1.seq - Patent sequence entries, part 1.
1226. gbpat10.seq - Patent sequence entries, part 10.
1227. gbpat11.seq - Patent sequence entries, part 11.
1228. gbpat12.seq - Patent sequence entries, part 12.
1229. gbpat13.seq - Patent sequence entries, part 13.
1230. gbpat14.seq - Patent sequence entries, part 14.
1231. gbpat15.seq - Patent sequence entries, part 15.
1232. gbpat16.seq - Patent sequence entries, part 16.
1233. gbpat17.seq - Patent sequence entries, part 17.
1234. gbpat18.seq - Patent sequence entries, part 18.
1235. gbpat19.seq - Patent sequence entries, part 19.
1236. gbpat2.seq - Patent sequence entries, part 2.
1237. gbpat20.seq - Patent sequence entries, part 20.
1238. gbpat21.seq - Patent sequence entries, part 21.
1239. gbpat22.seq - Patent sequence entries, part 22.
1240. gbpat23.seq - Patent sequence entries, part 23.
1241. gbpat24.seq - Patent sequence entries, part 24.
1242. gbpat25.seq - Patent sequence entries, part 25.
1243. gbpat26.seq - Patent sequence entries, part 26.
1244. gbpat27.seq - Patent sequence entries, part 27.
1245. gbpat28.seq - Patent sequence entries, part 28.
1246. gbpat29.seq - Patent sequence entries, part 29.
1247. gbpat3.seq - Patent sequence entries, part 3.
1248. gbpat30.seq - Patent sequence entries, part 30.
1249. gbpat31.seq - Patent sequence entries, part 31.
1250. gbpat4.seq - Patent sequence entries, part 4.
1251. gbpat5.seq - Patent sequence entries, part 5.
1252. gbpat6.seq - Patent sequence entries, part 6.
1253. gbpat7.seq - Patent sequence entries, part 7.
1254. gbpat8.seq - Patent sequence entries, part 8.
1255. gbpat9.seq - Patent sequence entries, part 9.
1256. gbphg.seq - Phage sequence entries.
1257. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1258. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1259. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1260. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1261. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1262. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1263. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1264. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1265. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1266. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1267. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1268. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1269. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1270. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1271. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1272. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1273. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1274. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1275. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1276. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1277. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1278. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1279. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1280. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1281. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1282. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1283. gbpri1.seq - Primate sequence entries, part 1.
1284. gbpri10.seq - Primate sequence entries, part 10.
1285. gbpri11.seq - Primate sequence entries, part 11.
1286. gbpri12.seq - Primate sequence entries, part 12.
1287. gbpri13.seq - Primate sequence entries, part 13.
1288. gbpri14.seq - Primate sequence entries, part 14.
1289. gbpri15.seq - Primate sequence entries, part 15.
1290. gbpri16.seq - Primate sequence entries, part 16.
1291. gbpri17.seq - Primate sequence entries, part 17.
1292. gbpri18.seq - Primate sequence entries, part 18.
1293. gbpri19.seq - Primate sequence entries, part 19.
1294. gbpri2.seq - Primate sequence entries, part 2.
1295. gbpri20.seq - Primate sequence entries, part 20.
1296. gbpri21.seq - Primate sequence entries, part 21.
1297. gbpri22.seq - Primate sequence entries, part 22.
1298. gbpri23.seq - Primate sequence entries, part 23.
1299. gbpri24.seq - Primate sequence entries, part 24.
1300. gbpri25.seq - Primate sequence entries, part 25.
1301. gbpri26.seq - Primate sequence entries, part 26.
1302. gbpri27.seq - Primate sequence entries, part 27.
1303. gbpri28.seq - Primate sequence entries, part 28.
1304. gbpri29.seq - Primate sequence entries, part 29.
1305. gbpri3.seq - Primate sequence entries, part 3.
1306. gbpri30.seq - Primate sequence entries, part 30.
1307. gbpri31.seq - Primate sequence entries, part 31.
1308. gbpri32.seq - Primate sequence entries, part 32.
1309. gbpri33.seq - Primate sequence entries, part 33.
1310. gbpri34.seq - Primate sequence entries, part 34.
1311. gbpri4.seq - Primate sequence entries, part 4.
1312. gbpri5.seq - Primate sequence entries, part 5.
1313. gbpri6.seq - Primate sequence entries, part 6.
1314. gbpri7.seq - Primate sequence entries, part 7.
1315. gbpri8.seq - Primate sequence entries, part 8.
1316. gbpri9.seq - Primate sequence entries, part 9.
1317. gbrel.txt - Release notes (this document).
1318. gbrod1.seq - Rodent sequence entries, part 1.
1319. gbrod10.seq - Rodent sequence entries, part 10.
1320. gbrod11.seq - Rodent sequence entries, part 11.
1321. gbrod12.seq - Rodent sequence entries, part 12.
1322. gbrod13.seq - Rodent sequence entries, part 13.
1323. gbrod14.seq - Rodent sequence entries, part 14.
1324. gbrod15.seq - Rodent sequence entries, part 15.
1325. gbrod16.seq - Rodent sequence entries, part 16.
1326. gbrod17.seq - Rodent sequence entries, part 17.
1327. gbrod18.seq - Rodent sequence entries, part 18.
1328. gbrod19.seq - Rodent sequence entries, part 19.
1329. gbrod2.seq - Rodent sequence entries, part 2.
1330. gbrod20.seq - Rodent sequence entries, part 20.
1331. gbrod21.seq - Rodent sequence entries, part 21.
1332. gbrod22.seq - Rodent sequence entries, part 22.
1333. gbrod23.seq - Rodent sequence entries, part 23.
1334. gbrod24.seq - Rodent sequence entries, part 24.
1335. gbrod25.seq - Rodent sequence entries, part 25.
1336. gbrod26.seq - Rodent sequence entries, part 26.
1337. gbrod3.seq - Rodent sequence entries, part 3.
1338. gbrod4.seq - Rodent sequence entries, part 4.
1339. gbrod5.seq - Rodent sequence entries, part 5.
1340. gbrod6.seq - Rodent sequence entries, part 6.
1341. gbrod7.seq - Rodent sequence entries, part 7.
1342. gbrod8.seq - Rodent sequence entries, part 8.
1343. gbrod9.seq - Rodent sequence entries, part 9.
1344. gbsdr1.txt - Short directory of the data bank, part 1.
1345. gbsdr2.txt - Short directory of the data bank, part 2.
1346. gbsdr3.txt - Short directory of the data bank, part 3.
1347. gbsec.idx - Index of the entries according to secondary accession number.
1348. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1349. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1350. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1351. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1352. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1353. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1354. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1355. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1356. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1357. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1358. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1359. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1360. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1361. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1362. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1363. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1364. gbuna.seq - Unannotated sequence entries.
1365. gbvrl1.seq - Viral sequence entries, part 1.
1366. gbvrl2.seq - Viral sequence entries, part 2.
1367. gbvrl3.seq - Viral sequence entries, part 3.
1368. gbvrl4.seq - Viral sequence entries, part 4.
1369. gbvrl5.seq - Viral sequence entries, part 5.
1370. gbvrl6.seq - Viral sequence entries, part 6.
1371. gbvrl7.seq - Viral sequence entries, part 7.
1372. gbvrl8.seq - Viral sequence entries, part 8.
1373. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1374. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1375. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1376. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1377. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1378. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1379. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1380. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1381. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1382. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1383. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1384. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1385. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1386. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 162.0 flatfiles require roughly 305 GB (sequence
files only) or 325 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 608098410     gbacc1.idx
1529890932     gbacc2.idx
 553472211     gbacc3.idx
 185316620     gbaut1.idx
 194263722     gbaut10.idx
 250131113     gbaut11.idx
 185120979     gbaut12.idx
 183729826     gbaut13.idx
 185077070     gbaut14.idx
 185979662     gbaut15.idx
 184352545     gbaut16.idx
 183577509     gbaut17.idx
 184098448     gbaut18.idx
 190492233     gbaut19.idx
 185358422     gbaut2.idx
 223975571     gbaut20.idx
 185491115     gbaut21.idx
 184005221     gbaut22.idx
 228948743     gbaut23.idx
 198072862     gbaut24.idx
 202221773     gbaut25.idx
 183873564     gbaut26.idx
 183658687     gbaut27.idx
 237139550     gbaut28.idx
 184270263     gbaut29.idx
 215187600     gbaut3.idx
 185133713     gbaut30.idx
 186548610     gbaut31.idx
 191757313     gbaut32.idx
 184096460     gbaut33.idx
 184536371     gbaut34.idx
 184132003     gbaut35.idx
 183819992     gbaut36.idx
 183984365     gbaut37.idx
 185218892     gbaut38.idx
 202763047     gbaut39.idx
 185231205     gbaut4.idx
 185440877     gbaut40.idx
 200478352     gbaut41.idx
 251405982     gbaut42.idx
 184168266     gbaut43.idx
 183694635     gbaut44.idx
 230770649     gbaut45.idx
 183773972     gbaut46.idx
 251136309     gbaut47.idx
  84550229     gbaut48.idx
 183618182     gbaut5.idx
 189092927     gbaut6.idx
 186318901     gbaut7.idx
 244586771     gbaut8.idx
 241026285     gbaut9.idx
 250612071     gbbct1.seq
 250546942     gbbct10.seq
 252774999     gbbct11.seq
 250862396     gbbct12.seq
 252288626     gbbct13.seq
 255282909     gbbct14.seq
 253716331     gbbct15.seq
 253525429     gbbct16.seq
 259760166     gbbct17.seq
 254726574     gbbct18.seq
 254491542     gbbct19.seq
 252215884     gbbct2.seq
 257586609     gbbct20.seq
 254787390     gbbct21.seq
 267681950     gbbct22.seq
 250182925     gbbct23.seq
 250004071     gbbct24.seq
  65803029     gbbct25.seq
 260945998     gbbct3.seq
 250000534     gbbct4.seq
 250003371     gbbct5.seq
 253417404     gbbct6.seq
 254138138     gbbct7.seq
 250002352     gbbct8.seq
 266597750     gbbct9.seq
   9551549     gbchg.txt
 250616620     gbcon1.seq
 250025495     gbcon10.seq
 250004273     gbcon11.seq
 250001389     gbcon12.seq
 250001262     gbcon13.seq
 250002821     gbcon14.seq
 249689550     gbcon15.seq
 249929199     gbcon16.seq
 249941067     gbcon17.seq
 250004480     gbcon18.seq
 250000272     gbcon19.seq
 251258493     gbcon2.seq
 250004092     gbcon20.seq
 250001267     gbcon21.seq
 250001930     gbcon22.seq
 250001335     gbcon23.seq
 250000718     gbcon24.seq
 250003687     gbcon25.seq
 250002796     gbcon26.seq
 250000581     gbcon27.seq
 250001799     gbcon28.seq
 250001907     gbcon29.seq
 250379220     gbcon3.seq
 250001098     gbcon30.seq
 250001017     gbcon31.seq
 250002918     gbcon32.seq
 250002969     gbcon33.seq
 250004565     gbcon34.seq
 250002912     gbcon35.seq
 250003337     gbcon36.seq
 250000913     gbcon37.seq
 250001468     gbcon38.seq
 250002785     gbcon39.seq
 250001411     gbcon4.seq
 250001616     gbcon40.seq
 250002452     gbcon41.seq
 250000958     gbcon42.seq
 250003276     gbcon43.seq
 250001402     gbcon44.seq
 250001305     gbcon45.seq
 250002090     gbcon46.seq
 250002618     gbcon47.seq
 250003788     gbcon48.seq
 250000529     gbcon49.seq
 250000611     gbcon5.seq
 250003550     gbcon50.seq
 250001674     gbcon51.seq
 250003976     gbcon52.seq
 250001172     gbcon53.seq
 250003472     gbcon54.seq
 250001874     gbcon55.seq
 250003819     gbcon56.seq
 250006173     gbcon57.seq
 250000869     gbcon58.seq
 250003697     gbcon59.seq
 250002457     gbcon6.seq
 250001356     gbcon60.seq
 250003809     gbcon61.seq
 250001845     gbcon62.seq
 250002937     gbcon63.seq
 250003354     gbcon64.seq
 250005811     gbcon65.seq
 250003580     gbcon66.seq
 250000650     gbcon67.seq
 250002696     gbcon68.seq
 250000564     gbcon69.seq
 250002666     gbcon7.seq
 250004005     gbcon70.seq
 250001204     gbcon71.seq
 250001809     gbcon72.seq
 250004552     gbcon73.seq
 250002912     gbcon74.seq
 250004274     gbcon75.seq
 250002110     gbcon76.seq
 250000354     gbcon77.seq
 250002866     gbcon78.seq
 250001402     gbcon79.seq
 223123817     gbcon8.seq
 250002903     gbcon80.seq
 250001764     gbcon81.seq
 239305086     gbcon82.seq
  21163313     gbcon83.seq
 250185874     gbcon9.seq
    307743     gbdel.txt
 250001898     gbenv1.seq
 250002579     gbenv2.seq
 250002097     gbenv3.seq
 250000806     gbenv4.seq
 250000297     gbenv5.seq
 250001604     gbenv6.seq
 129346982     gbenv7.seq
 230688948     gbest1.seq
 230688888     gbest10.seq
 230689896     gbest100.seq
 230689655     gbest101.seq
 230688327     gbest102.seq
 230689396     gbest103.seq
 230688332     gbest104.seq
 230688015     gbest105.seq
 230688266     gbest106.seq
 230690026     gbest107.seq
 230690762     gbest108.seq
 230689436     gbest109.seq
 230687810     gbest11.seq
 230688893     gbest110.seq
 230690458     gbest111.seq
 230687933     gbest112.seq
 230687798     gbest113.seq
 230689686     gbest114.seq
 230689614     gbest115.seq
 230688936     gbest116.seq
 230690494     gbest117.seq
 230689489     gbest118.seq
 230689408     gbest119.seq
 230688314     gbest12.seq
 230688701     gbest120.seq
 230689363     gbest121.seq
 230687491     gbest122.seq
 230687831     gbest123.seq
 230688586     gbest124.seq
 230690898     gbest125.seq
 230690443     gbest126.seq
 230688826     gbest127.seq
 230689078     gbest128.seq
 230689869     gbest129.seq
 230689562     gbest13.seq
 230689598     gbest130.seq
 230688726     gbest131.seq
 230689628     gbest132.seq
 230688185     gbest133.seq
 230688600     gbest134.seq
 230689084     gbest135.seq
 230690483     gbest136.seq
 230689142     gbest137.seq
 230688238     gbest138.seq
 230688451     gbest139.seq
 230689037     gbest14.seq
 230687965     gbest140.seq
 230689001     gbest141.seq
 230688980     gbest142.seq
 230688154     gbest143.seq
 230689258     gbest144.seq
 230687766     gbest145.seq
 230689552     gbest146.seq
 230688473     gbest147.seq
 230688132     gbest148.seq
 230690071     gbest149.seq
 230689056     gbest15.seq
 230689440     gbest150.seq
 230689155     gbest151.seq
 230689618     gbest152.seq
 230688071     gbest153.seq
 230689655     gbest154.seq
 230688980     gbest155.seq
 230688115     gbest156.seq
 230688694     gbest157.seq
 230688131     gbest158.seq
 230691123     gbest159.seq
 230687506     gbest16.seq
 230688256     gbest160.seq
 230688051     gbest161.seq
 230687464     gbest162.seq
 230689643     gbest163.seq
 230692032     gbest164.seq
 230687824     gbest165.seq
 230688536     gbest166.seq
 230687719     gbest167.seq
 230689581     gbest168.seq
 230687868     gbest169.seq
 230689942     gbest17.seq
 230688516     gbest170.seq
 230690052     gbest171.seq
 230688625     gbest172.seq
 230688080     gbest173.seq
 230689470     gbest174.seq
 230689058     gbest175.seq
 230687599     gbest176.seq
 230687691     gbest177.seq
 230688934     gbest178.seq
 230687610     gbest179.seq
 230689143     gbest18.seq
 222093431     gbest180.seq
 230687961     gbest181.seq
 230687739     gbest182.seq
 230687619     gbest183.seq
 230688776     gbest184.seq
 230688383     gbest185.seq
 230689609     gbest186.seq
 230688049     gbest187.seq
 230688216     gbest188.seq
 230688009     gbest189.seq
 230687626     gbest19.seq
 230689223     gbest190.seq
 230690019     gbest191.seq
 230689528     gbest192.seq
 230689854     gbest193.seq
 230690154     gbest194.seq
 230689264     gbest195.seq
 230687670     gbest196.seq
 230688229     gbest197.seq
 230688316     gbest198.seq
 230690304     gbest199.seq
 230690014     gbest2.seq
 230688433     gbest20.seq
 230689842     gbest200.seq
 230688764     gbest201.seq
 230690061     gbest202.seq
 230687580     gbest203.seq
 230689820     gbest204.seq
 230690382     gbest205.seq
 230688961     gbest206.seq
 230689520     gbest207.seq
 230687776     gbest208.seq
 230692017     gbest209.seq
 230687848     gbest21.seq
 230688533     gbest210.seq
 230688783     gbest211.seq
 230689262     gbest212.seq
 230687583     gbest213.seq
 230688365     gbest214.seq
 230687941     gbest215.seq
 230687445     gbest216.seq
 230687991     gbest217.seq
 230689877     gbest218.seq
 230689193     gbest219.seq
 230689284     gbest22.seq
 230688143     gbest220.seq
 230689704     gbest221.seq
 230688820     gbest222.seq
 230690427     gbest223.seq
 230689294     gbest224.seq
 230690250     gbest225.seq
 230687620     gbest226.seq
 230689473     gbest227.seq
 230688857     gbest228.seq
 230688037     gbest229.seq
 230689178     gbest23.seq
 219022729     gbest230.seq
 163087948     gbest231.seq
 162274219     gbest232.seq
 169398444     gbest233.seq
 168264354     gbest234.seq
 167203150     gbest235.seq
 165527045     gbest236.seq
 164895066     gbest237.seq
 164460583     gbest238.seq
 164404631     gbest239.seq
 230688547     gbest24.seq
 164270947     gbest240.seq
 164448098     gbest241.seq
 163419136     gbest242.seq
 167055846     gbest243.seq
 164631609     gbest244.seq
 161933104     gbest245.seq
 165246729     gbest246.seq
 168617936     gbest247.seq
 166686307     gbest248.seq
 165648896     gbest249.seq
 230690622     gbest25.seq
 165852300     gbest250.seq
 165119710     gbest251.seq
 164711055     gbest252.seq
 164238943     gbest253.seq
 164606967     gbest254.seq
 165313608     gbest255.seq
 174027996     gbest256.seq
 176701208     gbest257.seq
 174001580     gbest258.seq
 230689418     gbest259.seq
 230690312     gbest26.seq
 230690098     gbest260.seq
 230689182     gbest261.seq
 230689469     gbest262.seq
 230688796     gbest263.seq
 230687624     gbest264.seq
 230688636     gbest265.seq
 230689919     gbest266.seq
 230691127     gbest267.seq
 230688299     gbest268.seq
 230688031     gbest269.seq
 230689294     gbest27.seq
 230688825     gbest270.seq
 230688738     gbest271.seq
 230690667     gbest272.seq
 230689830     gbest273.seq
 230689884     gbest274.seq
 230687598     gbest275.seq
 230689813     gbest276.seq
 230690929     gbest277.seq
 230688464     gbest278.seq
 230688940     gbest279.seq
 230687981     gbest28.seq
 230688257     gbest280.seq
 230689105     gbest281.seq
 230688813     gbest282.seq
 230690314     gbest283.seq
 230689862     gbest284.seq
 230687545     gbest285.seq
 230689432     gbest286.seq
 230690645     gbest287.seq
 230688200     gbest288.seq
 230688018     gbest289.seq
 230688034     gbest29.seq
 215130724     gbest290.seq
 230690037     gbest291.seq
 230689463     gbest292.seq
 230688139     gbest293.seq
 230688471     gbest294.seq
 230689039     gbest295.seq
 230688188     gbest296.seq
 230690224     gbest297.seq
 230687752     gbest298.seq
 230688969     gbest299.seq
 230690086     gbest3.seq
 230689399     gbest30.seq
 230688825     gbest300.seq
 230687924     gbest301.seq
 230688139     gbest302.seq
 230688148     gbest303.seq
 230689568     gbest304.seq
 230690678     gbest305.seq
 230689180     gbest306.seq
 230690331     gbest307.seq
 230692319     gbest308.seq
 230690547     gbest309.seq
 230689798     gbest31.seq
 230688385     gbest310.seq
 230689269     gbest311.seq
 230688632     gbest312.seq
 230688009     gbest313.seq
 230689637     gbest314.seq
 230690394     gbest315.seq
 230690052     gbest316.seq
 230687912     gbest317.seq
 230690473     gbest318.seq
 230687924     gbest319.seq
 230688754     gbest32.seq
 230689376     gbest320.seq
 230690147     gbest321.seq
 230690237     gbest322.seq
 230691242     gbest323.seq
 230688967     gbest324.seq
 230689469     gbest325.seq
 230690894     gbest326.seq
 230689070     gbest327.seq
 230689113     gbest328.seq
 230687767     gbest329.seq
 230687853     gbest33.seq
 230689947     gbest330.seq
 230689501     gbest331.seq
 230689507     gbest332.seq
 230689110     gbest333.seq
 230688315     gbest334.seq
 230688923     gbest335.seq
 230688211     gbest336.seq
 230688780     gbest337.seq
 230688988     gbest338.seq
 230688434     gbest339.seq
 230689243     gbest34.seq
 230689510     gbest340.seq
 230690886     gbest341.seq
 201304814     gbest342.seq
 230688202     gbest343.seq
 230689347     gbest344.seq
 230687597     gbest345.seq
 230690491     gbest346.seq
 230688829     gbest347.seq
 230689335     gbest348.seq
 143379510     gbest349.seq
 230689934     gbest35.seq
 185676956     gbest350.seq
 230688317     gbest351.seq
 230690564     gbest352.seq
 230689403     gbest353.seq
 230691018     gbest354.seq
 230687685     gbest355.seq
 230688326     gbest356.seq
 230687790     gbest357.seq
 230687834     gbest358.seq
 230689198     gbest359.seq
 230688951     gbest36.seq
 230688648     gbest360.seq
 230689554     gbest361.seq
 230690188     gbest362.seq
 230688701     gbest363.seq
 230688125     gbest364.seq
 230688725     gbest365.seq
 230691501     gbest366.seq
 230687745     gbest367.seq
 230688447     gbest368.seq
 230687829     gbest369.seq
 230687469     gbest37.seq
 230688231     gbest370.seq
 230690350     gbest371.seq
 230690561     gbest372.seq
 230690266     gbest373.seq
 230687649     gbest374.seq
 230688476     gbest375.seq
 230688001     gbest376.seq
 230690634     gbest377.seq
 230690730     gbest378.seq
 230689647     gbest379.seq
 230689550     gbest38.seq
 230687625     gbest380.seq
 230688478     gbest381.seq
 230687569     gbest382.seq
 230690767     gbest383.seq
 230687455     gbest384.seq
 230689062     gbest385.seq
 230689049     gbest386.seq
 230691884     gbest387.seq
 230687751     gbest388.seq
 230687815     gbest389.seq
 230688220     gbest39.seq
 230689032     gbest390.seq
 230689726     gbest391.seq
 230689631     gbest392.seq
 230689489     gbest393.seq
 230687590     gbest394.seq
 230689035     gbest395.seq
 230691741     gbest396.seq
 230690419     gbest397.seq
 230303281     gbest398.seq
 230689270     gbest399.seq
 230687863     gbest4.seq
 230689239     gbest40.seq
 230688324     gbest400.seq
 230689758     gbest401.seq
 230690664     gbest402.seq
 230688388     gbest403.seq
 230690861     gbest404.seq
 230688411     gbest405.seq
 206749232     gbest406.seq
 230688535     gbest407.seq
 230688393     gbest408.seq
 230689437     gbest409.seq
 230688891     gbest41.seq
 230688765     gbest410.seq
 230687836     gbest411.seq
 230689155     gbest412.seq
 230690660     gbest413.seq
 230690548     gbest414.seq
 230689794     gbest415.seq
 230690379     gbest416.seq
 230687945     gbest417.seq
 230688020     gbest418.seq
 230689531     gbest419.seq
 230690213     gbest42.seq
 230690192     gbest420.seq
 230687673     gbest421.seq
 230691303     gbest422.seq
 230688275     gbest423.seq
 210576284     gbest424.seq
 210248243     gbest425.seq
 210125779     gbest426.seq
 210418122     gbest427.seq
 210287280     gbest428.seq
 210441714     gbest429.seq
 230688417     gbest43.seq
 211432929     gbest430.seq
 211742704     gbest431.seq
 211099666     gbest432.seq
 212442651     gbest433.seq
 213284367     gbest434.seq
 211277289     gbest435.seq
 210857436     gbest436.seq
 210812933     gbest437.seq
 210421990     gbest438.seq
 210172572     gbest439.seq
 230687683     gbest44.seq
 210212361     gbest440.seq
 210227477     gbest441.seq
 210089082     gbest442.seq
 225896416     gbest443.seq
 230689824     gbest444.seq
 230689541     gbest445.seq
 230688717     gbest446.seq
 230689203     gbest447.seq
 230689066     gbest448.seq
 230688614     gbest449.seq
 219146879     gbest45.seq
 230688777     gbest450.seq
 230688312     gbest451.seq
 230688780     gbest452.seq
 230689339     gbest453.seq
 230689275     gbest454.seq
 230688939     gbest455.seq
 230690483     gbest456.seq
 230691727     gbest457.seq
 230687539     gbest458.seq
 230689709     gbest459.seq
 192261097     gbest46.seq
 230688270     gbest460.seq
 230688922     gbest461.seq
 230695140     gbest462.seq
 230690450     gbest463.seq
 230689347     gbest464.seq
 230692645     gbest465.seq
 230689258     gbest466.seq
 230688217     gbest467.seq
 230688614     gbest468.seq
 230687706     gbest469.seq
 192008752     gbest47.seq
 224332786     gbest470.seq
 230689477     gbest471.seq
 230688965     gbest472.seq
 230690130     gbest473.seq
 230687843     gbest474.seq
 230689410     gbest475.seq
 230689042     gbest476.seq
 230688798     gbest477.seq
 230690995     gbest478.seq
 230690566     gbest479.seq
 216498591     gbest48.seq
 230690024     gbest480.seq
 230688014     gbest481.seq
 230691411     gbest482.seq
 230690414     gbest483.seq
 230690774     gbest484.seq
 230687905     gbest485.seq
 230689650     gbest486.seq
 230690799     gbest487.seq
 230688239     gbest488.seq
 230689393     gbest489.seq
 216220710     gbest49.seq
 230690040     gbest490.seq
 229932808     gbest491.seq
 230690185     gbest492.seq
 230690970     gbest493.seq
 230688924     gbest494.seq
 230690545     gbest495.seq
 230687519     gbest496.seq
 230689688     gbest497.seq
 230688602     gbest498.seq
 230688144     gbest499.seq
 164122792     gbest5.seq
 215876077     gbest50.seq
 230689313     gbest500.seq
 230691630     gbest501.seq
 230688087     gbest502.seq
 230688809     gbest503.seq
 230689750     gbest504.seq
 230689608     gbest505.seq
 230691217     gbest506.seq
 230689828     gbest507.seq
 230688172     gbest508.seq
 230689396     gbest509.seq
 216913883     gbest51.seq
 230689725     gbest510.seq
 226040330     gbest511.seq
 230688714     gbest512.seq
 230689270     gbest513.seq
 230690762     gbest514.seq
 230690283     gbest515.seq
 230687530     gbest516.seq
 230689009     gbest517.seq
 230687754     gbest518.seq
 230688123     gbest519.seq
 230688486     gbest52.seq
 230688709     gbest520.seq
 230691581     gbest521.seq
 230688332     gbest522.seq
 230689622     gbest523.seq
 230687866     gbest524.seq
 230688508     gbest525.seq
 196049260     gbest526.seq
 196033118     gbest527.seq
 230690689     gbest528.seq
 230689046     gbest529.seq
 230689446     gbest53.seq
 230688239     gbest530.seq
 230688621     gbest531.seq
 230690469     gbest532.seq
 230688100     gbest533.seq
 230687457     gbest534.seq
 230689245     gbest535.seq
 230689530     gbest536.seq
 230688316     gbest537.seq
 230689205     gbest538.seq
 230687733     gbest539.seq
 230688438     gbest54.seq
 230688513     gbest540.seq
 222463735     gbest541.seq
 230688964     gbest542.seq
 230689758     gbest543.seq
 230689215     gbest544.seq
 230688865     gbest545.seq
 230688270     gbest546.seq
 230687553     gbest547.seq
 225020145     gbest548.seq
 215154750     gbest549.seq
 225035271     gbest55.seq
 230687613     gbest550.seq
 230690375     gbest551.seq
 230689667     gbest552.seq
 230687998     gbest553.seq
 230687664     gbest554.seq
 230689764     gbest555.seq
 230687949     gbest556.seq
 230689476     gbest557.seq
 230689938     gbest558.seq
 230690013     gbest559.seq
 230687600     gbest56.seq
 230690139     gbest560.seq
 230689830     gbest561.seq
 230689529     gbest562.seq
 230687463     gbest563.seq
 230690018     gbest564.seq
 230689726     gbest565.seq
 230688726     gbest566.seq
 230688022     gbest567.seq
 230689429     gbest568.seq
 230687633     gbest569.seq
 230688032     gbest57.seq
 230687802     gbest570.seq
 230688408     gbest571.seq
 230690036     gbest572.seq
 230687958     gbest573.seq
 230689911     gbest574.seq
 230689032     gbest575.seq
 230688162     gbest576.seq
 230688266     gbest577.seq
 230688337     gbest578.seq
 230687583     gbest579.seq
 230691372     gbest58.seq
 230690028     gbest580.seq
 230384170     gbest581.seq
 230690714     gbest582.seq
 230688747     gbest583.seq
 230689641     gbest584.seq
 230691704     gbest585.seq
 230688555     gbest586.seq
 230689021     gbest587.seq
 230687661     gbest588.seq
 230689329     gbest589.seq
 230687531     gbest59.seq
 230688934     gbest590.seq
 230688934     gbest591.seq
 230687964     gbest592.seq
 230689079     gbest593.seq
 230687630     gbest594.seq
 230689282     gbest595.seq
 230688328     gbest596.seq
 230688370     gbest597.seq
 230690135     gbest598.seq
 230689303     gbest599.seq
 177439121     gbest6.seq
 230690771     gbest60.seq
 230688164     gbest600.seq
 230688637     gbest601.seq
 230689883     gbest602.seq
 230688126     gbest603.seq
 230688527     gbest604.seq
 230690833     gbest605.seq
 230687951     gbest606.seq
 230689959     gbest607.seq
 230687791     gbest608.seq
 230689839     gbest609.seq
 230689876     gbest61.seq
 230688969     gbest610.seq
 230689326     gbest611.seq
 230689682     gbest612.seq
 230688480     gbest613.seq
 230688948     gbest614.seq
 229079168     gbest615.seq
 230688751     gbest616.seq
 230690832     gbest617.seq
 228351321     gbest618.seq
 217270068     gbest619.seq
 230689479     gbest62.seq
 230689357     gbest620.seq
 224216997     gbest621.seq
 189317178     gbest622.seq
 189187380     gbest623.seq
 192208885     gbest624.seq
 190798039     gbest625.seq
 190406934     gbest626.seq
 189917264     gbest627.seq
 192189432     gbest628.seq
 190304223     gbest629.seq
 230687898     gbest63.seq
 190055254     gbest630.seq
 191468757     gbest631.seq
 230688432     gbest632.seq
 230689682     gbest633.seq
 230687609     gbest634.seq
 230687703     gbest635.seq
 230689824     gbest636.seq
 230687523     gbest637.seq
 230689109     gbest638.seq
 230688145     gbest639.seq
 230687890     gbest64.seq
 230688425     gbest640.seq
 230688557     gbest641.seq
 230687662     gbest642.seq
 230689520     gbest643.seq
 230688704     gbest644.seq
 230690136     gbest645.seq
 230688558     gbest646.seq
 218995909     gbest647.seq
 230690483     gbest648.seq
 181346965     gbest649.seq
 230690106     gbest65.seq
 230690189     gbest66.seq
 230688040     gbest67.seq
 230690690     gbest68.seq
 230688682     gbest69.seq
 230689869     gbest7.seq
 230689234     gbest70.seq
 230691771     gbest71.seq
 209403792     gbest72.seq
 209434778     gbest73.seq
 208565052     gbest74.seq
 209103912     gbest75.seq
 209732667     gbest76.seq
 210370023     gbest77.seq
 209766358     gbest78.seq
 208259457     gbest79.seq
 230687935     gbest8.seq
 210228195     gbest80.seq
 208581327     gbest81.seq
 205330078     gbest82.seq
 208570208     gbest83.seq
 207857402     gbest84.seq
 210917058     gbest85.seq
 225496185     gbest86.seq
 230688801     gbest87.seq
 230688637     gbest88.seq
 221402255     gbest89.seq
 230688178     gbest9.seq
 214526016     gbest90.seq
 213979065     gbest91.seq
 230689498     gbest92.seq
 230688349     gbest93.seq
 230689854     gbest94.seq
 230688925     gbest95.seq
 230690360     gbest96.seq
 230688292     gbest97.seq
 230687809     gbest98.seq
 230689136     gbest99.seq
  72456745     gbgen.idx
 230689941     gbgss1.seq
 230688990     gbgss10.seq
 230690229     gbgss100.seq
 227755793     gbgss101.seq
 228841479     gbgss102.seq
 228541374     gbgss103.seq
 228595875     gbgss104.seq
 227721818     gbgss105.seq
 230687977     gbgss106.seq
 230688913     gbgss107.seq
 230688620     gbgss108.seq
 230688423     gbgss109.seq
 230687697     gbgss11.seq
 230690189     gbgss110.seq
 230690194     gbgss111.seq
 230690069     gbgss112.seq
 230688846     gbgss113.seq
 230687531     gbgss114.seq
 230688700     gbgss115.seq
 230688921     gbgss116.seq
 230688996     gbgss117.seq
 230687888     gbgss118.seq
 230688574     gbgss119.seq
 230688133     gbgss12.seq
 230688155     gbgss120.seq
 230687771     gbgss121.seq
 230689432     gbgss122.seq
 230688540     gbgss123.seq
 230688340     gbgss124.seq
 230688423     gbgss125.seq
 230688215     gbgss126.seq
 230687766     gbgss127.seq
 230689462     gbgss128.seq
 230689489     gbgss129.seq
 230689916     gbgss13.seq
 230690586     gbgss130.seq
 230687962     gbgss131.seq
 230689638     gbgss132.seq
 230689035     gbgss133.seq
 230687502     gbgss134.seq
 230687664     gbgss135.seq
 230689319     gbgss136.seq
 230690154     gbgss137.seq
 230689549     gbgss138.seq
 230688991     gbgss139.seq
 230687590     gbgss14.seq
 230688920     gbgss140.seq
 230688833     gbgss141.seq
 230687795     gbgss142.seq
 230688337     gbgss143.seq
 230689244     gbgss144.seq
 224503101     gbgss145.seq
 230687517     gbgss146.seq
 230687600     gbgss147.seq
 197563866     gbgss148.seq
 230690222     gbgss149.seq
 230689087     gbgss15.seq
 230690499     gbgss150.seq
 230687904     gbgss151.seq
 230689917     gbgss152.seq
 230689907     gbgss153.seq
 230688586     gbgss154.seq
 230690640     gbgss155.seq
 230687631     gbgss156.seq
 230688118     gbgss157.seq
 230689170     gbgss158.seq
 230688632     gbgss159.seq
 230689755     gbgss16.seq
 230689223     gbgss160.seq
 230688216     gbgss161.seq
 230689363     gbgss162.seq
 230689562     gbgss163.seq
 230688828     gbgss164.seq
 230688527     gbgss165.seq
 230688292     gbgss166.seq
 230687616     gbgss167.seq
 230688705     gbgss168.seq
 230688137     gbgss169.seq
 230690225     gbgss17.seq
 230690796     gbgss170.seq
 230689922     gbgss171.seq
 208050853     gbgss172.seq
 208682758     gbgss173.seq
 210729411     gbgss174.seq
 210151596     gbgss175.seq
 209283408     gbgss176.seq
 208498592     gbgss177.seq
 207526496     gbgss178.seq
 207371939     gbgss179.seq
 230687922     gbgss18.seq
 208176558     gbgss180.seq
 209779179     gbgss181.seq
 209807318     gbgss182.seq
 206143611     gbgss183.seq
 205631754     gbgss184.seq
 205473769     gbgss185.seq
 205558345     gbgss186.seq
 205293339     gbgss187.seq
 204767111     gbgss188.seq
 208051987     gbgss189.seq
 230690376     gbgss19.seq
 207842755     gbgss190.seq
 208167166     gbgss191.seq
 207825143     gbgss192.seq
 208523250     gbgss193.seq
 208794800     gbgss194.seq
 208807915     gbgss195.seq
 207138904     gbgss196.seq
 206132463     gbgss197.seq
 206154511     gbgss198.seq
 205747245     gbgss199.seq
 230687773     gbgss2.seq
 230691590     gbgss20.seq
 205514899     gbgss200.seq
 207413920     gbgss201.seq
 207037983     gbgss202.seq
 207271669     gbgss203.seq
 207098948     gbgss204.seq
 207301763     gbgss205.seq
 206903396     gbgss206.seq
 206962397     gbgss207.seq
 206980829     gbgss208.seq
 206824323     gbgss209.seq
 230689903     gbgss21.seq
 207267826     gbgss210.seq
 207610302     gbgss211.seq
 208727680     gbgss212.seq
 210122284     gbgss213.seq
 209532659     gbgss214.seq
 209988557     gbgss215.seq
 214351214     gbgss216.seq
 218857529     gbgss217.seq
 230688547     gbgss218.seq
 230688448     gbgss219.seq
 230689122     gbgss22.seq
 230687614     gbgss220.seq
 164241319     gbgss221.seq
 250002714     gbgss222.seq
 250002997     gbgss223.seq
 250000929     gbgss224.seq
 250003202     gbgss225.seq
 250002860     gbgss226.seq
 250000990     gbgss227.seq
 250001999     gbgss228.seq
 250000855     gbgss229.seq
 230688286     gbgss23.seq
 250003058     gbgss230.seq
 250002221     gbgss231.seq
 250002954     gbgss232.seq
 250003096     gbgss233.seq
 250000693     gbgss234.seq
 250003040     gbgss235.seq
 250003778     gbgss236.seq
 250000228     gbgss237.seq
 250000784     gbgss238.seq
 250004620     gbgss239.seq
 230688682     gbgss24.seq
 250001902     gbgss240.seq
 250001444     gbgss241.seq
 250001995     gbgss242.seq
 250000515     gbgss243.seq
 250000325     gbgss244.seq
 250002773     gbgss245.seq
 250000778     gbgss246.seq
 250001928     gbgss247.seq
 250000695     gbgss248.seq
 250000653     gbgss249.seq
 230687623     gbgss25.seq
 250001151     gbgss250.seq
 250000703     gbgss251.seq
 250001468     gbgss252.seq
 250000993     gbgss253.seq
 250000789     gbgss254.seq
 250001404     gbgss255.seq
 250002074     gbgss256.seq
 250001528     gbgss257.seq
 250002101     gbgss258.seq
 250000418     gbgss259.seq
 230690034     gbgss26.seq
 250002399     gbgss260.seq
 250001619     gbgss261.seq
 250002456     gbgss262.seq
 250001493     gbgss263.seq
 250001131     gbgss264.seq
 250002552     gbgss265.seq
 250000714     gbgss266.seq
 250001187     gbgss267.seq
 250002104     gbgss268.seq
 110124714     gbgss269.seq
 230689447     gbgss27.seq
 230690553     gbgss28.seq
 230689597     gbgss29.seq
 230690517     gbgss3.seq
 230690445     gbgss30.seq
 230690124     gbgss31.seq
 230688264     gbgss32.seq
 230687499     gbgss33.seq
 230689148     gbgss34.seq
 230687994     gbgss35.seq
 230687902     gbgss36.seq
 230688853     gbgss37.seq
 230688577     gbgss38.seq
 230690882     gbgss39.seq
 230690055     gbgss4.seq
 230689221     gbgss40.seq
 230687676     gbgss41.seq
 230688331     gbgss42.seq
 230689651     gbgss43.seq
 230689254     gbgss44.seq
 230687497     gbgss45.seq
 230690057     gbgss46.seq
 230690193     gbgss47.seq
 230688343     gbgss48.seq
 230687941     gbgss49.seq
 230687548     gbgss5.seq
 230688364     gbgss50.seq
 230688240     gbgss51.seq
 230687647     gbgss52.seq
 230690714     gbgss53.seq
 230688927     gbgss54.seq
 230688056     gbgss55.seq
 230687818     gbgss56.seq
 230688122     gbgss57.seq
 230690458     gbgss58.seq
 230688776     gbgss59.seq
 230689498     gbgss6.seq
 230688135     gbgss60.seq
 228959773     gbgss61.seq
 230689859     gbgss62.seq
 230689037     gbgss63.seq
 230688318     gbgss64.seq
 230688993     gbgss65.seq
 230689232     gbgss66.seq
 230687519     gbgss67.seq
 230689355     gbgss68.seq
 230689404     gbgss69.seq
 230690186     gbgss7.seq
 230688251     gbgss70.seq
 230689522     gbgss71.seq
 230687868     gbgss72.seq
 230688170     gbgss73.seq
 230688451     gbgss74.seq
 230688210     gbgss75.seq
 230689551     gbgss76.seq
 230689525     gbgss77.seq
 230689413     gbgss78.seq
 230688711     gbgss79.seq
 230689868     gbgss8.seq
 230689643     gbgss80.seq
 225890913     gbgss81.seq
 194150557     gbgss82.seq
 194331515     gbgss83.seq
 230689523     gbgss84.seq
 230688236     gbgss85.seq
 230688491     gbgss86.seq
 230689152     gbgss87.seq
 230688371     gbgss88.seq
 230689177     gbgss89.seq
 230688713     gbgss9.seq
 230688664     gbgss90.seq
 230689991     gbgss91.seq
 230688271     gbgss92.seq
 230690194     gbgss93.seq
 230688059     gbgss94.seq
 230690022     gbgss95.seq
 230687853     gbgss96.seq
 230687605     gbgss97.seq
 230688510     gbgss98.seq
 230688876     gbgss99.seq
 250013395     gbhtc1.seq
 250002604     gbhtc10.seq
 250004081     gbhtc11.seq
 176008653     gbhtc12.seq
 250001930     gbhtc2.seq
 250005704     gbhtc3.seq
 250002242     gbhtc4.seq
 250012527     gbhtc5.seq
 250007117     gbhtc6.seq
 250000761     gbhtc7.seq
 250003379     gbhtc8.seq
 250000452     gbhtc9.seq
 250096213     gbhtg1.seq
 250059722     gbhtg10.seq
 250012262     gbhtg100.seq
 250251687     gbhtg101.seq
 111468007     gbhtg102.seq
 250129717     gbhtg11.seq
 250028716     gbhtg12.seq
 250231891     gbhtg13.seq
 250115977     gbhtg14.seq
 250265760     gbhtg15.seq
 250201586     gbhtg16.seq
 250201829     gbhtg17.seq
 250155315     gbhtg18.seq
 250028301     gbhtg19.seq
 250020784     gbhtg2.seq
 250033810     gbhtg20.seq
 250164025     gbhtg21.seq
 250242948     gbhtg22.seq
 250144020     gbhtg23.seq
 250088982     gbhtg24.seq
 250032540     gbhtg25.seq
 250181202     gbhtg26.seq
 250195979     gbhtg27.seq
 250051909     gbhtg28.seq
 250111976     gbhtg29.seq
 250039037     gbhtg3.seq
 250120353     gbhtg30.seq
 250202904     gbhtg31.seq
 250220445     gbhtg32.seq
 250269348     gbhtg33.seq
 250031905     gbhtg34.seq
 250168461     gbhtg35.seq
 250228372     gbhtg36.seq
 250007538     gbhtg37.seq
 250080524     gbhtg38.seq
 250248959     gbhtg39.seq
 250101894     gbhtg4.seq
 250080112     gbhtg40.seq
 250013497     gbhtg41.seq
 250194918     gbhtg42.seq
 250061347     gbhtg43.seq
 250153143     gbhtg44.seq
 250008843     gbhtg45.seq
 250185139     gbhtg46.seq
 250163367     gbhtg47.seq
 250029684     gbhtg48.seq
 250227281     gbhtg49.seq
 250209185     gbhtg5.seq
 250347332     gbhtg50.seq
 250004404     gbhtg51.seq
 250344147     gbhtg52.seq
 250126601     gbhtg53.seq
 250111662     gbhtg54.seq
 250179867     gbhtg55.seq
 250342508     gbhtg56.seq
 250095525     gbhtg57.seq
 250052591     gbhtg58.seq
 250018393     gbhtg59.seq
 250053402     gbhtg6.seq
 250390350     gbhtg60.seq
 250114943     gbhtg61.seq
 250049269     gbhtg62.seq
 250098597     gbhtg63.seq
 250413852     gbhtg64.seq
 250089584     gbhtg65.seq
 250036347     gbhtg66.seq
 250023856     gbhtg67.seq
 250140937     gbhtg68.seq
 250026889     gbhtg69.seq
 250004219     gbhtg7.seq
 250052472     gbhtg70.seq
 250024225     gbhtg71.seq
 250211422     gbhtg72.seq
 250121800     gbhtg73.seq
 250040008     gbhtg74.seq
 250126514     gbhtg75.seq
 250030722     gbhtg76.seq
 250037539     gbhtg77.seq
 250136519     gbhtg78.seq
 250109157     gbhtg79.seq
 250124023     gbhtg8.seq
 250037962     gbhtg80.seq
 250102012     gbhtg81.seq
 250347134     gbhtg82.seq
 250137794     gbhtg83.seq
 250011257     gbhtg84.seq
 250050722     gbhtg85.seq
 250217448     gbhtg86.seq
 250255022     gbhtg87.seq
 250136660     gbhtg88.seq
 250044793     gbhtg89.seq
 250009914     gbhtg9.seq
 250094093     gbhtg90.seq
 250131009     gbhtg91.seq
 250081623     gbhtg92.seq
 250097217     gbhtg93.seq
 250034633     gbhtg94.seq
 250276912     gbhtg95.seq
 250152823     gbhtg96.seq
 250236933     gbhtg97.seq
 250188941     gbhtg98.seq
 250037995     gbhtg99.seq
 250028918     gbinv1.seq
 250002384     gbinv10.seq
 129121020     gbinv11.seq
 250061855     gbinv2.seq
 250025704     gbinv3.seq
 250001211     gbinv4.seq
 250656718     gbinv5.seq
 250000017     gbinv6.seq
 250002838     gbinv7.seq
 250001555     gbinv8.seq
 250003016     gbinv9.seq
 148904813     gbjou1.idx
 139114667     gbjou2.idx
 232753391     gbjou3.idx
 242060780     gbjou4.idx
 186532683     gbkey1.idx
 204449587     gbkey2.idx
   4995311     gbkey3.idx
 250001295     gbmam1.seq
 250000988     gbmam2.seq
 250000082     gbmam3.seq
  15274804     gbmam4.seq
  23996536     gbnew.txt
 250000400     gbpat1.seq
 250001056     gbpat10.seq
 250000357     gbpat11.seq
 250001287     gbpat12.seq
 250000753     gbpat13.seq
 250000248     gbpat14.seq
 250001401     gbpat15.seq
 250001581     gbpat16.seq
 250002042     gbpat17.seq
 250000091     gbpat18.seq
 250000017     gbpat19.seq
 250000203     gbpat2.seq
 250002120     gbpat20.seq
 250000609     gbpat21.seq
 250169779     gbpat22.seq
 250020331     gbpat23.seq
 250000577     gbpat24.seq
 250001698     gbpat25.seq
 250003375     gbpat26.seq
 250000034     gbpat27.seq
 250000695     gbpat28.seq
 250001560     gbpat29.seq
 250003352     gbpat3.seq
 250000676     gbpat30.seq
  41902507     gbpat31.seq
 250002405     gbpat4.seq
 250000083     gbpat5.seq
 250000202     gbpat6.seq
 250001518     gbpat7.seq
 250002702     gbpat8.seq
 250000010     gbpat9.seq
  63926113     gbphg.seq
 250109396     gbpln1.seq
 250001239     gbpln10.seq
 250002815     gbpln11.seq
 250103434     gbpln12.seq
 250084985     gbpln13.seq
 250189632     gbpln14.seq
 252519817     gbpln15.seq
 263382270     gbpln16.seq
 290699279     gbpln17.seq
 250002100     gbpln18.seq
 250001276     gbpln19.seq
 250067699     gbpln2.seq
 250002548     gbpln20.seq
 250244139     gbpln21.seq
 250004549     gbpln22.seq
 250001471     gbpln23.seq
 250001584     gbpln24.seq
 250005101     gbpln25.seq
 177899028     gbpln26.seq
 250134051     gbpln3.seq
 250002011     gbpln4.seq
 250004311     gbpln5.seq
 250000298     gbpln6.seq
 250000884     gbpln7.seq
 250000142     gbpln8.seq
 250124328     gbpln9.seq
 250102031     gbpri1.seq
 250108027     gbpri10.seq
 250057206     gbpri11.seq
 250028034     gbpri12.seq
 250196483     gbpri13.seq
 250044348     gbpri14.seq
 250198667     gbpri15.seq
 250033380     gbpri16.seq
 250166539     gbpri17.seq
 250092863     gbpri18.seq
 250033271     gbpri19.seq
 250016809     gbpri2.seq
 250007022     gbpri20.seq
 250034814     gbpri21.seq
 250077976     gbpri22.seq
 250061697     gbpri23.seq
 250001640     gbpri24.seq
 250202266     gbpri25.seq
 250095097     gbpri26.seq
 250171769     gbpri27.seq
 250033743     gbpri28.seq
 250007664     gbpri29.seq
 250222749     gbpri3.seq
 250004811     gbpri30.seq
 250216793     gbpri31.seq
 250002106     gbpri32.seq
 250080487     gbpri33.seq
 159684266     gbpri34.seq
 250186989     gbpri4.seq
 250056497     gbpri5.seq
 250068489     gbpri6.seq
 250066849     gbpri7.seq
 250220625     gbpri8.seq
 250189001     gbpri9.seq
    284217     gbrel.txt
 250096286     gbrod1.seq
 250043721     gbrod10.seq
 250088631     gbrod11.seq
 250213826     gbrod12.seq
 250042314     gbrod13.seq
 250077796     gbrod14.seq
 250093898     gbrod15.seq
 250056282     gbrod16.seq
 250021036     gbrod17.seq
 250138647     gbrod18.seq
 250076458     gbrod19.seq
 250192792     gbrod2.seq
 250318541     gbrod20.seq
 250005297     gbrod21.seq
 250003649     gbrod22.seq
 250250968     gbrod23.seq
 250000742     gbrod24.seq
 250010324     gbrod25.seq
  40554732     gbrod26.seq
 250282909     gbrod3.seq
 250123910     gbrod4.seq
 250130651     gbrod5.seq
 250196160     gbrod6.seq
 250219341     gbrod7.seq
 250156513     gbrod8.seq
 250159153     gbrod9.seq
1135747121     gbsdr1.txt
3718906513     gbsdr2.txt
1689252349     gbsdr3.txt
  96652999     gbsec.idx
 250001829     gbsts1.seq
 250003224     gbsts10.seq
 250002816     gbsts11.seq
 250002166     gbsts12.seq
 250002430     gbsts13.seq
 195245268     gbsts14.seq
 250002617     gbsts2.seq
 250000191     gbsts3.seq
 250003129     gbsts4.seq
 250001709     gbsts5.seq
 250003957     gbsts6.seq
 250000749     gbsts7.seq
 250003682     gbsts8.seq
 250000423     gbsts9.seq
 250000231     gbsyn1.seq
  14518150     gbsyn2.seq
    422715     gbuna.seq
 250002102     gbvrl1.seq
 250001860     gbvrl2.seq
 250001372     gbvrl3.seq
 250003978     gbvrl4.seq
 250002179     gbvrl5.seq
 250003021     gbvrl6.seq
 250000620     gbvrl7.seq
  85648222     gbvrl8.seq
 250162714     gbvrt1.seq
 250141031     gbvrt10.seq
 250003644     gbvrt11.seq
 250018582     gbvrt12.seq
 250000967     gbvrt13.seq
 186014805     gbvrt14.seq
 250001097     gbvrt2.seq
 250026014     gbvrt3.seq
 250000559     gbvrt4.seq
 250003347     gbvrt5.seq
 250096637     gbvrt6.seq
 250081085     gbvrt7.seq
 250014706     gbvrt8.seq
 250261372     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         31806      101567702
BCT10        163        100712006
BCT11        110        106854351
BCT12        51         112690832
BCT13        54         113679202
BCT14        51         118892891
BCT15        64         115725611
BCT16        59         112706292
BCT17        38         114247144
BCT18        61         112101133
BCT19        67         113469653
BCT2         4004       109586144
BCT20        58         112829080
BCT21        52         109948086
BCT22        243        112196253
BCT23        69896      85489325
BCT24        57647      88150956
BCT25        10832      24167230
BCT3         159        115987743
BCT4         22461      103647695
BCT5         54712      86800908
BCT6         5513       95573058
BCT7         14746      101019676
BCT8         33583      100989461
BCT9         36138      106741529
ENV1         91140      70832239
ENV2         96287      71349143
ENV3         86294      82873177
ENV4         91539      83319927
ENV5         135938     29105904
ENV6         99292      66167823
ENV7         50302      37869046
EST1         68126      26289737
EST10        76542      29845796
EST100       74757      43490420
EST101       70433      36387971
EST102       75739      34899007
EST103       72228      43523399
EST104       73901      35444701
EST105       72244      41293528
EST106       67984      36694776
EST107       73243      36063598
EST108       72540      49334498
EST109       72351      42765046
EST11        75113      28769858
EST110       69343      45251980
EST111       73588      33064572
EST112       70774      29714781
EST113       65001      33747011
EST114       67787      39246525
EST115       69895      39858792
EST116       71408      40376709
EST117       75368      34200664
EST118       74346      27482940
EST119       74624      30706581
EST12        77564      30748087
EST120       72157      38159401
EST121       65964      33625949
EST122       79204      47096164
EST123       78635      44243777
EST124       69938      47677626
EST125       69264      39428905
EST126       72788      49796064
EST127       68292      42473698
EST128       74026      44820076
EST129       74276      45016521
EST13        76997      29271395
EST130       71094      48614553
EST131       74466      48090563
EST132       75791      45973580
EST133       77158      32793250
EST134       77691      30218821
EST135       79877      48260610
EST136       74741      42612896
EST137       64473      35118680
EST138       72808      37445558
EST139       66249      36513598
EST14        78533      31826188
EST140       66425      36337267
EST141       70868      43669020
EST142       72852      43977966
EST143       67841      40385771
EST144       67263      40168893
EST145       75745      44169147
EST146       68844      41956641
EST147       59653      33624255
EST148       97869      53249769
EST149       83693      48101929
EST15        74616      31539433
EST150       79944      41241378
EST151       102038     54928910
EST152       107491     57787103
EST153       98668      54568891
EST154       73451      45027038
EST155       94227      55437084
EST156       99469      59454165
EST157       90992      55985039
EST158       80845      43294718
EST159       69772      40423512
EST16        75821      33351173
EST160       65650      31338152
EST161       62266      28253984
EST162       56311      26814406
EST163       65421      31556085
EST164       57030      28939669
EST165       73804      44536952
EST166       68203      43890990
EST167       69895      49321453
EST168       76603      43932369
EST169       58154      29971753
EST17        82203      33930985
EST170       64029      32521061
EST171       65726      38582634
EST172       64415      45354616
EST173       62543      35880986
EST174       100105     46032278
EST175       86005      49307270
EST176       99867      56938770
EST177       99673      57709916
EST178       96864      51815108
EST179       82829      40631423
EST18        80825      32242803
EST180       90180      36782499
EST181       94842      50237684
EST182       89360      37680355
EST183       93546      40628393
EST184       70402      38297115
EST185       68292      43910734
EST186       64844      37238762
EST187       65086      42688728
EST188       68326      30810358
EST189       76318      31862041
EST19        78549      31803087
EST190       69472      43822283
EST191       82421      40923139
EST192       61704      32045132
EST193       67561      47816457
EST194       70409      46271196
EST195       67504      36641146
EST196       66780      44518314
EST197       70337      54374340
EST198       68337      32625917
EST199       72237      40247408
EST2         74651      28647346
EST20        74686      30676945
EST200       69151      58832851
EST201       66335      50265205
EST202       63736      46385774
EST203       63297      46848911
EST204       65037      45872143
EST205       64256      44595988
EST206       63488      48809214
EST207       62462      39259310
EST208       65169      33884687
EST209       63351      37360936
EST21        73849      34320100
EST210       83564      45450241
EST211       84467      54914585
EST212       66663      39776062
EST213       104653     66009522
EST214       108118     65304890
EST215       109306     64850368
EST216       103901     66338272
EST217       106021     61691890
EST218       108627     49607412
EST219       86777      52478293
EST22        75217      30151870
EST220       90180      44511977
EST221       91432      42458104
EST222       77318      50868842
EST223       66836      38886137
EST224       68259      56298182
EST225       68034      59122424
EST226       76113      45908394
EST227       81293      42401289
EST228       76009      52385683
EST229       71086      51493906
EST23        77353      32671483
EST230       57428      35691547
EST231       27773      10513451
EST232       27841      10352898
EST233       26642      9833624
EST234       26870      9351364
EST235       27094      9275333
EST236       27176      10217431
EST237       27181      9695981
EST238       27240      10169918
EST239       27193      11687071
EST24        74783      32879873
EST240       27198      11367270
EST241       27236      10474480
EST242       27543      9507273
EST243       26999      9006342
EST244       27539      11154656
EST245       27905      10748796
EST246       27383      11085350
EST247       26615      11776099
EST248       26895      11671092
EST249       27101      10677314
EST25        73935      31829331
EST250       26963      11478263
EST251       27117      11708886
EST252       27240      11281088
EST253       27270      10782016
EST254       27226      10751481
EST255       27138      10563004
EST256       25584      15836524
EST257       25126      16591450
EST258       30430      18346646
EST259       94497      41274118
EST26        75307      31121574
EST260       46448      29882463
EST261       100180     39656011
EST262       74059      39234073
EST263       68626      44367920
EST264       69347      44589589
EST265       68982      44631782
EST266       64597      38493281
EST267       79103      45208490
EST268       63009      45722817
EST269       66858      38173197
EST27        74464      32452326
EST270       66916      33695267
EST271       102320     47328749
EST272       81627      44763109
EST273       69658      36049012
EST274       65822      31619627
EST275       69306      41835363
EST276       70398      33960778
EST277       70309      33235369
EST278       76419      46247838
EST279       63832      37023860
EST28        108076     51161102
EST280       67901      39307227
EST281       76432      37521301
EST282       82153      45499371
EST283       73939      49197288
EST284       77886      53505330
EST285       100553     49695314
EST286       93706      45106529
EST287       76609      43414138
EST288       70199      46268966
EST289       74651      32829992
EST29        97079      45955830
EST290       70432      31294486
EST291       71895      36233828
EST292       64354      38544818
EST293       58665      37415180
EST294       73482      43578764
EST295       63368      43042309
EST296       62315      34515662
EST297       83561      44112998
EST298       83179      40832405
EST299       69529      44562969
EST3         73738      29918375
EST30        98323      53735898
EST300       103667     58728513
EST301       120667     47963392
EST302       86071      39591414
EST303       64471      35347663
EST304       71835      45123243
EST305       81590      41160853
EST306       70020      41776161
EST307       70172      41573727
EST308       65993      36600828
EST309       62249      37245973
EST31        83927      48617956
EST310       49827      27044624
EST311       73119      53422574
EST312       73453      42620017
EST313       72502      43968408
EST314       65742      35237461
EST315       65714      33861094
EST316       54020      27118164
EST317       53169      27389242
EST318       52958      28266643
EST319       51845      27583519
EST32        65450      46011243
EST320       52895      28538347
EST321       55874      23427961
EST322       55724      23891889
EST323       54212      22232706
EST324       55459      21638429
EST325       54768      21700282
EST326       56357      22785884
EST327       54961      21411079
EST328       56037      20441720
EST329       60504      26829158
EST33        72738      55112834
EST330       76920      40909041
EST331       74061      33985582
EST332       76428      31512722
EST333       74316      31366060
EST334       86645      52340980
EST335       72053      55614573
EST336       85947      53981608
EST337       93127      55954146
EST338       94473      56129988
EST339       101187     57098877
EST34        85388      48209607
EST340       98466      55206291
EST341       70140      37962978
EST342       68869      37787763
EST343       72891      45392227
EST344       63585      52920729
EST345       62948      46934792
EST346       63865      38226921
EST347       66096      42553223
EST348       71348      46244002
EST349       47836      23979677
EST35        86485      43975866
EST350       54264      26739309
EST351       74378      42024927
EST352       56868      28716914
EST353       64352      36258804
EST354       68877      43053044
EST355       82015      41014934
EST356       69635      42006813
EST357       69489      43115485
EST358       63962      37150257
EST359       70992      45858096
EST36        94930      51758166
EST360       88256      49052543
EST361       84555      50451399
EST362       73699      40392377
EST363       60643      36544313
EST364       72989      38541197
EST365       62895      32681595
EST366       47465      24401019
EST367       73207      42415653
EST368       76039      42011930
EST369       98288      46659346
EST37        84710      59000300
EST370       71568      49685951
EST371       68908      44362113
EST372       66728      42695558
EST373       64122      34845378
EST374       85664      37616150
EST375       72298      39850080
EST376       54300      38398251
EST377       63262      38579443
EST378       61084      39715301
EST379       95595      53570238
EST38        77036      53542712
EST380       79432      41986010
EST381       70661      47113764
EST382       71639      36760323
EST383       47751      29666272
EST384       44083      23090704
EST385       78598      52861052
EST386       80306      39597437
EST387       78753      47087798
EST388       75277      46128334
EST389       77515      48027220
EST39        89805      53372773
EST390       80195      52976635
EST391       83764      66636689
EST392       79869      65614999
EST393       82537      41900643
EST394       65648      38247400
EST395       63367      41464665
EST396       71646      38321804
EST397       54173      34753972
EST398       82071      27294820
EST399       81061      35496960
EST4         74566      28390659
EST40        63463      49906853
EST400       66800      39834544
EST401       65827      36973242
EST402       68646      38153452
EST403       74765      44007908
EST404       64084      45105176
EST405       61501      39130146
EST406       79871      46750217
EST407       56345      32112609
EST408       61948      38786755
EST409       79293      50226057
EST41        86195      49274469
EST410       85676      49544067
EST411       73453      42408922
EST412       58856      41203960
EST413       56927      40976226
EST414       57243      40510470
EST415       64243      39582215
EST416       73626      44610445
EST417       54986      34421714
EST418       60348      38835937
EST419       57934      40690096
EST42        102872     46026938
EST420       61361      41317145
EST421       55660      41893668
EST422       46886      33482630
EST423       93961      42303878
EST424       69455      38574376
EST425       69706      38352318
EST426       69862      38234698
EST427       69523      38799566
EST428       69618      38459154
EST429       69556      38761431
EST43        88538      45440545
EST430       68932      38347109
EST431       68826      39295143
EST432       69214      38321694
EST433       68088      37407570
EST434       67803      38809447
EST435       69387      39090552
EST436       69275      38210019
EST437       69407      38432983
EST438       69602      38019630
EST439       69842      38207021
EST44        101515     47449633
EST440       69701      38322771
EST441       69736      38361394
EST442       69989      37258304
EST443       85285      49071052
EST444       83942      43099215
EST445       81855      38679934
EST446       97767      56577879
EST447       79407      43206523
EST448       79494      50659785
EST449       89807      57295820
EST45        87653      33879985
EST450       97030      59300517
EST451       74050      43046864
EST452       86318      47155977
EST453       83512      48724682
EST454       52242      40131951
EST455       54921      42429797
EST456       75373      43016961
EST457       55208      33584824
EST458       88692      48867233
EST459       111232     58738215
EST46        68735      18416190
EST460       74313      46936461
EST461       79619      56831705
EST462       39326      21244534
EST463       50745      54921249
EST464       46768      58212373
EST465       77730      52457765
EST466       65145      37425009
EST467       73268      41830335
EST468       68301      42160448
EST469       70519      43399519
EST47        68637      18322481
EST470       60373      52544366
EST471       85602      43174157
EST472       109170     47908015
EST473       79270      53276311
EST474       60833      39401035
EST475       57198      40845502
EST476       57879      38842216
EST477       65768      49910561
EST478       64497      45126344
EST479       60565      43030372
EST48        62355      19027020
EST480       51905      38242986
EST481       53748      38040074
EST482       58707      42223672
EST483       67013      37388627
EST484       67611      44096747
EST485       57159      38027565
EST486       58862      40970054
EST487       61026      46676257
EST488       65164      48684525
EST489       63928      42247272
EST49        43705      11980620
EST490       51353      40439598
EST491       56607      37533629
EST492       53111      35923376
EST493       59047      38906088
EST494       64623      39402165
EST495       67584      44606476
EST496       72674      60521172
EST497       71669      50077376
EST498       65789      52207789
EST499       46895      56850918
EST5         48195      15294043
EST50        43302      11933283
EST500       59230      51163848
EST501       65815      42273374
EST502       66568      39770899
EST503       79610      48420885
EST504       82320      54359278
EST505       79382      49256405
EST506       66356      40683441
EST507       66531      40513837
EST508       73575      51435875
EST509       81659      47652385
EST51        43182      11438024
EST510       76343      63874463
EST511       69413      48527583
EST512       71827      47854038
EST513       67596      50458210
EST514       61756      46782836
EST515       63161      44833671
EST516       88514      46804888
EST517       84465      40345066
EST518       116371     43567574
EST519       96273      53935107
EST52        80572      33088833
EST520       67799      51605838
EST521       50569      49887076
EST522       78577      34652139
EST523       99624      11184304
EST524       99779      10924755
EST525       95388      36206621
EST526       86993      31686137
EST527       87007      31668178
EST528       68114      51025084
EST529       74140      58169407
EST53        90898      37167526
EST530       87169      51613551
EST531       78269      43535158
EST532       70517      49478977
EST533       72062      45751080
EST534       81368      53252747
EST535       79420      48082502
EST536       75469      54270485
EST537       64010      47560223
EST538       77498      56475242
EST539       90567      48900020
EST54        94329      42623984
EST540       81393      45104963
EST541       82599      42770355
EST542       80720      42136014
EST543       81256      48568387
EST544       77578      52595728
EST545       72597      55012002
EST546       70626      41559458
EST547       95950      50972563
EST548       109478     45837040
EST549       108461     48602431
EST55        91554      46239590
EST550       131307     56579979
EST551       120842     56369202
EST552       74297      54494090
EST553       80774      42523056
EST554       84288      8747748
EST555       84845      18794113
EST556       126040     62209084
EST557       119102     55444306
EST558       67388      44987931
EST559       69540      40547905
EST56        89617      42243492
EST560       70632      48770848
EST561       76114      46247129
EST562       72547      44712023
EST563       73224      46752633
EST564       69850      53472430
EST565       92925      54970719
EST566       97608      51373323
EST567       66758      35204501
EST568       63046      44595641
EST569       83523      54770187
EST57        102415     52212916
EST570       99276      58378807
EST571       75007      43761639
EST572       77632      40267952
EST573       88363      47221638
EST574       92548      46721962
EST575       70252      50727986
EST576       79579      55985637
EST577       88107      54301950
EST578       85283      56861460
EST579       84158      51243748
EST58        100324     51099642
EST580       76478      39946286
EST581       74494      46419490
EST582       63209      42457889
EST583       70193      34235057
EST584       103705     38774024
EST585       49960      34741440
EST586       51548      31602060
EST587       50695      35509286
EST588       68011      43001926
EST589       70590      49495847
EST59        76865      33180613
EST590       71303      49098487
EST591       122559     11172916
EST592       118193     14581907
EST593       122555     11181731
EST594       122483     11289402
EST595       94009      31898790
EST596       67953      51410133
EST597       74710      48686142
EST598       79415      54650127
EST599       69295      49445907
EST6         54920      17444122
EST60        66199      28700016
EST600       73103      44009172
EST601       67251      43773336
EST602       67920      41665913
EST603       78965      40907000
EST604       71965      46478120
EST605       71074      52568630
EST606       82920      46195372
EST607       88766      53062276
EST608       60043      34370554
EST609       71637      40320321
EST61        72842      32389595
EST610       78319      47797803
EST611       108759     49160147
EST612       77161      51336861
EST613       61412      48498390
EST614       66691      55079716
EST615       74353      37642399
EST616       85948      50897529
EST617       84937      51434409
EST618       75660      48980663
EST619       71487      46907585
EST62        70959      30035850
EST620       70137      51656212
EST621       91501      41770588
EST622       79205      26705619
EST623       79330      24985170
EST624       77036      29646311
EST625       78166      26827755
EST626       77942      29682123
EST627       78229      29322683
EST628       77092      29117534
EST629       78303      27910791
EST63        80265      32524166
EST630       78065      30413825
EST631       78492      29197718
EST632       80008      46996837
EST633       81831      60108226
EST634       81940      59811039
EST635       75585      44834668
EST636       62444      35002752
EST637       74088      45932697
EST638       60196      45000831
EST639       58373      45336530
EST64        74863      29534197
EST640       64697      46479199
EST641       86908      53195685
EST642       89991      44533164
EST643       69504      25472971
EST644       72937      27187864
EST645       73748      26085274
EST646       75798      27101543
EST647       72710      25046551
EST648       71120      29245577
EST649       59776      22073386
EST65        71014      28583450
EST66        64211      29592776
EST67        74858      33568216
EST68        77524      34643067
EST69        72879      28981069
EST7         74544      29357604
EST70        76117      25944101
EST71        86693      41608142
EST72        40647      11485451
EST73        40417      11119432
EST74        40374      12418877
EST75        40775      12592324
EST76        40819      12229820
EST77        40755      13108149
EST78        40506      12925599
EST79        40588      12086218
EST8         75832      30592480
EST80        40142      11969512
EST81        40853      12783050
EST82        41440      11769090
EST83        41006      13167641
EST84        40884      12774935
EST85        42146      13084996
EST86        45819      15388987
EST87        43043      27115919
EST88        42159      19949582
EST89        47603      19236078
EST9         77569      29868052
EST90        50754      22677298
EST91        51203      21532189
EST92        79404      46660022
EST93        77255      38149991
EST94        72052      27897915
EST95        75976      29568927
EST96        74291      39292243
EST97        76683      41590091
EST98        77563      44780007
EST99        75702      34662826
GSS1         90401      38650175
GSS10        74890      43604187
GSS100       80682      52426952
GSS101       74603      42575690
GSS102       73343      45759628
GSS103       73691      44884439
GSS104       73287      45619628
GSS105       73272      44804615
GSS106       75228      45659185
GSS107       81208      54535717
GSS108       83792      55524695
GSS109       80752      52730487
GSS11        70616      35924456
GSS110       82695      50149476
GSS111       84178      57290609
GSS112       79986      60363741
GSS113       90713      45904159
GSS114       90420      53751379
GSS115       73800      49906023
GSS116       89326      64910901
GSS117       82246      59216313
GSS118       75860      41659234
GSS119       81617      51036520
GSS12        72814      38256982
GSS120       95334      53233799
GSS121       84324      55709317
GSS122       84959      54757535
GSS123       82055      55420652
GSS124       76193      69486340
GSS125       76169      66903410
GSS126       79427      55411578
GSS127       72457      50191076
GSS128       72505      50091533
GSS129       73123      49059240
GSS13        76711      38985455
GSS130       72182      50691056
GSS131       74150      50385190
GSS132       84053      59900200
GSS133       80797      58678071
GSS134       69352      55920196
GSS135       71355      55437777
GSS136       75855      67842956
GSS137       75720      62415002
GSS138       77177      52454794
GSS139       86384      53687867
GSS14        71315      32132476
GSS140       94682      58087976
GSS141       93197      60032496
GSS142       81857      53641452
GSS143       88696      51262248
GSS144       74377      58452521
GSS145       114872     59716361
GSS146       110104     58695541
GSS147       86899      63131193
GSS148       52237      29990469
GSS149       67778      48213405
GSS15        70026      34720280
GSS150       73000      55888822
GSS151       72979      55923934
GSS152       73001      55887748
GSS153       73013      55865819
GSS154       72972      55936122
GSS155       72977      55929907
GSS156       75716      57531452
GSS157       83991      39610966
GSS158       88396      60280594
GSS159       85807      65768044
GSS16        78504      46313034
GSS160       88887      58894462
GSS161       87398      56742222
GSS162       85799      61166168
GSS163       82726      54296037
GSS164       93185      58717753
GSS165       88223      62505245
GSS166       84994      60390436
GSS167       114893     10559580
GSS168       90900      43422475
GSS169       72828      49299280
GSS17        70910      33291563
GSS170       46920      34292476
GSS171       64757      53637365
GSS172       58751      46322589
GSS173       58467      46819976
GSS174       57450      48918770
GSS175       57857      47631290
GSS176       58475      45730366
GSS177       58611      47132371
GSS178       58765      48990586
GSS179       58873      48656604
GSS18        59109      27963046
GSS180       58553      48909979
GSS181       58290      47160966
GSS182       58276      47231514
GSS183       59933      50535273
GSS184       60261      49876020
GSS185       60378      49555354
GSS186       60317      49735299
GSS187       60501      49183926
GSS188       60871      47927010
GSS189       58807      46426544
GSS19        56790      29081502
GSS190       58956      45979519
GSS191       58727      46698720
GSS192       58967      45949260
GSS193       58479      47477332
GSS194       58289      48071419
GSS195       58280      48098895
GSS196       59283      49368450
GSS197       59863      50801589
GSS198       59883      50473892
GSS199       60490      46318072
GSS2         88895      39291144
GSS20        57669      26710654
GSS200       60654      45819964
GSS201       59333      49895455
GSS202       59599      49093784
GSS203       59434      49593729
GSS204       59554      49228325
GSS205       59413      49660861
GSS206       59690      48814521
GSS207       59650      48937070
GSS208       59635      48981772
GSS209       59743      48652190
GSS21        61396      28908418
GSS210       59367      47025021
GSS211       59062      45359459
GSS212       58502      47209759
GSS213       58205      48275538
GSS214       58624      46963858
GSS215       58104      47541846
GSS216       61332      51099806
GSS217       64819      54766451
GSS218       81614      60031827
GSS219       94551      51072214
GSS22        64820      38304256
GSS220       76419      55171280
GSS221       58083      41512654
GSS222       86842      64244408
GSS223       83568      62773355
GSS224       103053     48151609
GSS225       68650      58534221
GSS226       68310      58772205
GSS227       69366      56632569
GSS228       69633      56114651
GSS229       70340      55385086
GSS23        57539      27052676
GSS230       85849      73194532
GSS231       86389      44988051
GSS232       88403      46749722
GSS233       85025      64872278
GSS234       70296      58979389
GSS235       69872      59837496
GSS236       63607      60977067
GSS237       81622      47098204
GSS238       87209      35427185
GSS239       107556     82017418
GSS24        66036      41986592
GSS240       105281     69753292
GSS241       84164      34109038
GSS242       119873     73717511
GSS243       120121     73724456
GSS244       116004     75289726
GSS245       94897      51453576
GSS246       87227      55368798
GSS247       98868      65301246
GSS248       107907     77930899
GSS249       107229     78784169
GSS25        68326      28371748
GSS250       105856     80256189
GSS251       97340      72912906
GSS252       83375      54566636
GSS253       110409     67141694
GSS254       110221     65995908
GSS255       104912     56835702
GSS256       75986      43313827
GSS257       105919     50543484
GSS258       89671      52586585
GSS259       95509      69129819
GSS26        58187      25327102
GSS260       95160      67465315
GSS261       95939      36482695
GSS262       95351      37383494
GSS263       96738      35052080
GSS264       94457      38879468
GSS265       90312      60586202
GSS266       83858      28316006
GSS267       84378      27360618
GSS268       85108      25882102
GSS269       37444      15064493
GSS27        65186      31867853
GSS28        65623      32569699
GSS29        76978      39592401
GSS3         87416      41795456
GSS30        83004      39735582
GSS31        74195      40404585
GSS32        70533      48274699
GSS33        79789      37825108
GSS34        75880      40336511
GSS35        74074      40136782
GSS36        87317      55909484
GSS37        87597      58174401
GSS38        85507      44951957
GSS39        86905      50545192
GSS4         78838      41008614
GSS40        86244      40182942
GSS41        83171      31604371
GSS42        81244      56937434
GSS43        80222      58198920
GSS44        72028      47495428
GSS45        72032      47436827
GSS46        77569      45748576
GSS47        77822      38557783
GSS48        83155      57943287
GSS49        86566      64537297
GSS5         78747      40519938
GSS50        81483      54638073
GSS51        93926      59204766
GSS52        88459      58725253
GSS53        76854      42642208
GSS54        72569      40124952
GSS55        86674      47379595
GSS56        88001      58235688
GSS57        76649      64030439
GSS58        70896      78092113
GSS59        85581      69204591
GSS6         78141      38864047
GSS60        89668      60323227
GSS61        63456      44763902
GSS62        65927      45345697
GSS63        89628      67158924
GSS64        84980      58459898
GSS65        86095      53001093
GSS66        85507      55706638
GSS67        93310      57873632
GSS68        97860      52533914
GSS69        97540      52958293
GSS7         77748      39090714
GSS70        98226      52049730
GSS71        99179      50787162
GSS72        99191      50770367
GSS73        99078      50921246
GSS74        99710      50082506
GSS75        97774      52646958
GSS76        91883      64612747
GSS77        89867      70738253
GSS78        88915      70112792
GSS79        87858      69635763
GSS8         75695      38114064
GSS80        87871      64029983
GSS81        88379      44981344
GSS82        78286      23247997
GSS83        78138      23604013
GSS84        84277      48814777
GSS85        77142      45683240
GSS86        88991      56037733
GSS87        84344      58665838
GSS88        76383      76702714
GSS89        79404      73243217
GSS9         72089      37168596
GSS90        84394      46535974
GSS91        84876      49467337
GSS92        75557      41818758
GSS93        79425      56644570
GSS94        77050      56484467
GSS95        81817      53524115
GSS96        84340      58507277
GSS97        85451      57660923
GSS98        87354      52202985
GSS99        81480      66890360
HTC1         24998      26954222
HTC10        64843      83528569
HTC11        68088      59318953
HTC12        46922      51530190
HTC2         15992      36011948
HTC3         15970      36547861
HTC4         16191      35357336
HTC5         15927      40313070
HTC6         16010      37271080
HTC7         51147      28230036
HTC8         81402      60491874
HTC9         75984      71601272
HTG1         1318       188929277
HTG10        1300       186477873
HTG100       1125       190505385
HTG101       1172       191198179
HTG102       671        84065768
HTG11        1437       184181984
HTG12        883        191839640
HTG13        751        192405888
HTG14        743        192235638
HTG15        782        192340544
HTG16        803        192110055
HTG17        768        192308108
HTG18        2056       171274467
HTG19        1050       187938699
HTG2         2465       186071856
HTG20        994        189114630
HTG21        782        191981791
HTG22        924        190472464
HTG23        903        190655876
HTG24        807        191465187
HTG25        779        192005274
HTG26        859        191462215
HTG27        888        190846826
HTG28        948        189939151
HTG29        897        191105192
HTG3         2517       185290576
HTG30        927        190434883
HTG31        874        191415178
HTG32        968        189728660
HTG33        878        191333161
HTG34        858        191433492
HTG35        826        191923499
HTG36        934        190318494
HTG37        938        190676343
HTG38        937        190378460
HTG39        1035       189487656
HTG4         2553       188532563
HTG40        1187       187235126
HTG41        1250       188074685
HTG42        1188       188224976
HTG43        1161       187342303
HTG44        1104       191576242
HTG45        1278       190787148
HTG46        1178       191117438
HTG47        1135       191255628
HTG48        1041       191160481
HTG49        928        189480596
HTG5         1284       185715991
HTG50        1055       189820926
HTG51        900        189594186
HTG52        1045       189744306
HTG53        925        189640581
HTG54        1000       189364350
HTG55        913        189302152
HTG56        974        189092354
HTG57        1082       188691536
HTG58        978        189470011
HTG59        1120       185699611
HTG6         1274       185234665
HTG60        1072       189098117
HTG61        1001       189166058
HTG62        997        188852206
HTG63        980        189147736
HTG64        1118       188925999
HTG65        1127       187464157
HTG66        1288       184414120
HTG67        1229       185445143
HTG68        1237       184701586
HTG69        1250       184650415
HTG7         1277       185414872
HTG70        1224       186848678
HTG71        1411       186369416
HTG72        1239       189366860
HTG73        1115       191205222
HTG74        1205       191731325
HTG75        1136       190981298
HTG76        1139       191201972
HTG77        1196       191002883
HTG78        1144       191362999
HTG79        1217       190738899
HTG8         1459       184762119
HTG80        1140       191038055
HTG81        1140       191415068
HTG82        1305       188890437
HTG83        1230       190051286
HTG84        1186       191379917
HTG85        1196       190915183
HTG86        1197       190366986
HTG87        1333       189758990
HTG88        1294       189615206
HTG89        1304       189838039
HTG9         1200       186999351
HTG90        1233       190301927
HTG91        1266       189942304
HTG92        1064       188878981
HTG93        1345       188557939
HTG94        1326       188927165
HTG95        1039       193049880
HTG96        770        169606657
HTG97        1062       193702378
HTG98        1114       192493006
HTG99        1043       189058888
INV1         41846      124153577
INV10        68876      82301068
INV11        14221      59703479
INV2         1725       181286224
INV3         2294       142669799
INV4         71802      80062529
INV5         59862      89018105
INV6         39018      106605304
INV7         81000      72193336
INV8         63263      85589575
INV9         86429      63869537
MAM1         19702      156968509
MAM2         66694      75678820
MAM3         58583      110064934
MAM4         4307       4854190
PAT1         222610     70141260
PAT10        125437     99518322
PAT11        141739     62608396
PAT12        105795     59941764
PAT13        103555     50226564
PAT14        121472     53274905
PAT15        113046     61292248
PAT16        145018     54899867
PAT17        155517     69893240
PAT18        97490      122598017
PAT19        147594     87373130
PAT2         194518     84655123
PAT20        117407     104542066
PAT21        123717     103465007
PAT22        119286     106149134
PAT23        126113     100478737
PAT24        97376      79764286
PAT25        95150      85871048
PAT26        117877     63591510
PAT27        97947      79983103
PAT28        124026     66183403
PAT29        134260     114801558
PAT3         171984     95898893
PAT30        177445     92934820
PAT31        43225      10448522
PAT4         153750     106059356
PAT5         184018     85619906
PAT6         156356     93378118
PAT7         152402     81705440
PAT8         104672     119401279
PAT9         143543     89226955
PHG          3544       25916110
PLN1         50811      102921297
PLN10        17614      135204576
PLN11        18532      152146359
PLN12        18379      152515202
PLN13        19424      150684272
PLN14        1292       165360818
PLN15        1321       168425220
PLN16        56         169476527
PLN17        7          192317431
PLN18        45901      90700303
PLN19        77795      78069623
PLN2         1456       168798438
PLN20        77741      76048998
PLN21        31202      108931821
PLN22        28254      136541799
PLN23        78804      75382536
PLN24        99609      59756798
PLN25        78877      78088450
PLN26        35550      67250920
PLN3         1676       182965345
PLN4         10212      161076381
PLN5         74882      80980465
PLN6         73502      77941968
PLN7         47664      55452220
PLN8         35880      68594657
PLN9         16335      138371611
PRI1         29743      121692971
PRI10        1469       183014562
PRI11        1270       178782324
PRI12        1459       178406528
PRI13        1604       179913583
PRI14        1620       182096882
PRI15        1231       192530290
PRI16        1137       193941234
PRI17        1121       194281336
PRI18        7677       180450875
PRI19        46392      115681984
PRI2         1628       172387506
PRI20        61556      78551610
PRI21        22705      123030996
PRI22        2673       179680973
PRI23        2068       182470066
PRI24        1631       182747330
PRI25        2113       182227812
PRI26        3634       177144863
PRI27        10333      162647266
PRI28        22742      143480868
PRI29        51455      81097207
PRI3         1334       184541565
PRI30        33031      63405324
PRI31        11649      160355259
PRI32        59392      106734894
PRI33        56890      91556540
PRI34        36844      66315037
PRI4         1313       184897615
PRI5         1194       181562480
PRI6         1192       178920777
PRI7         1233       181330805
PRI8         1314       175397424
PRI9         1241       175363425
ROD1         10968      166610663
ROD10        975        182155621
ROD11        1030       186498281
ROD12        959        183569550
ROD13        1023       187471174
ROD14        955        181076200
ROD15        964        182175547
ROD16        1034       186206096
ROD17        21566      156866157
ROD18        15518      156608852
ROD19        1159       184134049
ROD2         924        174227554
ROD20        1166       184084569
ROD21        28005      139434098
ROD22        31479      67871380
ROD23        8440       160892586
ROD24        60368      127551053
ROD25        122222     41715282
ROD26        10696      12899956
ROD3         909        173967764
ROD4         904        174052603
ROD5         926        173983771
ROD6         984        181059271
ROD7         973        179871005
ROD8         987        181761239
ROD9         1010       182995158
STS1         84179      36140922
STS10        57832      44837061
STS11        57928      43636816
STS12        64507      43021997
STS13        86587      36288945
STS14        69810      30946645
STS2         84042      48183190
STS3         69749      27467856
STS4         78991      37516123
STS5         54786      32165500
STS6         54865      31902640
STS7         54669      32203563
STS8         55688      35654923
STS9         57896      44459889
SYN1         51570      69304136
SYN2         2858       6201555
UNA          211        114018
VRL1         72267      65796916
VRL2         70886      63958030
VRL3         71087      66178902
VRL4         69673      67533219
VRL5         57650      73256123
VRL6         62201      72707766
VRL7         69737      69693428
VRL8         23970      23436449
VRT1         19586      162340859
VRT10        9830       179654592
VRT11        9223       178247119
VRT12        5056       185440302
VRT13        68649      87716093
VRT14        58603      53480631
VRT2         53748      113912125
VRT3         20018      157047405
VRT4         65438      90493007
VRT5         53293      65913173
VRT6         20743      119939640
VRT7         1222       191632682
VRT8         1276       191203470
VRT9         8905       179136574

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 162.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:

Entries        Bases   Species

11160616 12761442950   Homo sapiens
7208491   8315316302   Mus musculus
1303312   5775613825   Rattus norvegicus
2863887   4010324625   Zea mays
2039264   3816951705   Bos taurus
1561283   2779172864   Danio rerio
2115431   2073935676   Sus scrofa
1183399   1522933162   Oryza sativa (japonica cultivar-group)
227838    1352480651   Strongylocentrotus purpuratus
1417896   1135837233   Xenopus tropicalis
212468     954048961   Pan troglodytes
736802     898809999   Drosophila melanogaster
1950853    880586059   Arabidopsis thaliana
802551     861683460   Gallus gallus
513445     829261560   Vitis vinifera
76143      753282513   Macaca mulatta
1221041    698061628   Canis lupus familiaris
1006311    657645257   Sorghum bicolor
1102789    655515953   Triticum aestivum
417424     526984387   Medicago truncatula

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 October 2007

                NCBI-GenBank Flat File Release 162.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 PROJECT Format

  This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
PROJECT     GenomeProject:18787

  A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second 
contains the actual project identifier ("18787").

  PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 162.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
	Andrea Gocke, Anjanette Johnston, Mark Landree,	Richard McVeigh,
	Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
	Gert Roosen, Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Ben Slade, Angela Tirone

User Support
	Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
	Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
	Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
	David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center