Release Notes For GenBank Release 163

GBREL.TXT          Genetic Sequence Data Bank
                         December 15 2007

               NCBI-GenBank Flat File Release 163.0

                    Distribution Release Notes

 80388382 loci, 83874179730 bases, from 80388382 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 163.0
1.2 Cutoff Date
1.3 Important Changes in Release 163.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 163.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 163.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:

	ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/  (Japan)
	ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/  (Korea)
	ftp://bio-mirror.sg.apan.net/biomirrors/genbank/     (Singapore)

1.2 Cutoff Date

  This full release, 163.0, incorporates data available to the collaborating
databases as of December 17, 2007 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 163.0

1.3.1 CON division changes and impact on FASTA file

  The changes to the processing of CON (CONstructed) division ASN.1 files
(gbcon*.aso) which occurred for GenBank Release 162.0 significantly 
impacted the size of the protein FASTA file which accompanies our releases
(for example: rel163.fsa_aa.gz) .

  The many proteins associated with CON records for the AACY WGS project
caused the size of the FASTA file to double, from 2GB to over 4GB .

  Some users have less interest in CON-division proteins, so an additional
file has been made available for their use:

         compressed        uncompressed  ratio uncompressed_name
          876480857          2158008959  59.4% no_CON.rel163.fsa_aa

  A longer term solution will involve the generation of separate protein
FASTA files for the various divisions of GenBank, similar to what is now
done for Quality Score files. That step will be taken for the February 2008
GenBank releaase. Support for the 'monolithic' protein FASTA files will
then be discontinued, but not before August 2008.

  For further details about the changes to CON-division processing, please
see Section 1.3 of these release notes:

	ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb161.release.notes
	ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb162.release.notes

1.3.2 Organizational changes

  The total number of sequence data files increased by 25 with this release:

  - the BCT division is now comprised of  26 files (+1)
  - the CON division is now comprised of  84 files (+1)
  - the EST division is now comprised of 675 files (+26)
  - the GSS division is now comprised of 295 files (+26)
  - the HTG division is now comprised of 105 files (+3)
  - the PAT division is now comprised of  34 files (+3)
  - the PLN division is now comprised of  27 files (+1)
  - the VRT division is now comprised of  15 files (+1)

  The total number of index files increased by 1 with this release:

  - the JOU (JOURNAL Citation) index is now comprised of 5 files (+1)

1.3.3 New /culture_collection and /bio_material qualifiers

  As of the December 2007 GenBank release, new qualifiers /culture_collection
and /bio_material qualifiers are legal for the source feature. Their
definitions are:

Qualifier       /culture_collection=
Definition      institution code and identifier for the culture from which the
                nucleic acid sequenced was obtained, with optional collection
                code.
Value format    "<institution-code>:[<collection-code>:]<culture_id>"
Example         /culture_collection="ATCC:26370"
Comment         the /culture_collection qualifier should be used to annotate
                live microbial and viral cultures, and cell lines that have been
                deposited in curated culture collections; microbial cultures in
                personal or laboratory collections should be annotated in strain
                qualifiers;
                annotation with a culture_collection qualifier implies that the
                sequence was obtained from a sample retrieved (by the submitter
                or a collaborator) from the indicated culture collection, or
                that the sequence was obtained from a sample that was deposited
                (by the submitter or a collaborator) in the indicated culture
                collection; annotation with more than one culture_collection
                qualifier indicates that the sequence was obtained from a sample
                that was deposited (by the submitter or a collaborator) in more
                than one culture collection.
                culture_id and institution_code are mandatory, collection_code
                is optional;
                the /culture_collection qualifier becomes legal on 15-Dec-2007;

Qualifier       /bio_material=
Definition      identifier for the biological material from which the nucleic
                acid sequenced was obtained, with optional institution code and
                collection code for the place where it is currently stored.
Value format    "[<institution-code>:[<collection-code>:]]<material_id>"
Example         /bio_material="CGC:CB3912"      <- Caenorhabditis stock centre
Comment         the bio_material qualifier should be used to annotate the
                identifiers of material in biological collections that are not
                appropriate to annotate as either /specimen_voucher or
                /culture_collection; these include zoos and aquaria, stock
                centres, seed banks, germplasm repositories and DNA banks;
                material_id is mandatory, institution_code and collection_code
                are optional; institution code is mandatory where collection
                code is present;
                the /bio_material qualifier becomes legal on 15-Dec-2007;

1.3.4 New tmRNA feature and /peptide_tag qualifier

  To support the annotation of a class of RNAs that have dual
tRNA-like and mRNA-like behaviors, a new tmRNA feature has been
added to the Feature Table as of December 2007. The "tmRNA Website"
at Indiana University provides some background information about
the unusual biology of tmRNAs :

	http://www.indiana.edu/~tmrna/ 

Here is the definition of the new tmRNA feature:

Feature Key           tmRNA
Definition            transfer messenger RNA; tmRNA acts as a tRNA first,
                      and then as an mRNA that encodes a peptide tag; the
                      ribosome translates this mRNA region of tmRNA and attaches
                      the encoded peptide tag to the C-terminus of the
                      unfinished protein; this attached tag targets the protein for
                      destruction or proteolysis;
Optional qualifiers   /allele="text"
                      /citation=[number]
                      /db_xref="<database>:<identifier>"
                      /experiment="text"
                      /function="text"
                      /gene="text"
                      /inference="TYPE[ (same species)][:EVIDENCE_BASIS]"
                      /label=feature_label
                      /locus_tag="text" (single token)
                      /map="text"
                      /note="text"
                      /old_locus_tag="text" (single token)
                      /product="text"
                      /pseudo
                      /standard_name="text"
                      /tag_peptide=<base_range>
Comment               the tmRNA feature key will become valid on 15-Dec-2007


To indicate the nucleotide region encoding the proteolysis tag
peptide, a new /tag_peptide qualifier has been introduced for
use with the tmRNA feature. The definition of /tag_peptide is:

Qualifier       /tag_peptide=
Definition      base location encoding the polypeptide for proteolysis tag of
                tmRNA and its termination codon;
Value format    <base_range>
Example         /tag_peptide=90..122
Comment         it is recommended that the amino acid sequence corresponding
                to the /tag_peptide be annotated by describing a 5' partial
                CDS feature; e.g. CDS    <90..122;
                the /tag_peptide qualifier (and tmRNA feature) will become
                valid on 15-Dec-2007


1.3.5 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.6 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
forty-eight of the GSS flatfiles in Release 163.0. Consider gbgss248.seq :


GBGSS1.SEQ           Genetic Sequence Data Bank
                          December 15 2007

                NCBI-GenBank Flat File Release 163.0

                           GSS Sequences (Part 1)

   86843 loci,    64232072 bases, from    86843 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "248" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 Divisional protein FASTA files

  As a convenience for users, separate protein FASTA files for the various
divisions of GenBank will be generated as of the February 2008 release.
These files will be placed in a new subdirectory ( aa_fasta/ ), and will
utilize this file-naming convention:

	gb*.aa_fsa.gz

  The current, single, protein FASTA file (relxxx.aa_fsa.gz) now exceeds 4GB
in size, and has become too unwieldy for users to process.

  This change is similar to what is now being done for Quality Score files
in the quality_scores/ subdirectory.

  Support for the single protein FASTA file will be discontinued, but not
before August of 2008. If that timetable poses problems, please let us know
at the NCBI Service Desk:

	info@ncbi.nlm.nih.gov

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1449 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut5.idx - Index of the entries according to author name, part 5.
48. gbaut6.idx - Index of the entries according to author name, part 6.
49. gbaut7.idx - Index of the entries according to author name, part 7.
50. gbaut8.idx - Index of the entries according to author name, part 8.
51. gbaut9.idx - Index of the entries according to author name, part 9.
52. gbbct1.seq - Bacterial sequence entries, part 1.
53. gbbct10.seq - Bacterial sequence entries, part 10.
54. gbbct11.seq - Bacterial sequence entries, part 11.
55. gbbct12.seq - Bacterial sequence entries, part 12.
56. gbbct13.seq - Bacterial sequence entries, part 13.
57. gbbct14.seq - Bacterial sequence entries, part 14.
58. gbbct15.seq - Bacterial sequence entries, part 15.
59. gbbct16.seq - Bacterial sequence entries, part 16.
60. gbbct17.seq - Bacterial sequence entries, part 17.
61. gbbct18.seq - Bacterial sequence entries, part 18.
62. gbbct19.seq - Bacterial sequence entries, part 19.
63. gbbct2.seq - Bacterial sequence entries, part 2.
64. gbbct20.seq - Bacterial sequence entries, part 20.
65. gbbct21.seq - Bacterial sequence entries, part 21.
66. gbbct22.seq - Bacterial sequence entries, part 22.
67. gbbct23.seq - Bacterial sequence entries, part 23.
68. gbbct24.seq - Bacterial sequence entries, part 24.
69. gbbct25.seq - Bacterial sequence entries, part 25.
70. gbbct26.seq - Bacterial sequence entries, part 26.
71. gbbct3.seq - Bacterial sequence entries, part 3.
72. gbbct4.seq - Bacterial sequence entries, part 4.
73. gbbct5.seq - Bacterial sequence entries, part 5.
74. gbbct6.seq - Bacterial sequence entries, part 6.
75. gbbct7.seq - Bacterial sequence entries, part 7.
76. gbbct8.seq - Bacterial sequence entries, part 8.
77. gbbct9.seq - Bacterial sequence entries, part 9.
78. gbchg.txt - Accession numbers of entries updated since the previous release.
79. gbcon1.seq - Constructed sequence entries, part 1.
80. gbcon10.seq - Constructed sequence entries, part 10.
81. gbcon11.seq - Constructed sequence entries, part 11.
82. gbcon12.seq - Constructed sequence entries, part 12.
83. gbcon13.seq - Constructed sequence entries, part 13.
84. gbcon14.seq - Constructed sequence entries, part 14.
85. gbcon15.seq - Constructed sequence entries, part 15.
86. gbcon16.seq - Constructed sequence entries, part 16.
87. gbcon17.seq - Constructed sequence entries, part 17.
88. gbcon18.seq - Constructed sequence entries, part 18.
89. gbcon19.seq - Constructed sequence entries, part 19.
90. gbcon2.seq - Constructed sequence entries, part 2.
91. gbcon20.seq - Constructed sequence entries, part 20.
92. gbcon21.seq - Constructed sequence entries, part 21.
93. gbcon22.seq - Constructed sequence entries, part 22.
94. gbcon23.seq - Constructed sequence entries, part 23.
95. gbcon24.seq - Constructed sequence entries, part 24.
96. gbcon25.seq - Constructed sequence entries, part 25.
97. gbcon26.seq - Constructed sequence entries, part 26.
98. gbcon27.seq - Constructed sequence entries, part 27.
99. gbcon28.seq - Constructed sequence entries, part 28.
100. gbcon29.seq - Constructed sequence entries, part 29.
101. gbcon3.seq - Constructed sequence entries, part 3.
102. gbcon30.seq - Constructed sequence entries, part 30.
103. gbcon31.seq - Constructed sequence entries, part 31.
104. gbcon32.seq - Constructed sequence entries, part 32.
105. gbcon33.seq - Constructed sequence entries, part 33.
106. gbcon34.seq - Constructed sequence entries, part 34.
107. gbcon35.seq - Constructed sequence entries, part 35.
108. gbcon36.seq - Constructed sequence entries, part 36.
109. gbcon37.seq - Constructed sequence entries, part 37.
110. gbcon38.seq - Constructed sequence entries, part 38.
111. gbcon39.seq - Constructed sequence entries, part 39.
112. gbcon4.seq - Constructed sequence entries, part 4.
113. gbcon40.seq - Constructed sequence entries, part 40.
114. gbcon41.seq - Constructed sequence entries, part 41.
115. gbcon42.seq - Constructed sequence entries, part 42.
116. gbcon43.seq - Constructed sequence entries, part 43.
117. gbcon44.seq - Constructed sequence entries, part 44.
118. gbcon45.seq - Constructed sequence entries, part 45.
119. gbcon46.seq - Constructed sequence entries, part 46.
120. gbcon47.seq - Constructed sequence entries, part 47.
121. gbcon48.seq - Constructed sequence entries, part 48.
122. gbcon49.seq - Constructed sequence entries, part 49.
123. gbcon5.seq - Constructed sequence entries, part 5.
124. gbcon50.seq - Constructed sequence entries, part 50.
125. gbcon51.seq - Constructed sequence entries, part 51.
126. gbcon52.seq - Constructed sequence entries, part 52.
127. gbcon53.seq - Constructed sequence entries, part 53.
128. gbcon54.seq - Constructed sequence entries, part 54.
129. gbcon55.seq - Constructed sequence entries, part 55.
130. gbcon56.seq - Constructed sequence entries, part 56.
131. gbcon57.seq - Constructed sequence entries, part 57.
132. gbcon58.seq - Constructed sequence entries, part 58.
133. gbcon59.seq - Constructed sequence entries, part 59.
134. gbcon6.seq - Constructed sequence entries, part 6.
135. gbcon60.seq - Constructed sequence entries, part 60.
136. gbcon61.seq - Constructed sequence entries, part 61.
137. gbcon62.seq - Constructed sequence entries, part 62.
138. gbcon63.seq - Constructed sequence entries, part 63.
139. gbcon64.seq - Constructed sequence entries, part 64.
140. gbcon65.seq - Constructed sequence entries, part 65.
141. gbcon66.seq - Constructed sequence entries, part 66.
142. gbcon67.seq - Constructed sequence entries, part 67.
143. gbcon68.seq - Constructed sequence entries, part 68.
144. gbcon69.seq - Constructed sequence entries, part 69.
145. gbcon7.seq - Constructed sequence entries, part 7.
146. gbcon70.seq - Constructed sequence entries, part 70.
147. gbcon71.seq - Constructed sequence entries, part 71.
148. gbcon72.seq - Constructed sequence entries, part 72.
149. gbcon73.seq - Constructed sequence entries, part 73.
150. gbcon74.seq - Constructed sequence entries, part 74.
151. gbcon75.seq - Constructed sequence entries, part 75.
152. gbcon76.seq - Constructed sequence entries, part 76.
153. gbcon77.seq - Constructed sequence entries, part 77.
154. gbcon78.seq - Constructed sequence entries, part 78.
155. gbcon79.seq - Constructed sequence entries, part 79.
156. gbcon8.seq - Constructed sequence entries, part 8.
157. gbcon80.seq - Constructed sequence entries, part 80.
158. gbcon81.seq - Constructed sequence entries, part 81.
159. gbcon82.seq - Constructed sequence entries, part 82.
160. gbcon83.seq - Constructed sequence entries, part 83.
161. gbcon84.seq - Constructed sequence entries, part 84.
162. gbcon9.seq - Constructed sequence entries, part 9.
163. gbdel.txt - Accession numbers of entries deleted since the previous release.
164. gbenv1.seq - Environmental sampling sequence entries, part 1.
165. gbenv2.seq - Environmental sampling sequence entries, part 2.
166. gbenv3.seq - Environmental sampling sequence entries, part 3.
167. gbenv4.seq - Environmental sampling sequence entries, part 4.
168. gbenv5.seq - Environmental sampling sequence entries, part 5.
169. gbenv6.seq - Environmental sampling sequence entries, part 6.
170. gbenv7.seq - Environmental sampling sequence entries, part 7.
171. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
172. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
173. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
174. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
175. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
176. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
177. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
178. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
179. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
180. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
181. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
182. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
183. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
184. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
185. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
186. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
187. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
188. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
189. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
190. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
191. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
192. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
193. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
194. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
195. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
196. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
197. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
198. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
199. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
200. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
201. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
202. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
203. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
204. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
205. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
206. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
207. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
208. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
209. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
210. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
211. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
212. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
213. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
214. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
215. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
216. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
217. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
218. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
219. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
220. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
221. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
222. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
223. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
224. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
225. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
226. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
227. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
228. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
229. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
230. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
231. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
232. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
233. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
234. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
235. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
236. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
237. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
238. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
239. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
240. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
241. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
242. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
243. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
244. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
245. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
246. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
247. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
248. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
249. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
250. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
251. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
252. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
253. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
254. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
255. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
256. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
257. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
258. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
259. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
260. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
261. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
262. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
263. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
264. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
265. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
266. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
267. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
268. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
269. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
270. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
271. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
272. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
273. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
274. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
275. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
276. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
277. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
278. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
279. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
280. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
281. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
282. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
283. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
284. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
285. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
286. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
287. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
288. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
289. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
290. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
291. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
292. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
293. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
294. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
295. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
296. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
297. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
298. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
299. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
300. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
301. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
302. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
303. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
304. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
305. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
306. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
307. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
308. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
309. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
310. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
311. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
312. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
313. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
314. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
315. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
316. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
317. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
318. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
319. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
320. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
321. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
322. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
323. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
324. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
325. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
326. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
327. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
328. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
329. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
330. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
331. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
332. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
333. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
334. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
335. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
336. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
337. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
338. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
339. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
340. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
341. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
342. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
343. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
344. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
345. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
346. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
347. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
348. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
349. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
350. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
351. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
352. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
353. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
354. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
355. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
356. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
357. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
358. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
359. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
360. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
361. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
362. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
363. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
364. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
365. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
366. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
367. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
368. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
369. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
370. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
371. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
372. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
373. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
374. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
375. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
376. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
377. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
378. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
379. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
380. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
381. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
382. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
383. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
384. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
385. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
386. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
387. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
388. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
389. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
390. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
391. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
392. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
393. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
394. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
395. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
396. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
397. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
398. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
399. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
400. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
401. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
402. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
403. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
404. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
405. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
406. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
407. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
408. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
409. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
410. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
411. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
412. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
413. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
414. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
415. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
416. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
417. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
418. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
419. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
420. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
421. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
422. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
423. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
424. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
425. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
426. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
427. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
428. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
429. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
430. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
431. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
432. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
433. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
434. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
435. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
436. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
437. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
438. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
439. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
440. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
441. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
442. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
443. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
444. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
445. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
446. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
447. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
448. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
449. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
450. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
451. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
452. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
453. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
454. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
455. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
456. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
457. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
458. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
459. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
460. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
461. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
462. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
463. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
464. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
465. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
466. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
467. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
468. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
469. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
470. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
471. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
472. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
473. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
474. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
475. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
476. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
477. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
478. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
479. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
480. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
481. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
482. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
483. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
484. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
485. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
486. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
487. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
488. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
489. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
490. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
491. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
492. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
493. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
494. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
495. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
496. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
497. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
498. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
499. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
500. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
501. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
502. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
503. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
504. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
505. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
506. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
507. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
508. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
509. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
510. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
511. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
512. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
513. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
514. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
515. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
516. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
517. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
518. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
519. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
520. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
521. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
522. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
523. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
524. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
525. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
526. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
527. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
528. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
529. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
530. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
531. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
532. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
533. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
534. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
535. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
536. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
537. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
538. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
539. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
540. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
541. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
542. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
543. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
544. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
545. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
546. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
547. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
548. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
549. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
550. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
551. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
552. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
553. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
554. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
555. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
556. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
557. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
558. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
559. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
560. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
561. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
562. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
563. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
564. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
565. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
566. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
567. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
568. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
569. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
570. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
571. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
572. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
573. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
574. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
575. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
576. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
577. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
578. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
579. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
580. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
581. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
582. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
583. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
584. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
585. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
586. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
587. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
588. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
589. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
590. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
591. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
592. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
593. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
594. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
595. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
596. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
597. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
598. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
599. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
600. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
601. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
602. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
603. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
604. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
605. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
606. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
607. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
608. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
609. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
610. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
611. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
612. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
613. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
614. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
615. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
616. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
617. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
618. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
619. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
620. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
621. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
622. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
623. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
624. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
625. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
626. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
627. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
628. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
629. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
630. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
631. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
632. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
633. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
634. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
635. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
636. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
637. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
638. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
639. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
640. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
641. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
642. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
643. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
644. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
645. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
646. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
647. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
648. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
649. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
650. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
651. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
652. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
653. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
654. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
655. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
656. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
657. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
658. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
659. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
660. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
661. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
662. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
663. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
664. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
665. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
666. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
667. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
668. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
669. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
670. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
671. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
672. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
673. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
674. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
675. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
676. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
677. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
678. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
679. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
680. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
681. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
682. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
683. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
684. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
685. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
686. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
687. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
688. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
689. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
690. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
691. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
692. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
693. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
694. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
695. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
696. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
697. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
698. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
699. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
700. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
701. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
702. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
703. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
704. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
705. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
706. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
707. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
708. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
709. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
710. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
711. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
712. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
713. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
714. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
715. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
716. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
717. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
718. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
719. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
720. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
721. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
722. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
723. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
724. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
725. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
726. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
727. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
728. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
729. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
730. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
731. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
732. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
733. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
734. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
735. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
736. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
737. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
738. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
739. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
740. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
741. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
742. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
743. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
744. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
745. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
746. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
747. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
748. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
749. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
750. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
751. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
752. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
753. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
754. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
755. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
756. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
757. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
758. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
759. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
760. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
761. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
762. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
763. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
764. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
765. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
766. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
767. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
768. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
769. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
770. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
771. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
772. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
773. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
774. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
775. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
776. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
777. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
778. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
779. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
780. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
781. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
782. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
783. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
784. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
785. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
786. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
787. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
788. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
789. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
790. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
791. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
792. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
793. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
794. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
795. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
796. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
797. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
798. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
799. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
800. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
801. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
802. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
803. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
804. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
805. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
806. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
807. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
808. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
809. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
810. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
811. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
812. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
813. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
814. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
815. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
816. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
817. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
818. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
819. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
820. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
821. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
822. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
823. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
824. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
825. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
826. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
827. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
828. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
829. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
830. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
831. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
832. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
833. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
834. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
835. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
836. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
837. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
838. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
839. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
840. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
841. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
842. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
843. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
844. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
845. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
846. gbgen.idx - Index of the entries according to gene symbols.
847. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
848. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
849. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
850. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
851. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
852. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
853. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
854. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
855. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
856. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
857. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
858. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
859. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
860. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
861. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
862. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
863. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
864. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
865. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
866. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
867. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
868. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
869. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
870. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
871. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
872. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
873. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
874. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
875. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
876. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
877. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
878. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
879. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
880. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
881. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
882. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
883. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
884. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
885. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
886. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
887. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
888. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
889. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
890. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
891. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
892. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
893. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
894. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
895. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
896. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
897. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
898. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
899. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
900. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
901. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
902. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
903. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
904. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
905. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
906. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
907. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
908. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
909. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
910. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
911. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
912. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
913. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
914. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
915. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
916. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
917. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
918. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
919. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
920. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
921. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
922. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
923. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
924. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
925. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
926. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
927. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
928. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
929. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
930. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
931. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
932. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
933. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
934. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
935. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
936. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
937. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
938. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
939. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
940. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
941. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
942. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
943. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
944. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
945. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
946. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
947. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
948. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
949. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
950. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
951. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
952. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
953. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
954. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
955. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
956. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
957. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
958. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
959. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
960. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
961. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
962. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
963. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
964. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
965. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
966. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
967. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
968. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
969. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
970. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
971. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
972. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
973. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
974. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
975. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
976. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
977. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
978. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
979. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
980. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
981. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
982. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
983. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
984. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
985. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
986. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
987. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
988. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
989. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
990. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
991. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
992. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
993. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
994. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
995. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
996. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
997. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
998. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
999. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1000. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1001. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1002. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1003. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1004. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1005. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1006. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1007. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1008. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1009. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1010. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1011. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1012. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1013. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1014. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1015. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1016. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1017. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1018. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1019. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1020. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1021. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1022. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1023. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1024. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1025. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1026. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1027. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1028. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1029. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1030. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1031. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1032. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1033. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1034. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1035. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1036. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1037. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1038. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1039. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1040. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1041. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1042. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1043. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1044. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1045. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1046. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1047. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1048. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1049. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1050. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1051. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1052. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1053. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1054. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1055. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1056. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1057. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1058. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1059. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1060. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1061. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1062. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1063. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1064. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1065. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1066. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1067. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1068. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1069. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1070. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1071. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1072. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1073. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1074. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1075. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1076. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1077. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1078. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1079. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1080. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1081. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1082. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1083. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1084. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1085. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1086. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1087. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1088. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1089. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1090. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1091. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1092. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1093. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1094. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1095. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1096. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1097. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1098. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1099. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1100. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1101. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1102. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1103. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1104. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1105. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1106. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1107. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1108. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1109. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1110. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1111. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1112. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1113. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1114. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1115. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1116. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1117. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1118. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1119. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1120. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1121. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1122. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1123. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1124. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1125. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1126. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1127. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1128. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1129. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1130. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1131. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1132. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1133. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1134. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1135. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1136. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1137. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1138. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1139. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1140. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1141. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1142. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1143. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1144. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1145. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1146. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1147. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1148. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1149. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1150. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1151. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1152. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1153. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1154. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1155. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1156. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1157. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1158. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1159. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1160. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1161. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1162. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1163. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1164. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1165. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1166. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1167. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1168. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1169. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1170. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1171. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1172. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1173. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1174. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1175. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1176. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1177. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1178. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1179. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1180. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1181. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1182. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1183. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1184. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1185. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1186. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1187. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1188. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1189. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1190. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1191. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1192. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1193. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1194. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1195. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1196. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1197. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1198. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1199. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1200. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1201. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1202. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1203. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1204. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1205. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1206. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1207. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1208. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1209. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1210. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1211. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1212. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1213. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1214. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1215. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1216. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1217. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1218. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1219. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1220. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1221. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1222. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1223. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1224. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1225. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1226. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1227. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1228. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1229. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1230. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1231. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1232. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1233. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1234. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1235. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1236. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1237. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1238. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1239. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1240. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1241. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1242. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1243. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1244. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1245. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1246. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1247. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1248. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1249. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1250. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1251. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1252. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1253. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1254. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1255. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1256. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1257. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1258. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1259. gbinv1.seq - Invertebrate sequence entries, part 1.
1260. gbinv10.seq - Invertebrate sequence entries, part 10.
1261. gbinv11.seq - Invertebrate sequence entries, part 11.
1262. gbinv2.seq - Invertebrate sequence entries, part 2.
1263. gbinv3.seq - Invertebrate sequence entries, part 3.
1264. gbinv4.seq - Invertebrate sequence entries, part 4.
1265. gbinv5.seq - Invertebrate sequence entries, part 5.
1266. gbinv6.seq - Invertebrate sequence entries, part 6.
1267. gbinv7.seq - Invertebrate sequence entries, part 7.
1268. gbinv8.seq - Invertebrate sequence entries, part 8.
1269. gbinv9.seq - Invertebrate sequence entries, part 9.
1270. gbjou1.idx - Index of the entries according to journal citation, part 1.
1271. gbjou2.idx - Index of the entries according to journal citation, part 2.
1272. gbjou3.idx - Index of the entries according to journal citation, part 3.
1273. gbjou4.idx - Index of the entries according to journal citation, part 4.
1274. gbjou5.idx - Index of the entries according to journal citation, part 5.
1275. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1276. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1277. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1278. gbmam1.seq - Other mammalian sequence entries, part 1.
1279. gbmam2.seq - Other mammalian sequence entries, part 2.
1280. gbmam3.seq - Other mammalian sequence entries, part 3.
1281. gbmam4.seq - Other mammalian sequence entries, part 4.
1282. gbnew.txt - Accession numbers of entries new since the previous release.
1283. gbpat1.seq - Patent sequence entries, part 1.
1284. gbpat10.seq - Patent sequence entries, part 10.
1285. gbpat11.seq - Patent sequence entries, part 11.
1286. gbpat12.seq - Patent sequence entries, part 12.
1287. gbpat13.seq - Patent sequence entries, part 13.
1288. gbpat14.seq - Patent sequence entries, part 14.
1289. gbpat15.seq - Patent sequence entries, part 15.
1290. gbpat16.seq - Patent sequence entries, part 16.
1291. gbpat17.seq - Patent sequence entries, part 17.
1292. gbpat18.seq - Patent sequence entries, part 18.
1293. gbpat19.seq - Patent sequence entries, part 19.
1294. gbpat2.seq - Patent sequence entries, part 2.
1295. gbpat20.seq - Patent sequence entries, part 20.
1296. gbpat21.seq - Patent sequence entries, part 21.
1297. gbpat22.seq - Patent sequence entries, part 22.
1298. gbpat23.seq - Patent sequence entries, part 23.
1299. gbpat24.seq - Patent sequence entries, part 24.
1300. gbpat25.seq - Patent sequence entries, part 25.
1301. gbpat26.seq - Patent sequence entries, part 26.
1302. gbpat27.seq - Patent sequence entries, part 27.
1303. gbpat28.seq - Patent sequence entries, part 28.
1304. gbpat29.seq - Patent sequence entries, part 29.
1305. gbpat3.seq - Patent sequence entries, part 3.
1306. gbpat30.seq - Patent sequence entries, part 30.
1307. gbpat31.seq - Patent sequence entries, part 31.
1308. gbpat32.seq - Patent sequence entries, part 32.
1309. gbpat33.seq - Patent sequence entries, part 33.
1310. gbpat34.seq - Patent sequence entries, part 34.
1311. gbpat4.seq - Patent sequence entries, part 4.
1312. gbpat5.seq - Patent sequence entries, part 5.
1313. gbpat6.seq - Patent sequence entries, part 6.
1314. gbpat7.seq - Patent sequence entries, part 7.
1315. gbpat8.seq - Patent sequence entries, part 8.
1316. gbpat9.seq - Patent sequence entries, part 9.
1317. gbphg.seq - Phage sequence entries.
1318. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1319. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1320. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1321. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1322. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1323. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1324. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1325. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1326. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1327. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1328. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1329. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1330. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1331. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1332. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1333. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1334. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1335. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1336. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1337. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1338. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1339. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1340. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1341. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1342. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1343. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1344. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1345. gbpri1.seq - Primate sequence entries, part 1.
1346. gbpri10.seq - Primate sequence entries, part 10.
1347. gbpri11.seq - Primate sequence entries, part 11.
1348. gbpri12.seq - Primate sequence entries, part 12.
1349. gbpri13.seq - Primate sequence entries, part 13.
1350. gbpri14.seq - Primate sequence entries, part 14.
1351. gbpri15.seq - Primate sequence entries, part 15.
1352. gbpri16.seq - Primate sequence entries, part 16.
1353. gbpri17.seq - Primate sequence entries, part 17.
1354. gbpri18.seq - Primate sequence entries, part 18.
1355. gbpri19.seq - Primate sequence entries, part 19.
1356. gbpri2.seq - Primate sequence entries, part 2.
1357. gbpri20.seq - Primate sequence entries, part 20.
1358. gbpri21.seq - Primate sequence entries, part 21.
1359. gbpri22.seq - Primate sequence entries, part 22.
1360. gbpri23.seq - Primate sequence entries, part 23.
1361. gbpri24.seq - Primate sequence entries, part 24.
1362. gbpri25.seq - Primate sequence entries, part 25.
1363. gbpri26.seq - Primate sequence entries, part 26.
1364. gbpri27.seq - Primate sequence entries, part 27.
1365. gbpri28.seq - Primate sequence entries, part 28.
1366. gbpri29.seq - Primate sequence entries, part 29.
1367. gbpri3.seq - Primate sequence entries, part 3.
1368. gbpri30.seq - Primate sequence entries, part 30.
1369. gbpri31.seq - Primate sequence entries, part 31.
1370. gbpri32.seq - Primate sequence entries, part 32.
1371. gbpri33.seq - Primate sequence entries, part 33.
1372. gbpri34.seq - Primate sequence entries, part 34.
1373. gbpri4.seq - Primate sequence entries, part 4.
1374. gbpri5.seq - Primate sequence entries, part 5.
1375. gbpri6.seq - Primate sequence entries, part 6.
1376. gbpri7.seq - Primate sequence entries, part 7.
1377. gbpri8.seq - Primate sequence entries, part 8.
1378. gbpri9.seq - Primate sequence entries, part 9.
1379. gbrel.txt - Release notes (this document).
1380. gbrod1.seq - Rodent sequence entries, part 1.
1381. gbrod10.seq - Rodent sequence entries, part 10.
1382. gbrod11.seq - Rodent sequence entries, part 11.
1383. gbrod12.seq - Rodent sequence entries, part 12.
1384. gbrod13.seq - Rodent sequence entries, part 13.
1385. gbrod14.seq - Rodent sequence entries, part 14.
1386. gbrod15.seq - Rodent sequence entries, part 15.
1387. gbrod16.seq - Rodent sequence entries, part 16.
1388. gbrod17.seq - Rodent sequence entries, part 17.
1389. gbrod18.seq - Rodent sequence entries, part 18.
1390. gbrod19.seq - Rodent sequence entries, part 19.
1391. gbrod2.seq - Rodent sequence entries, part 2.
1392. gbrod20.seq - Rodent sequence entries, part 20.
1393. gbrod21.seq - Rodent sequence entries, part 21.
1394. gbrod22.seq - Rodent sequence entries, part 22.
1395. gbrod23.seq - Rodent sequence entries, part 23.
1396. gbrod24.seq - Rodent sequence entries, part 24.
1397. gbrod25.seq - Rodent sequence entries, part 25.
1398. gbrod26.seq - Rodent sequence entries, part 26.
1399. gbrod3.seq - Rodent sequence entries, part 3.
1400. gbrod4.seq - Rodent sequence entries, part 4.
1401. gbrod5.seq - Rodent sequence entries, part 5.
1402. gbrod6.seq - Rodent sequence entries, part 6.
1403. gbrod7.seq - Rodent sequence entries, part 7.
1404. gbrod8.seq - Rodent sequence entries, part 8.
1405. gbrod9.seq - Rodent sequence entries, part 9.
1406. gbsdr1.txt - Short directory of the data bank, part 1.
1407. gbsdr2.txt - Short directory of the data bank, part 2.
1408. gbsdr3.txt - Short directory of the data bank, part 3.
1409. gbsec.idx - Index of the entries according to secondary accession number.
1410. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1411. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1412. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1413. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1414. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1415. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1416. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1417. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1418. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1419. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1420. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1421. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1422. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1423. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1424. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1425. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1426. gbuna.seq - Unannotated sequence entries.
1427. gbvrl1.seq - Viral sequence entries, part 1.
1428. gbvrl2.seq - Viral sequence entries, part 2.
1429. gbvrl3.seq - Viral sequence entries, part 3.
1430. gbvrl4.seq - Viral sequence entries, part 4.
1431. gbvrl5.seq - Viral sequence entries, part 5.
1432. gbvrl6.seq - Viral sequence entries, part 6.
1433. gbvrl7.seq - Viral sequence entries, part 7.
1434. gbvrl8.seq - Viral sequence entries, part 8.
1435. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1436. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1437. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1438. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1439. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1440. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1441. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1442. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1443. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1444. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1445. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1446. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1447. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1448. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1449. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 163.0 flatfiles require roughly 314 GB (sequence
files only) or 335 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 637205221     gbacc1.idx
1585355418     gbacc2.idx
 562397622     gbacc3.idx
 185011463     gbaut1.idx
 222720442     gbaut10.idx
 217800884     gbaut11.idx
 217691553     gbaut12.idx
 217374724     gbaut13.idx
 224888958     gbaut14.idx
 239984287     gbaut15.idx
 223329638     gbaut16.idx
 230505475     gbaut17.idx
 218501762     gbaut18.idx
 216049623     gbaut19.idx
 253891974     gbaut2.idx
 215056149     gbaut20.idx
 216138612     gbaut21.idx
 218997339     gbaut22.idx
 222766299     gbaut23.idx
 183382699     gbaut24.idx
 184047823     gbaut25.idx
 184565825     gbaut26.idx
 184127702     gbaut27.idx
 185687350     gbaut28.idx
 188015837     gbaut29.idx
 207119303     gbaut3.idx
 183860588     gbaut30.idx
 184192748     gbaut31.idx
 184432341     gbaut32.idx
 184096696     gbaut33.idx
 183782527     gbaut34.idx
 183510010     gbaut35.idx
 183369486     gbaut36.idx
 183691681     gbaut37.idx
 183320219     gbaut38.idx
 183426400     gbaut39.idx
 246338956     gbaut4.idx
 184755310     gbaut40.idx
 183276533     gbaut41.idx
 194086532     gbaut42.idx
 190617023     gbaut43.idx
 183442211     gbaut44.idx
 184239477     gbaut45.idx
 185060035     gbaut46.idx
 183578910     gbaut47.idx
  11892371     gbaut48.idx
 184486048     gbaut5.idx
 227665507     gbaut6.idx
 215611192     gbaut7.idx
 221952243     gbaut8.idx
 219242825     gbaut9.idx
 250481621     gbbct1.seq
 251737887     gbbct10.seq
 254082970     gbbct11.seq
 251890180     gbbct12.seq
 251780454     gbbct13.seq
 252235852     gbbct14.seq
 257623798     gbbct15.seq
 253126448     gbbct16.seq
 253516184     gbbct17.seq
 255437350     gbbct18.seq
 254820810     gbbct19.seq
 255999842     gbbct2.seq
 257217508     gbbct20.seq
 267175021     gbbct21.seq
 252636436     gbbct22.seq
 250000320     gbbct23.seq
 250002390     gbbct24.seq
 250008705     gbbct25.seq
  47600264     gbbct26.seq
 251607956     gbbct3.seq
 250000786     gbbct4.seq
 256119921     gbbct5.seq
 257889319     gbbct6.seq
 252683022     gbbct7.seq
 250000706     gbbct8.seq
 252617921     gbbct9.seq
  10322781     gbchg.txt
 250095967     gbcon1.seq
 250002136     gbcon10.seq
 250000682     gbcon11.seq
 250001715     gbcon12.seq
 250001501     gbcon13.seq
 250001298     gbcon14.seq
 250009365     gbcon15.seq
 250002598     gbcon16.seq
 250002307     gbcon17.seq
 250037752     gbcon18.seq
 250005780     gbcon19.seq
 251081426     gbcon2.seq
 250002936     gbcon20.seq
 250000132     gbcon21.seq
 250001451     gbcon22.seq
 250001075     gbcon23.seq
 250004274     gbcon24.seq
 250005690     gbcon25.seq
 250001137     gbcon26.seq
 250004667     gbcon27.seq
 250003863     gbcon28.seq
 250004340     gbcon29.seq
 250434441     gbcon3.seq
 250006948     gbcon30.seq
 250000279     gbcon31.seq
 250000515     gbcon32.seq
 250002224     gbcon33.seq
 250003898     gbcon34.seq
 250002538     gbcon35.seq
 250001911     gbcon36.seq
 250000798     gbcon37.seq
 250000126     gbcon38.seq
 250004268     gbcon39.seq
 250000250     gbcon4.seq
 250004267     gbcon40.seq
 250000474     gbcon41.seq
 250002856     gbcon42.seq
 250001056     gbcon43.seq
 250004159     gbcon44.seq
 250000800     gbcon45.seq
 250004195     gbcon46.seq
 250003695     gbcon47.seq
 250002023     gbcon48.seq
 250002963     gbcon49.seq
 250000045     gbcon5.seq
 250004905     gbcon50.seq
 250000067     gbcon51.seq
 250004232     gbcon52.seq
 250001937     gbcon53.seq
 250004818     gbcon54.seq
 250002015     gbcon55.seq
 250005631     gbcon56.seq
 250000681     gbcon57.seq
 250004440     gbcon58.seq
 250002246     gbcon59.seq
 250000777     gbcon6.seq
 250003309     gbcon60.seq
 250004097     gbcon61.seq
 250004123     gbcon62.seq
 250000326     gbcon63.seq
 250002339     gbcon64.seq
 250002520     gbcon65.seq
 250001696     gbcon66.seq
 250004425     gbcon67.seq
 250004014     gbcon68.seq
 250005222     gbcon69.seq
 250000437     gbcon7.seq
 250000584     gbcon70.seq
 250006015     gbcon71.seq
 250001180     gbcon72.seq
 250000178     gbcon73.seq
 250002415     gbcon74.seq
 250010443     gbcon75.seq
 250003313     gbcon76.seq
 250001518     gbcon77.seq
 250000927     gbcon78.seq
 250003703     gbcon79.seq
 250002259     gbcon8.seq
 250003717     gbcon80.seq
 250008035     gbcon81.seq
 250006648     gbcon82.seq
 224857151     gbcon83.seq
  21177666     gbcon84.seq
 250085224     gbcon9.seq
    972691     gbdel.txt
 250001370     gbenv1.seq
 250002983     gbenv2.seq
 250001173     gbenv3.seq
 250001742     gbenv4.seq
 250001275     gbenv5.seq
 250000794     gbenv6.seq
 213177748     gbenv7.seq
 230688948     gbest1.seq
 230690195     gbest10.seq
 230689053     gbest100.seq
 230691173     gbest101.seq
 230690611     gbest102.seq
 230687634     gbest103.seq
 230688542     gbest104.seq
 230690182     gbest105.seq
 230690289     gbest106.seq
 230688552     gbest107.seq
 230690796     gbest108.seq
 230689132     gbest109.seq
 230688446     gbest11.seq
 230689057     gbest110.seq
 230689532     gbest111.seq
 230690015     gbest112.seq
 230690090     gbest113.seq
 230688728     gbest114.seq
 230689539     gbest115.seq
 230689537     gbest116.seq
 230689501     gbest117.seq
 230689230     gbest118.seq
 230689171     gbest119.seq
 230689589     gbest12.seq
 230691063     gbest120.seq
 230689917     gbest121.seq
 230689025     gbest122.seq
 230687945     gbest123.seq
 230689731     gbest124.seq
 230688799     gbest125.seq
 230689654     gbest126.seq
 230688631     gbest127.seq
 230689623     gbest128.seq
 230689413     gbest129.seq
 230687660     gbest13.seq
 230689788     gbest130.seq
 230689117     gbest131.seq
 230689733     gbest132.seq
 230689244     gbest133.seq
 230687475     gbest134.seq
 230688680     gbest135.seq
 230690411     gbest136.seq
 230688808     gbest137.seq
 230689450     gbest138.seq
 230690778     gbest139.seq
 230689926     gbest14.seq
 230690154     gbest140.seq
 230690506     gbest141.seq
 230689126     gbest142.seq
 230689233     gbest143.seq
 230689988     gbest144.seq
 230688503     gbest145.seq
 230689395     gbest146.seq
 230687750     gbest147.seq
 230688091     gbest148.seq
 230688383     gbest149.seq
 230689134     gbest15.seq
 230689845     gbest150.seq
 230688438     gbest151.seq
 230687498     gbest152.seq
 230688962     gbest153.seq
 230687949     gbest154.seq
 230688938     gbest155.seq
 230688851     gbest156.seq
 230688591     gbest157.seq
 230691368     gbest158.seq
 230690067     gbest159.seq
 230688076     gbest16.seq
 230691044     gbest160.seq
 230690733     gbest161.seq
 230688726     gbest162.seq
 230688452     gbest163.seq
 230696473     gbest164.seq
 230687704     gbest165.seq
 230690780     gbest166.seq
 230688300     gbest167.seq
 230688131     gbest168.seq
 230688765     gbest169.seq
 230688189     gbest17.seq
 230688382     gbest170.seq
 230691246     gbest171.seq
 230689146     gbest172.seq
 230690940     gbest173.seq
 230688373     gbest174.seq
 230688798     gbest175.seq
 230689058     gbest176.seq
 230688063     gbest177.seq
 230688253     gbest178.seq
 230688006     gbest179.seq
 230689836     gbest18.seq
 221974965     gbest180.seq
 230688882     gbest181.seq
 230688464     gbest182.seq
 230687900     gbest183.seq
 230688295     gbest184.seq
 230688926     gbest185.seq
 230689822     gbest186.seq
 230687770     gbest187.seq
 230690207     gbest188.seq
 230689834     gbest189.seq
 230688463     gbest19.seq
 230689523     gbest190.seq
 230688367     gbest191.seq
 230690118     gbest192.seq
 230690523     gbest193.seq
 230690123     gbest194.seq
 230688572     gbest195.seq
 230690500     gbest196.seq
 230688733     gbest197.seq
 230688827     gbest198.seq
 230688297     gbest199.seq
 230690014     gbest2.seq
 230687940     gbest20.seq
 230687739     gbest200.seq
 230689611     gbest201.seq
 230687579     gbest202.seq
 230690206     gbest203.seq
 230689163     gbest204.seq
 230688145     gbest205.seq
 230690131     gbest206.seq
 230688536     gbest207.seq
 230688712     gbest208.seq
 230688966     gbest209.seq
 230691980     gbest21.seq
 230689705     gbest210.seq
 230688200     gbest211.seq
 230690470     gbest212.seq
 230688869     gbest213.seq
 230688158     gbest214.seq
 230689230     gbest215.seq
 230687467     gbest216.seq
 230688026     gbest217.seq
 230689043     gbest218.seq
 230687489     gbest219.seq
 230687936     gbest22.seq
 230688798     gbest220.seq
 230689836     gbest221.seq
 230690941     gbest222.seq
 230691002     gbest223.seq
 230687697     gbest224.seq
 230688911     gbest225.seq
 230690575     gbest226.seq
 230688666     gbest227.seq
 230689041     gbest228.seq
 230689723     gbest229.seq
 230689144     gbest23.seq
 230690562     gbest230.seq
 163269669     gbest231.seq
 162068563     gbest232.seq
 168085545     gbest233.seq
 167786799     gbest234.seq
 169548955     gbest235.seq
 164886288     gbest236.seq
 164935216     gbest237.seq
 164502352     gbest238.seq
 164364716     gbest239.seq
 230687921     gbest24.seq
 164397618     gbest240.seq
 164607551     gbest241.seq
 163494913     gbest242.seq
 166112315     gbest243.seq
 165194161     gbest244.seq
 162031678     gbest245.seq
 164319595     gbest246.seq
 169151067     gbest247.seq
 166862238     gbest248.seq
 165634294     gbest249.seq
 230691076     gbest25.seq
 165769548     gbest250.seq
 165371669     gbest251.seq
 164833230     gbest252.seq
 164219911     gbest253.seq
 164361622     gbest254.seq
 165525782     gbest255.seq
 170817852     gbest256.seq
 178034253     gbest257.seq
 171500018     gbest258.seq
 229410561     gbest259.seq
 230689141     gbest26.seq
 230692604     gbest260.seq
 230688317     gbest261.seq
 230689583     gbest262.seq
 230689987     gbest263.seq
 230689841     gbest264.seq
 230687754     gbest265.seq
 230688961     gbest266.seq
 230688930     gbest267.seq
 230688958     gbest268.seq
 230687949     gbest269.seq
 230689065     gbest27.seq
 230687646     gbest270.seq
 230689370     gbest271.seq
 230688292     gbest272.seq
 230689824     gbest273.seq
 230688902     gbest274.seq
 230688775     gbest275.seq
 230688646     gbest276.seq
 230689527     gbest277.seq
 230687945     gbest278.seq
 230694715     gbest279.seq
 230688661     gbest28.seq
 230688229     gbest280.seq
 230688934     gbest281.seq
 230689207     gbest282.seq
 230688074     gbest283.seq
 230688955     gbest284.seq
 230687768     gbest285.seq
 230689468     gbest286.seq
 230688318     gbest287.seq
 230687832     gbest288.seq
 230688704     gbest289.seq
 230688942     gbest29.seq
 215364416     gbest290.seq
 228377342     gbest291.seq
 230688453     gbest292.seq
 230691126     gbest293.seq
 230689789     gbest294.seq
 230690944     gbest295.seq
 230689626     gbest296.seq
 230687568     gbest297.seq
 230689582     gbest298.seq
 230689508     gbest299.seq
 230690086     gbest3.seq
 230687897     gbest30.seq
 230687441     gbest300.seq
 230687539     gbest301.seq
 230689715     gbest302.seq
 230689649     gbest303.seq
 230688668     gbest304.seq
 230689254     gbest305.seq
 230689599     gbest306.seq
 230687783     gbest307.seq
 230691285     gbest308.seq
 230687505     gbest309.seq
 230690340     gbest31.seq
 230691630     gbest310.seq
 230688548     gbest311.seq
 230688506     gbest312.seq
 230687787     gbest313.seq
 230687990     gbest314.seq
 230688075     gbest315.seq
 230688910     gbest316.seq
 230689631     gbest317.seq
 230688491     gbest318.seq
 230690515     gbest319.seq
 230690174     gbest32.seq
 230688599     gbest320.seq
 230689595     gbest321.seq
 230688723     gbest322.seq
 230689013     gbest323.seq
 230688810     gbest324.seq
 230690326     gbest325.seq
 230689237     gbest326.seq
 230689037     gbest327.seq
 230689913     gbest328.seq
 230689620     gbest329.seq
 230689388     gbest33.seq
 230688552     gbest330.seq
 230689550     gbest331.seq
 230687841     gbest332.seq
 230690538     gbest333.seq
 230688386     gbest334.seq
 230687695     gbest335.seq
 230689318     gbest336.seq
 230689077     gbest337.seq
 230689492     gbest338.seq
 230687660     gbest339.seq
 230687674     gbest34.seq
 230688776     gbest340.seq
 230689902     gbest341.seq
 201941926     gbest342.seq
 230688027     gbest343.seq
 230689249     gbest344.seq
 230690512     gbest345.seq
 230689552     gbest346.seq
 230688783     gbest347.seq
 230687791     gbest348.seq
 143431614     gbest349.seq
 230690004     gbest35.seq
 178693153     gbest350.seq
 230689265     gbest351.seq
 230688689     gbest352.seq
 230689057     gbest353.seq
 230689207     gbest354.seq
 230689155     gbest355.seq
 230689961     gbest356.seq
 230690792     gbest357.seq
 230689996     gbest358.seq
 230688835     gbest359.seq
 230688054     gbest36.seq
 230688201     gbest360.seq
 230687608     gbest361.seq
 230688370     gbest362.seq
 230691026     gbest363.seq
 230689602     gbest364.seq
 230692232     gbest365.seq
 230687895     gbest366.seq
 230689386     gbest367.seq
 230688431     gbest368.seq
 230688973     gbest369.seq
 230688767     gbest37.seq
 230690256     gbest370.seq
 230687509     gbest371.seq
 230689039     gbest372.seq
 230688358     gbest373.seq
 230687565     gbest374.seq
 230689418     gbest375.seq
 230687555     gbest376.seq
 230689807     gbest377.seq
 230688751     gbest378.seq
 230689598     gbest379.seq
 230688489     gbest38.seq
 230688063     gbest380.seq
 230688074     gbest381.seq
 230688161     gbest382.seq
 230690494     gbest383.seq
 230692333     gbest384.seq
 230688994     gbest385.seq
 230688138     gbest386.seq
 230688832     gbest387.seq
 230687990     gbest388.seq
 230687789     gbest389.seq
 230690684     gbest39.seq
 230687586     gbest390.seq
 230688374     gbest391.seq
 230687524     gbest392.seq
 230689973     gbest393.seq
 230693338     gbest394.seq
 230689367     gbest395.seq
 230687697     gbest396.seq
 230690580     gbest397.seq
 230687513     gbest398.seq
 230689114     gbest399.seq
 230688808     gbest4.seq
 230687582     gbest40.seq
 230688411     gbest400.seq
 230690604     gbest401.seq
 230690391     gbest402.seq
 230689195     gbest403.seq
 230689015     gbest404.seq
 230688792     gbest405.seq
 212146428     gbest406.seq
 230689632     gbest407.seq
 230687614     gbest408.seq
 230688114     gbest409.seq
 230687740     gbest41.seq
 230689084     gbest410.seq
 230689186     gbest411.seq
 230689702     gbest412.seq
 230687649     gbest413.seq
 230687957     gbest414.seq
 230689318     gbest415.seq
 230690255     gbest416.seq
 230687971     gbest417.seq
 230688777     gbest418.seq
 230688629     gbest419.seq
 230688937     gbest42.seq
 230691440     gbest420.seq
 230688164     gbest421.seq
 230691362     gbest422.seq
 230687652     gbest423.seq
 210589455     gbest424.seq
 210244821     gbest425.seq
 210117964     gbest426.seq
 210406230     gbest427.seq
 210302493     gbest428.seq
 210426285     gbest429.seq
 230687695     gbest43.seq
 211365579     gbest430.seq
 211632839     gbest431.seq
 211277669     gbest432.seq
 212165582     gbest433.seq
 213484997     gbest434.seq
 211373792     gbest435.seq
 210830068     gbest436.seq
 210726920     gbest437.seq
 210561672     gbest438.seq
 210142253     gbest439.seq
 230687623     gbest44.seq
 210235366     gbest440.seq
 210197562     gbest441.seq
 210134763     gbest442.seq
 222743086     gbest443.seq
 230689459     gbest444.seq
 230689120     gbest445.seq
 230688536     gbest446.seq
 230687915     gbest447.seq
 230689026     gbest448.seq
 230689494     gbest449.seq
 223279853     gbest45.seq
 230688650     gbest450.seq
 230690488     gbest451.seq
 230688803     gbest452.seq
 230687809     gbest453.seq
 230688241     gbest454.seq
 230690162     gbest455.seq
 230687788     gbest456.seq
 230689530     gbest457.seq
 230689122     gbest458.seq
 230689003     gbest459.seq
 192377589     gbest46.seq
 230689182     gbest460.seq
 230688231     gbest461.seq
 230691579     gbest462.seq
 230688528     gbest463.seq
 230690782     gbest464.seq
 230687517     gbest465.seq
 230688332     gbest466.seq
 230690175     gbest467.seq
 230688498     gbest468.seq
 230689512     gbest469.seq
 191859528     gbest47.seq
 230691027     gbest470.seq
 227062714     gbest471.seq
 230688208     gbest472.seq
 230687526     gbest473.seq
 230688633     gbest474.seq
 230690379     gbest475.seq
 230688836     gbest476.seq
 230688241     gbest477.seq
 230688892     gbest478.seq
 230687670     gbest479.seq
 215094753     gbest48.seq
 230689033     gbest480.seq
 230689951     gbest481.seq
 230689135     gbest482.seq
 230688598     gbest483.seq
 230688215     gbest484.seq
 230691037     gbest485.seq
 230689700     gbest486.seq
 230689664     gbest487.seq
 230689124     gbest488.seq
 230688820     gbest489.seq
 216203173     gbest49.seq
 230688668     gbest490.seq
 230690359     gbest491.seq
 230690497     gbest492.seq
 230687638     gbest493.seq
 230691568     gbest494.seq
 230687703     gbest495.seq
 230688676     gbest496.seq
 226769910     gbest497.seq
 230688988     gbest498.seq
 230688668     gbest499.seq
 164122622     gbest5.seq
 215866619     gbest50.seq
 230688592     gbest500.seq
 230688277     gbest501.seq
 230690898     gbest502.seq
 230689020     gbest503.seq
 230689840     gbest504.seq
 230687546     gbest505.seq
 230690323     gbest506.seq
 230688347     gbest507.seq
 230689066     gbest508.seq
 230688580     gbest509.seq
 216967628     gbest51.seq
 230688235     gbest510.seq
 225581732     gbest511.seq
 228018183     gbest512.seq
 230688500     gbest513.seq
 230688744     gbest514.seq
 230690154     gbest515.seq
 230687690     gbest516.seq
 230688872     gbest517.seq
 230687561     gbest518.seq
 230688297     gbest519.seq
 230688078     gbest52.seq
 230687699     gbest520.seq
 230689832     gbest521.seq
 230689647     gbest522.seq
 230689079     gbest523.seq
 230689537     gbest524.seq
 230689702     gbest525.seq
 226972693     gbest526.seq
 196054591     gbest527.seq
 223780479     gbest528.seq
 230690494     gbest529.seq
 230689310     gbest53.seq
 230689895     gbest530.seq
 230688875     gbest531.seq
 230687540     gbest532.seq
 230689301     gbest533.seq
 230689681     gbest534.seq
 230688252     gbest535.seq
 230690261     gbest536.seq
 230689649     gbest537.seq
 230689087     gbest538.seq
 230688870     gbest539.seq
 230688364     gbest54.seq
 230689264     gbest540.seq
 221861437     gbest541.seq
 221850582     gbest542.seq
 230689491     gbest543.seq
 230690376     gbest544.seq
 230688868     gbest545.seq
 230689308     gbest546.seq
 230688975     gbest547.seq
 230688061     gbest548.seq
 219961408     gbest549.seq
 227044573     gbest55.seq
 223931492     gbest550.seq
 230688314     gbest551.seq
 230688623     gbest552.seq
 230688771     gbest553.seq
 230689572     gbest554.seq
 230689870     gbest555.seq
 230689513     gbest556.seq
 230687669     gbest557.seq
 230688448     gbest558.seq
 230688287     gbest559.seq
 230249432     gbest56.seq
 230688550     gbest560.seq
 230688829     gbest561.seq
 230690090     gbest562.seq
 230690878     gbest563.seq
 230688215     gbest564.seq
 230687756     gbest565.seq
 230688200     gbest566.seq
 230690492     gbest567.seq
 230689485     gbest568.seq
 230689480     gbest569.seq
 230688826     gbest57.seq
 230689355     gbest570.seq
 230687740     gbest571.seq
 230687977     gbest572.seq
 230688796     gbest573.seq
 230689599     gbest574.seq
 230688708     gbest575.seq
 230688538     gbest576.seq
 230687976     gbest577.seq
 230687992     gbest578.seq
 230688627     gbest579.seq
 230690327     gbest58.seq
 230687685     gbest580.seq
 230689597     gbest581.seq
 230688463     gbest582.seq
 230688884     gbest583.seq
 230688084     gbest584.seq
 230689839     gbest585.seq
 230690980     gbest586.seq
 230688613     gbest587.seq
 230687897     gbest588.seq
 230688563     gbest589.seq
 230689288     gbest59.seq
 230688387     gbest590.seq
 230687947     gbest591.seq
 230687795     gbest592.seq
 230688679     gbest593.seq
 230687963     gbest594.seq
 230689245     gbest595.seq
 230690254     gbest596.seq
 230691032     gbest597.seq
 230687471     gbest598.seq
 230689453     gbest599.seq
 177441695     gbest6.seq
 230688024     gbest60.seq
 230689804     gbest600.seq
 230689757     gbest601.seq
 230689924     gbest602.seq
 230688519     gbest603.seq
 230689616     gbest604.seq
 230687755     gbest605.seq
 230688270     gbest606.seq
 230689209     gbest607.seq
 230687746     gbest608.seq
 230689301     gbest609.seq
 230688711     gbest61.seq
 230688039     gbest610.seq
 230689244     gbest611.seq
 230688308     gbest612.seq
 230689525     gbest613.seq
 230689001     gbest614.seq
 230688855     gbest615.seq
 230689906     gbest616.seq
 209187736     gbest617.seq
 230689456     gbest618.seq
 230688966     gbest619.seq
 230688917     gbest62.seq
 226734558     gbest620.seq
 217300237     gbest621.seq
 230688484     gbest622.seq
 223354609     gbest623.seq
 189320189     gbest624.seq
 189213284     gbest625.seq
 192273890     gbest626.seq
 190721998     gbest627.seq
 190446733     gbest628.seq
 189857574     gbest629.seq
 230688498     gbest63.seq
 192227376     gbest630.seq
 190283153     gbest631.seq
 190060726     gbest632.seq
 191897861     gbest633.seq
 230687512     gbest634.seq
 230688035     gbest635.seq
 230687855     gbest636.seq
 230688983     gbest637.seq
 230691016     gbest638.seq
 230689334     gbest639.seq
 230687960     gbest64.seq
 230690570     gbest640.seq
 230688482     gbest641.seq
 230689150     gbest642.seq
 230688950     gbest643.seq
 230687507     gbest644.seq
 230687569     gbest645.seq
 230689614     gbest646.seq
 230688183     gbest647.seq
 230687717     gbest648.seq
 230690668     gbest649.seq
 230690213     gbest65.seq
 230689111     gbest650.seq
 230689191     gbest651.seq
 230689823     gbest652.seq
 230689697     gbest653.seq
 230689596     gbest654.seq
 230688691     gbest655.seq
 230689675     gbest656.seq
 230688887     gbest657.seq
 230687547     gbest658.seq
 230689864     gbest659.seq
 230689969     gbest66.seq
 230690581     gbest660.seq
 230690825     gbest661.seq
 230687513     gbest662.seq
 230687497     gbest663.seq
 230690341     gbest664.seq
 230689680     gbest665.seq
 230690264     gbest666.seq
 230688695     gbest667.seq
 230690090     gbest668.seq
 230689158     gbest669.seq
 230687497     gbest67.seq
 230689161     gbest670.seq
 230688932     gbest671.seq
 225512012     gbest672.seq
 230689517     gbest673.seq
 230688313     gbest674.seq
  40606395     gbest675.seq
 230688214     gbest68.seq
 230689501     gbest69.seq
 230690906     gbest7.seq
 230288833     gbest70.seq
 230688001     gbest71.seq
 210191941     gbest72.seq
 209389918     gbest73.seq
 208712239     gbest74.seq
 209068508     gbest75.seq
 209559853     gbest76.seq
 210591605     gbest77.seq
 209600572     gbest78.seq
 208395265     gbest79.seq
 230688637     gbest8.seq
 210183017     gbest80.seq
 208948469     gbest81.seq
 205188900     gbest82.seq
 208416787     gbest83.seq
 207681838     gbest84.seq
 210408781     gbest85.seq
 224382001     gbest86.seq
 230687642     gbest87.seq
 230690823     gbest88.seq
 222491747     gbest89.seq
 230688685     gbest9.seq
 214449764     gbest90.seq
 214088235     gbest91.seq
 230687446     gbest92.seq
 230688918     gbest93.seq
 230688028     gbest94.seq
 230688833     gbest95.seq
 230688707     gbest96.seq
 230689092     gbest97.seq
 230688059     gbest98.seq
 230687594     gbest99.seq
  74122540     gbgen.idx
 209716011     gbgss1.seq
 209719113     gbgss10.seq
 209718163     gbgss100.seq
 209717738     gbgss101.seq
 209718882     gbgss102.seq
 209716227     gbgss103.seq
 209716898     gbgss104.seq
 209717763     gbgss105.seq
 209716994     gbgss106.seq
 209716726     gbgss107.seq
 209717399     gbgss108.seq
 209717217     gbgss109.seq
 209716636     gbgss11.seq
 209718827     gbgss110.seq
 207037075     gbgss111.seq
 208074259     gbgss112.seq
 207885040     gbgss113.seq
 207855556     gbgss114.seq
 207106932     gbgss115.seq
 206778973     gbgss116.seq
 209717416     gbgss117.seq
 209717531     gbgss118.seq
 209718853     gbgss119.seq
 209718702     gbgss12.seq
 209718329     gbgss120.seq
 209717278     gbgss121.seq
 209715921     gbgss122.seq
 209717432     gbgss123.seq
 209716351     gbgss124.seq
 209717766     gbgss125.seq
 209716038     gbgss126.seq
 209718037     gbgss127.seq
 209717478     gbgss128.seq
 209718011     gbgss129.seq
 209717618     gbgss13.seq
 209717002     gbgss130.seq
 209717392     gbgss131.seq
 209716139     gbgss132.seq
 209715935     gbgss133.seq
 209716122     gbgss134.seq
 209718447     gbgss135.seq
 209717997     gbgss136.seq
 209718150     gbgss137.seq
 209716924     gbgss138.seq
 209717959     gbgss139.seq
 209717613     gbgss14.seq
 209716788     gbgss140.seq
 209717876     gbgss141.seq
 209719217     gbgss142.seq
 209718541     gbgss143.seq
 209716488     gbgss144.seq
 209717577     gbgss145.seq
 209717865     gbgss146.seq
 209717295     gbgss147.seq
 209716718     gbgss148.seq
 209718603     gbgss149.seq
 209716297     gbgss15.seq
 209717947     gbgss150.seq
 209716172     gbgss151.seq
 209716148     gbgss152.seq
 209716335     gbgss153.seq
 209716644     gbgss154.seq
 209715991     gbgss155.seq
 209716720     gbgss156.seq
 209715947     gbgss157.seq
 209718834     gbgss158.seq
 209717209     gbgss159.seq
 209718089     gbgss16.seq
 203728162     gbgss160.seq
 209717969     gbgss161.seq
 209716233     gbgss162.seq
 176926999     gbgss163.seq
 209716590     gbgss164.seq
 209718597     gbgss165.seq
 209717027     gbgss166.seq
 209716285     gbgss167.seq
 209716911     gbgss168.seq
 209716643     gbgss169.seq
 209718026     gbgss17.seq
 209716731     gbgss170.seq
 209718718     gbgss171.seq
 209717014     gbgss172.seq
 209716322     gbgss173.seq
 209716058     gbgss174.seq
 209716202     gbgss175.seq
 209717177     gbgss176.seq
 209718144     gbgss177.seq
 209717130     gbgss178.seq
 209716507     gbgss179.seq
 209718312     gbgss18.seq
 209717546     gbgss180.seq
 209717923     gbgss181.seq
 209715976     gbgss182.seq
 209718575     gbgss183.seq
 209717645     gbgss184.seq
 209717648     gbgss185.seq
 209718212     gbgss186.seq
 208148335     gbgss187.seq
 209718192     gbgss188.seq
 209716546     gbgss189.seq
 209719001     gbgss19.seq
 209718341     gbgss190.seq
 196015291     gbgss191.seq
 188920668     gbgss192.seq
 190091083     gbgss193.seq
 191558130     gbgss194.seq
 191101663     gbgss195.seq
 190377967     gbgss196.seq
 190049615     gbgss197.seq
 188497748     gbgss198.seq
 188421213     gbgss199.seq
 209717137     gbgss2.seq
 209718325     gbgss20.seq
 188804470     gbgss200.seq
 190223438     gbgss201.seq
 190229527     gbgss202.seq
 190498509     gbgss203.seq
 187256876     gbgss204.seq
 186899477     gbgss205.seq
 186832700     gbgss206.seq
 186789179     gbgss207.seq
 186639311     gbgss208.seq
 186423236     gbgss209.seq
 209717437     gbgss21.seq
 187905826     gbgss210.seq
 188582408     gbgss211.seq
 189639613     gbgss212.seq
 189005266     gbgss213.seq
 189040514     gbgss214.seq
 189637752     gbgss215.seq
 189811921     gbgss216.seq
 189799245     gbgss217.seq
 188787380     gbgss218.seq
 187249499     gbgss219.seq
 209717642     gbgss22.seq
 187347185     gbgss220.seq
 187627117     gbgss221.seq
 186836750     gbgss222.seq
 187204503     gbgss223.seq
 188522852     gbgss224.seq
 188217459     gbgss225.seq
 188469005     gbgss226.seq
 188263808     gbgss227.seq
 188460073     gbgss228.seq
 188075759     gbgss229.seq
 209716654     gbgss23.seq
 188302917     gbgss230.seq
 188052035     gbgss231.seq
 188094267     gbgss232.seq
 187878455     gbgss233.seq
 189048992     gbgss234.seq
 188905728     gbgss235.seq
 190028730     gbgss236.seq
 191006983     gbgss237.seq
 190389011     gbgss238.seq
 190867457     gbgss239.seq
 209716604     gbgss24.seq
 193693376     gbgss240.seq
 198964286     gbgss241.seq
 199316266     gbgss242.seq
 209717758     gbgss243.seq
 209716929     gbgss244.seq
 209718782     gbgss245.seq
 209717423     gbgss246.seq
 102438745     gbgss247.seq
 250000587     gbgss248.seq
 250000528     gbgss249.seq
 209718179     gbgss25.seq
 250001090     gbgss250.seq
 250003165     gbgss251.seq
 250001891     gbgss252.seq
 250000431     gbgss253.seq
 250001825     gbgss254.seq
 250000909     gbgss255.seq
 250002571     gbgss256.seq
 250002433     gbgss257.seq
 250000352     gbgss258.seq
 250001445     gbgss259.seq
 209717587     gbgss26.seq
 250001903     gbgss260.seq
 250000091     gbgss261.seq
 250001509     gbgss262.seq
 250002123     gbgss263.seq
 250000143     gbgss264.seq
 250001324     gbgss265.seq
 250000339     gbgss266.seq
 250003403     gbgss267.seq
 250001638     gbgss268.seq
 250001571     gbgss269.seq
 209719224     gbgss27.seq
 250000923     gbgss270.seq
 250000181     gbgss271.seq
 250002124     gbgss272.seq
 250001063     gbgss273.seq
 250000882     gbgss274.seq
 250000300     gbgss275.seq
 250000102     gbgss276.seq
 250000116     gbgss277.seq
 250001876     gbgss278.seq
 250001935     gbgss279.seq
 209718361     gbgss28.seq
 250000658     gbgss280.seq
 250000453     gbgss281.seq
 250000185     gbgss282.seq
 250000677     gbgss283.seq
 250001099     gbgss284.seq
 250002461     gbgss285.seq
 250001541     gbgss286.seq
 250001970     gbgss287.seq
 250002194     gbgss288.seq
 250001384     gbgss289.seq
 209720057     gbgss29.seq
 250000385     gbgss290.seq
 250002059     gbgss291.seq
 250002391     gbgss292.seq
 250000932     gbgss293.seq
 250000255     gbgss294.seq
 111860695     gbgss295.seq
 209718357     gbgss3.seq
 209717859     gbgss30.seq
 209719445     gbgss31.seq
 209717260     gbgss32.seq
 209718695     gbgss33.seq
 209716659     gbgss34.seq
 209718176     gbgss35.seq
 209717711     gbgss36.seq
 209718551     gbgss37.seq
 209716567     gbgss38.seq
 209716441     gbgss39.seq
 209716735     gbgss4.seq
 209717552     gbgss40.seq
 209718069     gbgss41.seq
 209717215     gbgss42.seq
 209716439     gbgss43.seq
 209716436     gbgss44.seq
 209716469     gbgss45.seq
 209717279     gbgss46.seq
 209717020     gbgss47.seq
 209718731     gbgss48.seq
 209717645     gbgss49.seq
 209718358     gbgss5.seq
 209718854     gbgss50.seq
 209716281     gbgss51.seq
 209717570     gbgss52.seq
 209717880     gbgss53.seq
 209717864     gbgss54.seq
 209717675     gbgss55.seq
 209716424     gbgss56.seq
 209717756     gbgss57.seq
 209717340     gbgss58.seq
 209718945     gbgss59.seq
 209717139     gbgss6.seq
 209718143     gbgss60.seq
 209716162     gbgss61.seq
 209716644     gbgss62.seq
 209717744     gbgss63.seq
 209716243     gbgss64.seq
 209717204     gbgss65.seq
 209718032     gbgss66.seq
 208009657     gbgss67.seq
 209362838     gbgss68.seq
 209717107     gbgss69.seq
 209718431     gbgss7.seq
 209718063     gbgss70.seq
 209717029     gbgss71.seq
 209716787     gbgss72.seq
 209716054     gbgss73.seq
 209716123     gbgss74.seq
 209717749     gbgss75.seq
 209717672     gbgss76.seq
 209716479     gbgss77.seq
 209717378     gbgss78.seq
 209716052     gbgss79.seq
 209718624     gbgss8.seq
 209717991     gbgss80.seq
 209716729     gbgss81.seq
 209717024     gbgss82.seq
 209718047     gbgss83.seq
 209716142     gbgss84.seq
 209718041     gbgss85.seq
 209717503     gbgss86.seq
 209716884     gbgss87.seq
 209717041     gbgss88.seq
 207146261     gbgss89.seq
 209717119     gbgss9.seq
 176180860     gbgss90.seq
 176791346     gbgss91.seq
 209716804     gbgss92.seq
 209718595     gbgss93.seq
 209717793     gbgss94.seq
 209716152     gbgss95.seq
 209718075     gbgss96.seq
 209718292     gbgss97.seq
 209717287     gbgss98.seq
 209718155     gbgss99.seq
 250005562     gbhtc1.seq
 250000758     gbhtc10.seq
 250001732     gbhtc11.seq
 176065468     gbhtc12.seq
 250016615     gbhtc2.seq
 250005705     gbhtc3.seq
 250002243     gbhtc4.seq
 250012416     gbhtc5.seq
 250007006     gbhtc6.seq
 250000669     gbhtc7.seq
 250008464     gbhtc8.seq
 250004401     gbhtc9.seq
 250096214     gbhtg1.seq
 250059723     gbhtg10.seq
 250140778     gbhtg100.seq
 250219650     gbhtg101.seq
 250143483     gbhtg102.seq
 250000269     gbhtg103.seq
 250178535     gbhtg104.seq
  85718696     gbhtg105.seq
 250080408     gbhtg11.seq
 250028717     gbhtg12.seq
 250228970     gbhtg13.seq
 250086689     gbhtg14.seq
 250190626     gbhtg15.seq
 250201587     gbhtg16.seq
 250201830     gbhtg17.seq
 250114985     gbhtg18.seq
 250028302     gbhtg19.seq
 250020785     gbhtg2.seq
 250033811     gbhtg20.seq
 250164026     gbhtg21.seq
 250242949     gbhtg22.seq
 250045352     gbhtg23.seq
 250068017     gbhtg24.seq
 250000857     gbhtg25.seq
 250142134     gbhtg26.seq
 250183323     gbhtg27.seq
 250030226     gbhtg28.seq
 250074193     gbhtg29.seq
 250039038     gbhtg3.seq
 250290721     gbhtg30.seq
 250202905     gbhtg31.seq
 250158076     gbhtg32.seq
 250226326     gbhtg33.seq
 250016968     gbhtg34.seq
 250427479     gbhtg35.seq
 250108266     gbhtg36.seq
 250039742     gbhtg37.seq
 250154069     gbhtg38.seq
 250123377     gbhtg39.seq
 250101895     gbhtg4.seq
 250134866     gbhtg40.seq
 250046909     gbhtg41.seq
 250185164     gbhtg42.seq
 250143201     gbhtg43.seq
 250129536     gbhtg44.seq
 250151261     gbhtg45.seq
 250004486     gbhtg46.seq
 250075432     gbhtg47.seq
 250050473     gbhtg48.seq
 250071213     gbhtg49.seq
 250209186     gbhtg5.seq
 250230927     gbhtg50.seq
 250278114     gbhtg51.seq
 250138533     gbhtg52.seq
 250304272     gbhtg53.seq
 250110009     gbhtg54.seq
 250075322     gbhtg55.seq
 250124699     gbhtg56.seq
 250287811     gbhtg57.seq
 250100705     gbhtg58.seq
 250156736     gbhtg59.seq
 250053403     gbhtg6.seq
 250023777     gbhtg60.seq
 250119554     gbhtg61.seq
 250141357     gbhtg62.seq
 250025374     gbhtg63.seq
 250034496     gbhtg64.seq
 250121010     gbhtg65.seq
 250082856     gbhtg66.seq
 250217440     gbhtg67.seq
 250089421     gbhtg68.seq
 250069388     gbhtg69.seq
 250004220     gbhtg7.seq
 250273298     gbhtg70.seq
 250337708     gbhtg71.seq
 250120169     gbhtg72.seq
 250046000     gbhtg73.seq
 250076879     gbhtg74.seq
 250134988     gbhtg75.seq
 250260345     gbhtg76.seq
 250182113     gbhtg77.seq
 250227922     gbhtg78.seq
 250148818     gbhtg79.seq
 250124024     gbhtg8.seq
 250041994     gbhtg80.seq
 250116513     gbhtg81.seq
 250026783     gbhtg82.seq
 250040921     gbhtg83.seq
 250203762     gbhtg84.seq
 250149960     gbhtg85.seq
 250165401     gbhtg86.seq
 250172828     gbhtg87.seq
 250050124     gbhtg88.seq
 250158514     gbhtg89.seq
 250009915     gbhtg9.seq
 250121512     gbhtg90.seq
 250150385     gbhtg91.seq
 250125745     gbhtg92.seq
 250029946     gbhtg93.seq
 250131185     gbhtg94.seq
 253053788     gbhtg95.seq
 250080631     gbhtg96.seq
 252373039     gbhtg97.seq
 250105624     gbhtg98.seq
 250092682     gbhtg99.seq
 250089690     gbinv1.seq
 250024835     gbinv10.seq
 169141388     gbinv11.seq
 250026061     gbinv2.seq
 250002193     gbinv3.seq
 250000649     gbinv4.seq
 250000671     gbinv5.seq
 250000297     gbinv6.seq
 250000934     gbinv7.seq
 250000100     gbinv8.seq
 250002142     gbinv9.seq
 148999061     gbjou1.idx
 139168782     gbjou2.idx
 230920172     gbjou3.idx
 276365723     gbjou4.idx
  23178691     gbjou5.idx
 187769530     gbkey1.idx
 208288530     gbkey2.idx
   6145319     gbkey3.idx
 250000708     gbmam1.seq
 250003470     gbmam2.seq
 250001235     gbmam3.seq
  46716137     gbmam4.seq
  45334631     gbnew.txt
 250000401     gbpat1.seq
 250001176     gbpat10.seq
 250000358     gbpat11.seq
 250001414     gbpat12.seq
 250000859     gbpat13.seq
 250000501     gbpat14.seq
 250001402     gbpat15.seq
 250001582     gbpat16.seq
 250002043     gbpat17.seq
 250000092     gbpat18.seq
 250000035     gbpat19.seq
 250000204     gbpat2.seq
 250002306     gbpat20.seq
 250000490     gbpat21.seq
 250170081     gbpat22.seq
 250079151     gbpat23.seq
 250001446     gbpat24.seq
 250005220     gbpat25.seq
 250002245     gbpat26.seq
 250001284     gbpat27.seq
 250008047     gbpat28.seq
 250000947     gbpat29.seq
 250003353     gbpat3.seq
 250000141     gbpat30.seq
 250001061     gbpat31.seq
 250000986     gbpat32.seq
 250000292     gbpat33.seq
  78892334     gbpat34.seq
 250002406     gbpat4.seq
 250000084     gbpat5.seq
 250000203     gbpat6.seq
 250001519     gbpat7.seq
 250002720     gbpat8.seq
 250000011     gbpat9.seq
  64930275     gbphg.seq
 250032297     gbpln1.seq
 250001266     gbpln10.seq
 250030479     gbpln11.seq
 250004070     gbpln12.seq
 250004469     gbpln13.seq
 250171428     gbpln14.seq
 250037744     gbpln15.seq
 266322726     gbpln16.seq
 267454122     gbpln17.seq
 250000886     gbpln18.seq
 250002450     gbpln19.seq
 250039945     gbpln2.seq
 250000587     gbpln20.seq
 250520077     gbpln21.seq
 250000145     gbpln22.seq
 250000965     gbpln23.seq
 250000245     gbpln24.seq
 250002144     gbpln25.seq
 250000656     gbpln26.seq
 188456936     gbpln27.seq
 250006138     gbpln3.seq
 250614107     gbpln4.seq
 250000626     gbpln5.seq
 250000144     gbpln6.seq
 250002883     gbpln7.seq
 250001967     gbpln8.seq
 250000061     gbpln9.seq
 250044409     gbpri1.seq
 250233099     gbpri10.seq
 250054978     gbpri11.seq
 250034661     gbpri12.seq
 250051012     gbpri13.seq
 250109052     gbpri14.seq
 250192888     gbpri15.seq
 250069835     gbpri16.seq
 250038248     gbpri17.seq
 250280044     gbpri18.seq
 250000964     gbpri19.seq
 250015561     gbpri2.seq
 250008200     gbpri20.seq
 250024984     gbpri21.seq
 250030391     gbpri22.seq
 250079954     gbpri23.seq
 250023428     gbpri24.seq
 250176966     gbpri25.seq
 250182400     gbpri26.seq
 250101872     gbpri27.seq
 250001118     gbpri28.seq
 251850949     gbpri29.seq
 250020002     gbpri3.seq
 250002603     gbpri30.seq
 250004345     gbpri31.seq
 250001535     gbpri32.seq
 250002765     gbpri33.seq
 237721779     gbpri34.seq
 250005364     gbpri4.seq
 250052347     gbpri5.seq
 250057929     gbpri6.seq
 250118849     gbpri7.seq
 250335295     gbpri8.seq
 250025759     gbpri9.seq
    286821     gbrel.txt
 250256137     gbrod1.seq
 250091258     gbrod10.seq
 250112331     gbrod11.seq
 250126924     gbrod12.seq
 250055425     gbrod13.seq
 250152854     gbrod14.seq
 250092002     gbrod15.seq
 250124434     gbrod16.seq
 250000865     gbrod17.seq
 250095752     gbrod18.seq
 250252754     gbrod19.seq
 250225189     gbrod2.seq
 250076204     gbrod20.seq
 250001974     gbrod21.seq
 250004706     gbrod22.seq
 250004554     gbrod23.seq
 250000658     gbrod24.seq
 250000525     gbrod25.seq
  68692758     gbrod26.seq
 250098146     gbrod3.seq
 250227134     gbrod4.seq
 250055825     gbrod5.seq
 250113668     gbrod6.seq
 250145170     gbrod7.seq
 250056910     gbrod8.seq
 250192191     gbrod9.seq
1206247726     gbsdr1.txt
3853367618     gbsdr2.txt
1710953438     gbsdr3.txt
  98286799     gbsec.idx
 250001142     gbsts1.seq
 250000926     gbsts10.seq
 250002036     gbsts11.seq
 250002240     gbsts12.seq
 250002167     gbsts13.seq
 199800359     gbsts14.seq
 250001256     gbsts2.seq
 250001893     gbsts3.seq
 250000943     gbsts4.seq
 250003898     gbsts5.seq
 250001736     gbsts6.seq
 250002692     gbsts7.seq
 250001758     gbsts8.seq
 250002327     gbsts9.seq
 250002099     gbsyn1.seq
  26422141     gbsyn2.seq
    422716     gbuna.seq
 250015646     gbvrl1.seq
 250000013     gbvrl2.seq
 250010335     gbvrl3.seq
 250003148     gbvrl4.seq
 250001458     gbvrl5.seq
 250002357     gbvrl6.seq
 250002790     gbvrl7.seq
 150521426     gbvrl8.seq
 250170247     gbvrt1.seq
 250013241     gbvrt10.seq
 250016644     gbvrt11.seq
 250039316     gbvrt12.seq
 250003001     gbvrt13.seq
 250000283     gbvrt14.seq
  17008050     gbvrt15.seq
 250004794     gbvrt2.seq
 250246998     gbvrt3.seq
 250002597     gbvrt4.seq
 250000118     gbvrt5.seq
 250027771     gbvrt6.seq
 250157878     gbvrt7.seq
 250030639     gbvrt8.seq
 250050490     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         33065      101002156
BCT10        115        107914174
BCT11        145        102149261
BCT12        61         113778634
BCT13        46         112930081
BCT14        55         116808839
BCT15        52         117268197
BCT16        71         113646700
BCT17        42         112657675
BCT18        59         112338335
BCT19        67         112930593
BCT2         3541       111270643
BCT20        59         114150194
BCT21        60         114870424
BCT22        56         109124474
BCT23        7839       101592577
BCT24        74483      80628897
BCT25        55373      89586059
BCT26        7073       17322277
BCT3         159        112070853
BCT4         23024      104073120
BCT5         54376      87638936
BCT6         5466       98489581
BCT7         15620      100856871
BCT8         21988      106692337
BCT9         47739      93730267
ENV1         91203      70852034
ENV2         96311      70771609
ENV3         83245      86327578
ENV4         92507      82762950
ENV5         129513     35642421
ENV6         105031     59187528
ENV7         82094      63313243
EST1         68126      26289737
EST10        76542      29845947
EST100       75762      43610646
EST101       71174      36766224
EST102       75013      33363679
EST103       72493      45116514
EST104       73116      33785040
EST105       73091      43139605
EST106       67210      36068929
EST107       73273      36427094
EST108       72730      48193073
EST109       72776      42759593
EST11        75186      28804942
EST110       68682      46206873
EST111       74166      33279634
EST112       70759      29813189
EST113       64559      32016209
EST114       68597      40924592
EST115       69493      38511905
EST116       70951      41901258
EST117       75430      34082066
EST118       74319      27517741
EST119       75044      29033828
EST12        77560      30740468
EST120       72488      39739124
EST121       65301      31813738
EST122       78676      48072978
EST123       78690      44648254
EST124       70749      46683645
EST125       69058      40432067
EST126       72409      49329490
EST127       68146      42806697
EST128       73193      45111153
EST129       75767      44127094
EST13        77009      29270258
EST130       71082      48598929
EST131       74688      47949220
EST132       74355      45995296
EST133       78004      34262754
EST134       77798      28548405
EST135       79843      49229388
EST136       74810      42490823
EST137       64792      35715777
EST138       73021      37095306
EST139       65788      36506474
EST14        78527      31836122
EST140       66839      36566432
EST141       70472      43247113
EST142       72930      43158549
EST143       67982      41369977
EST144       67842      40639732
EST145       75148      43864174
EST146       68555      41558324
EST147       59927      33928949
EST148       96415      52185496
EST149       85606      49409640
EST15        74651      31550365
EST150       77992      40105907
EST151       101347     54650030
EST152       108241     58059371
EST153       98327      54277064
EST154       73828      45109738
EST155       94243      55272638
EST156       99452      59598869
EST157       90729      56079617
EST158       82780      43684501
EST159       70620      41449008
EST16        75794      33337683
EST160       65523      31314817
EST161       62670      28544287
EST162       55122      26208004
EST163       66201      31806638
EST164       58754      29873323
EST165       71495      41208253
EST166       68870      46385338
EST167       68513      48177353
EST168       78134      45193249
EST169       57875      29843197
EST17        82206      33937960
EST170       63262      32257628
EST171       66353      38703501
EST172       64485      43309013
EST173       62552      37908586
EST174       97716      45814991
EST175       83801      45942002
EST176       97675      56434478
EST177       99392      57591905
EST178       91406      49949331
EST179       84919      42739054
EST18        80843      32236579
EST180       90478      37182969
EST181       94216      48930558
EST182       90761      39418530
EST183       91213      38804975
EST184       75935      37760365
EST185       65899      44540522
EST186       68713      39139717
EST187       62237      42257867
EST188       68357      32214061
EST189       75203      28674313
EST19        78531      31812366
EST190       70677      45254842
EST191       82024      41084743
EST192       63497      32660238
EST193       67200      43729823
EST194       68129      50247115
EST195       70082      36613601
EST196       66502      40209939
EST197       70257      57082699
EST198       67355      34981457
EST199       72613      36499028
EST2         74651      28647346
EST20        74690      30659700
EST200       69115      57411827
EST201       67629      52508361
EST202       63670      46666396
EST203       63474      46719704
EST204       64484      46508606
EST205       64061      44700985
EST206       63664      48361258
EST207       63715      40377850
EST208       63250      34229940
EST209       64684      38193117
EST21        73816      34319040
EST210       81199      41915558
EST211       84362      55764444
EST212       67897      41387253
EST213       99199      61696533
EST214       107477     66256125
EST215       109209     63996044
EST216       105502     65921632
EST217       104452     64885127
EST218       111164     49229669
EST219       88466      51705650
EST22        75255      30169223
EST220       88816      46370338
EST221       92166      41872925
EST222       77752      49071801
EST223       66906      39640156
EST224       68032      53736978
EST225       68226      58637173
EST226       76116      50669393
EST227       80126      39296259
EST228       75965      52036303
EST229       71589      51479259
EST23        77342      32670021
EST230       65430      43435051
EST231       27800      10443916
EST232       27868      10458247
EST233       26873      9857595
EST234       26940      9554823
EST235       26686      9131223
EST236       27328      10170642
EST237       27196      9633970
EST238       27225      10001557
EST239       27223      11402735
EST24        74793      32884425
EST240       27171      11585759
EST241       27190      10707500
EST242       27515      9623451
EST243       27137      8813040
EST244       27448      10958808
EST245       27875      10813431
EST246       27551      11045591
EST247       26594      11598016
EST248       26820      11953154
EST249       27121      10654309
EST25        73911      31817129
EST250       26994      11218767
EST251       27052      11904040
EST252       27227      11390566
EST253       27276      10736008
EST254       27249      10901170
EST255       27110      10331997
EST256       26159      14434517
EST257       24910      16963255
EST258       25861      17633827
EST259       88119      36137691
EST26        75328      31130887
EST260       55221      34597662
EST261       91649      36332884
EST262       78546      39772421
EST263       68882      44474758
EST264       69214      44829329
EST265       69088      44283143
EST266       64703      40634664
EST267       79747      44213465
EST268       61970      41702052
EST269       69427      44302027
EST27        74517      32468002
EST270       59159      29630770
EST271       101821     47866509
EST272       86041      43549906
EST273       72209      39970465
EST274       62595      30159690
EST275       69994      41620758
EST276       71128      34914635
EST277       71690      33720362
EST278       71731      44732819
EST279       72417      39796684
EST28        108051     51161127
EST280       63915      38215238
EST281       72625      34398473
EST282       84932      46374905
EST283       71888      46828428
EST284       80282      54585353
EST285       95437      50698843
EST286       98762      46878542
EST287       77023      42906709
EST288       68909      46075316
EST289       75622      34681459
EST29        97076      45965629
EST290       70241      31548239
EST291       71880      33656556
EST292       66764      40303557
EST293       59802      37474393
EST294       66874      38395067
EST295       69015      44100400
EST296       60773      38689269
EST297       85095      43038545
EST298       79637      41393726
EST299       70810      43641081
EST3         73738      29918375
EST30        98317      53742147
EST300       98817      56100929
EST301       118283     49051778
EST302       91808      40792990
EST303       64265      35084558
EST304       71517      43953362
EST305       81755      43932900
EST306       72733      39077936
EST307       70247      44742370
EST308       69623      38694526
EST309       62602      36987884
EST31        83899      48580049
EST310       47636      24925354
EST311       72737      52642742
EST312       69994      39162626
EST313       73092      46832677
EST314       63161      34385236
EST315       70184      36209482
EST316       54637      27556928
EST317       54046      28023159
EST318       53183      28345612
EST319       52822      27811576
EST32        65450      46046822
EST320       52881      29681644
EST321       56707      23097110
EST322       56554      24587328
EST323       54769      22386672
EST324       55999      21995520
EST325       55338      21805243
EST326       57118      23164522
EST327       55642      21649705
EST328       56619      20727131
EST329       59572      25550034
EST33        72748      55093515
EST330       73948      40499822
EST331       74391      34083497
EST332       76201      31078877
EST333       74553      31755498
EST334       85874      50204141
EST335       73374      56272024
EST336       84216      53684410
EST337       92670      56495978
EST338       94285      55444211
EST339       101146     57550865
EST34        85391      48208538
EST340       98763      55050857
EST341       72489      38199211
EST342       68829      39148552
EST343       74127      44644395
EST344       61659      53754585
EST345       64573      46471548
EST346       62694      38165610
EST347       66381      41616641
EST348       71625      47650006
EST349       47818      24040380
EST35        86498      43990853
EST350       52495      26178803
EST351       75504      42255151
EST352       59417      30455186
EST353       60990      32829283
EST354       68132      43084071
EST355       82258      41449632
EST356       70757      41750043
EST357       68597      43923332
EST358       64974      37221072
EST359       68730      44755519
EST36        94962      51777929
EST360       87672      49104232
EST361       84568      50439491
EST362       74428      41180310
EST363       62452      36362016
EST364       69932      36919904
EST365       66961      35712465
EST366       47277      24131690
EST367       71330      40917619
EST368       72974      42684072
EST369       98856      46122159
EST37        84662      58978279
EST370       72856      48860501
EST371       69888      44634165
EST372       68190      43798277
EST373       64035      35021923
EST374       82092      37313944
EST375       75591      39085314
EST376       55446      39413493
EST377       60987      38669065
EST378       61699      39172500
EST379       92223      52328159
EST38        77072      53567983
EST380       83765      44798115
EST381       67094      44890656
EST382       76626      39293092
EST383       48396      30330125
EST384       44118      23118486
EST385       74025      48722196
EST386       80260      39780096
EST387       78279      47726925
EST388       76256      46365635
EST389       77611      47839473
EST39        90342      52994446
EST390       79398      51728416
EST391       84638      66541142
EST392       79422      67255552
EST393       83991      42961235
EST394       65412      38014919
EST395       61362      40530008
EST396       75397      39739346
EST397       53115      33189645
EST398       80535      29925525
EST399       81426      32726526
EST4         74568      28391284
EST40        63478      49870813
EST400       68461      42405778
EST401       64220      36370989
EST402       68482      36293905
EST403       73742      43457164
EST404       65322      45323651
EST405       64069      41228563
EST406       78696      46425313
EST407       57914      32892204
EST408       58576      36439878
EST409       83573      52714166
EST41        85084      49344409
EST410       83748      49052772
EST411       75240      42894733
EST412       58865      41139289
EST413       56881      40946625
EST414       57275      40550992
EST415       63969      39415978
EST416       75246      46050719
EST417       52159      32886221
EST418       61791      38993011
EST419       57912      40814563
EST42        102817     46990407
EST420       61454      41174646
EST421       55709      41976645
EST422       47046      33534092
EST423       92672      42347320
EST424       69432      38571581
EST425       69707      38339714
EST426       69867      38217905
EST427       69541      38780363
EST428       69608      38507842
EST429       69575      38727282
EST43        90558      45840115
EST430       68925      38388150
EST431       68932      38868919
EST432       69128      38699940
EST433       68251      37573814
EST434       67636      38653459
EST435       69349      39110631
EST436       69299      38198422
EST437       69445      38469521
EST438       69521      38048476
EST439       69863      38146528
EST44        99062      47878207
EST440       69691      38375422
EST441       69762      38283085
EST442       69938      37396428
EST443       82568      46925845
EST444       85389      44870056
EST445       80371      36615631
EST446       99177      57905927
EST447       79711      43901691
EST448       73728      47238794
EST449       83086      50020110
EST45        91456      35225693
EST450       92617      57441211
EST451       87120      51467528
EST452       81467      45990543
EST453       85676      47240371
EST454       69411      45608179
EST455       52199      40592728
EST456       66382      45801310
EST457       68127      38121030
EST458       63509      37854543
EST459       103196     53618408
EST46        68708      18231237
EST460       84999      50202000
EST461       87976      54229324
EST462       62709      43870324
EST463       43331      31133493
EST464       46912      58469898
EST465       62174      56637203
EST466       64722      42954225
EST467       73491      42061988
EST468       73787      42960013
EST469       68597      44111603
EST47        68709      18410735
EST470       66471      40210059
EST471       58764      51363551
EST472       106676     47363750
EST473       102781     48066020
EST474       68736      50632143
EST475       55246      39020332
EST476       57385      40114123
EST477       60982      40410981
EST478       62673      49547671
EST479       64765      45686522
EST48        63792      19511790
EST480       58537      40267539
EST481       51384      38724138
EST482       58917      40481172
EST483       59605      38961895
EST484       69796      40134094
EST485       61463      42018107
EST486       56915      38473798
EST487       62088      44991713
EST488       58409      45716182
EST489       64991      47658902
EST49        43715      11914104
EST490       60695      40937982
EST491       56546      40933615
EST492       51738      34423376
EST493       57020      39151600
EST494       56077      36753209
EST495       76564      42921275
EST496       61976      50048340
EST497       74131      56987676
EST498       78785      49823529
EST499       46993      55306985
EST5         48195      15293879
EST50        43330      11999872
EST500       52311      50449206
EST501       65858      54113622
EST502       59394      39160775
EST503       71793      38011793
EST504       84923      55358644
EST505       80568      53375059
EST506       74562      44186031
EST507       59474      39279230
EST508       71834      46047000
EST509       81651      50507452
EST51        43210      11439690
EST510       79471      54055122
EST511       71912      56515634
EST512       71578      50491248
EST513       66928      45262813
EST514       66344      51222445
EST515       62696      45460212
EST516       69849      44255267
EST517       78630      44803284
EST518       97008      43212026
EST519       122929     46253515
EST52        78012      31513960
EST520       87706      54749574
EST521       55429      49948518
EST522       56380      47734290
EST523       91974      21742468
EST524       99699      11057803
EST525       99489      12309584
EST526       94972      44567900
EST527       86991      31686420
EST528       86024      34879043
EST529       61363      63810102
EST53        90317      37120112
EST530       89850      56569381
EST531       82878      45755499
EST532       68616      42706392
EST533       72238      49448602
EST534       76104      48866537
EST535       89383      52515221
EST536       70917      51248888
EST537       69767      50075600
EST538       69506      52165559
EST539       81055      54590055
EST54        94504      42761893
EST540       86789      43715537
EST541       82652      47044815
EST542       83546      38702003
EST543       79252      41693384
EST544       79347      52027395
EST545       74657      56314673
EST546       69591      50239859
EST547       81545      44574406
EST548       102834     47524112
EST549       111393     48504354
EST55        92706      45885139
EST550       119340     50274588
EST551       132815     59646869
EST552       92589      53811082
EST553       80238      52521711
EST554       80558      23825338
EST555       84290      8750072
EST556       101415     43241802
EST557       122385     58645265
EST558       69611      44120556
EST559       63913      37824681
EST56        90119      43168594
EST560       74680      50315301
EST561       77240      46993819
EST562       71358      44288953
EST563       74762      46266083
EST564       68672      53365987
EST565       90554      54573913
EST566       97623      51714312
EST567       70034      36180838
EST568       63397      43780415
EST569       79170      53834462
EST57        101453     51294353
EST570       102278     60517101
EST571       75038      43567487
EST572       77654      41205881
EST573       72943      43261647
EST574       87499      46694956
EST575       85155      47291661
EST576       71006      52095449
EST577       85962      56681981
EST578       85456      55461864
EST579       85122      56619083
EST58        102133     52173490
EST580       80128      46639068
EST581       86446      52014541
EST582       74603      44849269
EST583       64081      43523472
EST584       63941      36064786
EST585       107443     34766018
EST586       53907      37045473
EST587       51396      31831320
EST588       51065      34369499
EST589       61687      42217679
EST59        75770      32884885
EST590       71785      46687019
EST591       64794      48017380
EST592       112282     18684593
EST593       118212     14553976
EST594       122584     11136388
EST595       122478     11298459
EST596       105101     22628161
EST597       65350      47524664
EST598       64166      48916401
EST599       81656      53423893
EST6         54921      17444667
EST60        66475      28729724
EST600       74060      48968987
EST601       68016      46871979
EST602       77799      44559821
EST603       64290      43643829
EST604       73986      39331957
EST605       76182      43065748
EST606       74095      47409180
EST607       69018      50827737
EST608       87986      51831215
EST609       79837      48977173
EST61        73166      32432882
EST610       65538      33882273
EST611       66841      41347699
EST612       97383      47030739
EST613       104735     54418664
EST614       62361      47992820
EST615       60783      48374380
EST616       69468      54237298
EST617       71328      30388753
EST618       89118      56374964
EST619       82086      49362422
EST62        70522      30078522
EST620       74475      48479685
EST621       71457      46982214
EST622       70429      51579956
EST623       91217      41333665
EST624       79214      26631244
EST625       79311      25035562
EST626       76998      29713777
EST627       78211      26733872
EST628       77916      29765941
EST629       78262      29246327
EST63        79947      32513484
EST630       77069      29147630
EST631       78317      27944614
EST632       78056      30410220
EST633       78395      29453226
EST634       80152      47109360
EST635       81845      60083098
EST636       81930      59825308
EST637       75250      44380199
EST638       62355      35170534
EST639       72211      44307967
EST64        76000      29892293
EST640       64501      44110224
EST641       58125      45749467
EST642       61763      44551705
EST643       74436      44915014
EST644       64290      40778834
EST645       87974      53915964
EST646       68632      42140791
EST647       66794      45594774
EST648       78088      49808928
EST649       74923      38182921
EST65        70866      28592376
EST650       68392      46618280
EST651       76799      51774803
EST652       59188      40949898
EST653       70083      50645820
EST654       71034      50094068
EST655       73508      46310541
EST656       69327      50002651
EST657       69654      46952390
EST658       77131      39084059
EST659       70502      31581515
EST66        65066      29750415
EST660       55591      33513663
EST661       66237      46917686
EST662       63720      40836662
EST663       66710      49079096
EST664       66923      44270476
EST665       58603      39032927
EST666       54462      37575830
EST667       64851      43299902
EST668       73095      32011547
EST669       71734      26058473
EST67        72924      32726306
EST670       73332      26619582
EST671       72652      26444506
EST672       78142      26267328
EST673       72416      28537912
EST674       69629      27938993
EST675       16827      5109862
EST68        79006      35298745
EST69        73493      29365895
EST7         74544      29357867
EST70        74317      25040002
EST71        86891      42258985
EST72        42449      12026824
EST73        40413      11115569
EST74        40382      12380472
EST75        40756      12578111
EST76        40780      12178330
EST77        40781      13219676
EST78        40623      12682417
EST79        40484      12353202
EST8         75833      30592306
EST80        40140      11913668
EST81        40793      12801383
EST82        41475      11693699
EST83        41013      13194942
EST84        40903      12758490
EST85        41892      13197137
EST86        45736      14358496
EST87        43253      27300417
EST88        42069      20308732
EST89        47120      18898581
EST9         77569      29868098
EST90        50735      23058095
EST91        51207      21243220
EST92        77514      45743596
EST93        77948      38679616
EST94        72709      28150376
EST95        75718      29166752
EST96        74255      38621833
EST97        76319      42166474
EST98        77440      44696418
EST99        75434      34798634
GSS1         81983      35151959
GSS10        66195      33932453
GSS100       77651      44534380
GSS101       66905      36320703
GSS102       75879      49287411
GSS103       65945      53300540
GSS104       76942      47935441
GSS105       73860      55218404
GSS106       77447      51016385
GSS107       76097      52374552
GSS108       80404      46466790
GSS109       74159      65447979
GSS11        68147      40182229
GSS110       72971      42910530
GSS111       67831      38668939
GSS112       66634      41704916
GSS113       66852      41155694
GSS114       66887      41067960
GSS115       66578      40870176
GSS116       66885      40037439
GSS117       69325      45250355
GSS118       76186      50769615
GSS119       75852      49644046
GSS12        65613      32971532
GSS120       74827      47115394
GSS121       74085      46096497
GSS122       76455      51525715
GSS123       72513      56620963
GSS124       80056      41242882
GSS125       85008      51894326
GSS126       69343      43023358
GSS127       76829      52311790
GSS128       79246      62651119
GSS129       72007      45934591
GSS13        64358      34440226
GSS130       69037      41458438
GSS131       77166      42628585
GSS132       85794      48407913
GSS133       76653      50652213
GSS134       77491      49395430
GSS135       76040      47555593
GSS136       69170      63294066
GSS137       69148      61745718
GSS138       72165      55287313
GSS139       68225      47503323
GSS14        68326      35714444
GSS140       65766      45814446
GSS141       66187      45046223
GSS142       66317      44892334
GSS143       65514      46270063
GSS144       67306      45384755
GSS145       76462      54381142
GSS146       74721      52408498
GSS147       68057      52665424
GSS148       57504      51347644
GSS149       70598      55363181
GSS15        67693      31132008
GSS150       68897      62943884
GSS151       69366      50633459
GSS152       69949      45528659
GSS153       81723      52126364
GSS154       86398      52382798
GSS155       84603      54733276
GSS156       73334      49044283
GSS157       83487      44485863
GSS158       64920      58856801
GSS159       97185      50356866
GSS16        65169      28830099
GSS160       105001     53332355
GSS161       89562      55490573
GSS162       71621      48299410
GSS163       41788      26326878
GSS164       63957      47336930
GSS165       66364      50807657
GSS166       66344      50841374
GSS167       66368      50799668
GSS168       66363      50807561
GSS169       66358      50816248
GSS17        69434      37703819
GSS170       66330      50865207
GSS171       70342      51616675
GSS172       68202      44544644
GSS173       77972      42388069
GSS174       82417      55918311
GSS175       74429      60644167
GSS176       84210      52322129
GSS177       83698      52182299
GSS178       75302      53785172
GSS179       69890      46506847
GSS18        66126      37729125
GSS180       66380      40953584
GSS181       82074      53498835
GSS182       86106      53405919
GSS183       77289      57558903
GSS184       77855      50762609
GSS185       108301     5607083
GSS186       81256      39569661
GSS187       71202      43093396
GSS188       74034      49014152
GSS189       48557      35316343
GSS19        62331      28672937
GSS190       46990      36251569
GSS191       57020      47760479
GSS192       53565      41634132
GSS193       52952      43015176
GSS194       52236      44442884
GSS195       52560      43420264
GSS196       53073      41839482
GSS197       53150      42293170
GSS198       53533      44193029
GSS199       53588      44024665
GSS2         83264      35168809
GSS20        51683      26279054
GSS200       53320      44851794
GSS201       52973      43993436
GSS202       53330      41809320
GSS203       53001      44175580
GSS204       54558      45993944
GSS205       54810      45262772
GSS206       54861      45133072
GSS207       54893      45038694
GSS208       54995      44729861
GSS209       55145      44277854
GSS21        51749      26109665
GSS210       54240      42562573
GSS211       53852      40991997
GSS212       53113      43316683
GSS213       53557      41928199
GSS214       53531      42008689
GSS215       53115      43312595
GSS216       52990      43700005
GSS217       53001      43667287
GSS218       53597      44818343
GSS219       54522      45881596
GSS22        52536      23986462
GSS220       54453      46087360
GSS221       54490      44298135
GSS222       55135      41668322
GSS223       54883      42454059
GSS224       53967      45282393
GSS225       54179      44635463
GSS226       54004      45168017
GSS227       54146      44735028
GSS228       54006      45160797
GSS229       54277      44336058
GSS23        55688      24577272
GSS230       54119      44818442
GSS231       54292      44290846
GSS232       54266      44372720
GSS233       54414      43919451
GSS234       53480      42040731
GSS235       53579      41609144
GSS236       53171      42993412
GSS237       52924      43855469
GSS238       53361      42484934
GSS239       52848      43156433
GSS24        59916      38118893
GSS240       54812      45539870
GSS241       58926      49790277
GSS242       59288      49602350
GSS243       94049      59064520
GSS244       73219      40734778
GSS245       71284      53789845
GSS246       80015      46008614
GSS247       37303      21093131
GSS248       86843      64232072
GSS249       83567      62773367
GSS25        52511      24049271
GSS250       103049     48153603
GSS251       68656      58536078
GSS252       68310      58771394
GSS253       69366      56632173
GSS254       69633      56114500
GSS255       70526      55524384
GSS256       85869      73170056
GSS257       86403      44923726
GSS258       88351      46874211
GSS259       85037      64836847
GSS26        55165      36701640
GSS260       70302      58968384
GSS261       69852      59875178
GSS262       63594      60939475
GSS263       81687      47122760
GSS264       87275      35467890
GSS265       107454     82038171
GSS266       105369     69703338
GSS267       84066      33990134
GSS268       119993     73845937
GSS269       120108     73738621
GSS27        67602      31709980
GSS270       116000     75274590
GSS271       94805      51419724
GSS272       87263      55387002
GSS273       98914      65322908
GSS274       107917     77918598
GSS275       107208     78806529
GSS276       105847     80265387
GSS277       97282      72838052
GSS278       83452      54605715
GSS279       110407     67138414
GSS28        53857      20521329
GSS280       110231     65983833
GSS281       104682     56504571
GSS282       75979      43261666
GSS283       106157     50660751
GSS284       89490      52485281
GSS285       95499      69068511
GSS286       95167      67698871
GSS287       95921      36514993
GSS288       95346      37391695
GSS289       96752      35028607
GSS29        52222      24831238
GSS290       94483      38835268
GSS291       90397      60592354
GSS292       83858      28362132
GSS293       84361      27393234
GSS294       85083      25930408
GSS295       38048      15215379
GSS3         79723      37808591
GSS30        69198      31935126
GSS31        50985      27997860
GSS32        76035      37623350
GSS33        74264      35981276
GSS34        67467      36695142
GSS35        63226      44686701
GSS36        71187      32537831
GSS37        70957      38269510
GSS38        68305      36937456
GSS39        73175      42393318
GSS4         73951      37730128
GSS40        79620      52901854
GSS41        79795      51468362
GSS42        77610      40744406
GSS43        76844      43510043
GSS44        80150      36131815
GSS45        75657      27231474
GSS46        73804      51843060
GSS47        73386      52491574
GSS48        67336      45936449
GSS49        65426      43236538
GSS5         70467      37700496
GSS50        65451      43183647
GSS51        72366      38885184
GSS52        73468      39890711
GSS53        75646      53233976
GSS54        78496      61372131
GSS55        74451      46645234
GSS56        85585      53336573
GSS57        80119      52192378
GSS58        71736      43456937
GSS59        64587      33100995
GSS6         70570      35428382
GSS60        79401      51956020
GSS61        77159      40082694
GSS62        77303      49177942
GSS63        65927      68850747
GSS64        64968      70288433
GSS65        81126      61617781
GSS66        80695      53521092
GSS67        57622      40620718
GSS68        58764      40554125
GSS69        78583      58194636
GSS7         70049      35131726
GSS70        81121      59763024
GSS71        74486      43686360
GSS72        79705      49453011
GSS73        78167      54088818
GSS74        87928      50147020
GSS75        88741      48053355
GSS76        88653      48169856
GSS77        89304      47307764
GSS78        90230      46080542
GSS79        89843      46593016
GSS8         70767      36261913
GSS80        90822      45297533
GSS81        90077      46282934
GSS82        89807      46640879
GSS83        86827      51637850
GSS84        81764      63331752
GSS85        81670      64342433
GSS86        80361      63454611
GSS87        79858      63319050
GSS88        79869      57505710
GSS89        80834      42279592
GSS9         68447      33994914
GSS90        71431      20463808
GSS91        70932      21729057
GSS92        79726      34903824
GSS93        76059      48440589
GSS94        71745      45740357
GSS95        80266      57337045
GSS96        72389      53491926
GSS97        70211      71278125
GSS98        70840      61228155
GSS99        78347      43037092
HTC1         24998      26954535
HTC10        64837      83565335
HTC11        68115      59261731
HTC12        47043      51551421
HTC2         15993      36013431
HTC3         15970      36547861
HTC4         16191      35357336
HTC5         15927      40313070
HTC6         16010      37271080
HTC7         51171      28266248
HTC8         81482      60687313
HTC9         76078      71560254
HTG1         1318       188929277
HTG10        1300       186477873
HTG100       1065       192917501
HTG101       1069       188606095
HTG102       1109       191115739
HTG103       1222       190789706
HTG104       1223       191185424
HTG105       554        64981448
HTG11        1437       184144251
HTG12        883        191839640
HTG13        751        192403068
HTG14        743        192211920
HTG15        782        192281135
HTG16        803        192110055
HTG17        768        192308108
HTG18        2056       171242738
HTG19        1050       187938699
HTG2         2465       186071856
HTG20        994        189114630
HTG21        782        191981791
HTG22        924        190472464
HTG23        903        190578787
HTG24        807        191448804
HTG25        779        191978670
HTG26        859        191431375
HTG27        888        190837083
HTG28        948        189921302
HTG29        897        191079664
HTG3         2517       185290576
HTG30        928        190561776
HTG31        874        191415178
HTG32        968        189678782
HTG33        878        191299128
HTG34        858        191420437
HTG35        827        192121978
HTG36        935        190219736
HTG37        937        190702812
HTG38        938        190431111
HTG39        1034       189392974
HTG4         2553       188532563
HTG40        1187       187278405
HTG41        1257       188042194
HTG42        1182       188260277
HTG43        1161       187443403
HTG44        1104       191559361
HTG45        1283       190867403
HTG46        1172       191011397
HTG47        1134       191211332
HTG48        1043       191199328
HTG49        937        189434429
HTG5         1284       185715991
HTG50        1057       189721601
HTG51        898        189812268
HTG52        1042       189635965
HTG53        925        189775649
HTG54        1016       189891442
HTG55        969        189685581
HTG56        980        189048792
HTG57        1089       188986461
HTG58        977        189426903
HTG59        1138       185779958
HTG6         1274       185234665
HTG60        1046       188905850
HTG61        1003       189162522
HTG62        995        188910299
HTG63        993        189022487
HTG64        1124       188781648
HTG65        1154       186958909
HTG66        1289       184461431
HTG67        1224       185501417
HTG68        1242       184714379
HTG69        1246       184699396
HTG7         1277       185414872
HTG70        1301       186874524
HTG71        1239       187602660
HTG72        1236       189547752
HTG73        1113       191097938
HTG74        1207       191673990
HTG75        1134       190928823
HTG76        1182       191203850
HTG77        1145       190989322
HTG78        1174       191040534
HTG79        1200       190562193
HTG8         1459       184762119
HTG80        1122       190733598
HTG81        1138       191169229
HTG82        1333       187234898
HTG83        1209       190995754
HTG84        1205       191389287
HTG85        1140       191570297
HTG86        1168       191717248
HTG87        1255       191212446
HTG88        1233       190005549
HTG89        1266       190268050
HTG9         1200       186999351
HTG90        1235       190606597
HTG91        1271       190543275
HTG92        1290       190656514
HTG93        1215       189532465
HTG94        1085       187740512
HTG95        1587       191238296
HTG96        1020       190945925
HTG97        820        175152469
HTG98        1021       189433020
HTG99        1098       192720184
INV1         42570      122957496
INV10        80660      72028508
INV11        17859      78656975
INV2         1686       181192694
INV3         1809       143813718
INV4         71174      80478925
INV5         60635      87780763
INV6         37823      107929782
INV7         81464      71437020
INV8         62686      86435548
INV9         83782      65808788
MAM1         15575      162089901
MAM2         69312      74815426
MAM3         54480      112793666
MAM4         14426      14251357
PAT1         222610     70141260
PAT10        125437     99518322
PAT11        141739     62608396
PAT12        105795     59941764
PAT13        103555     50226564
PAT14        121472     53274905
PAT15        113046     61292248
PAT16        145018     54899867
PAT17        155517     69893240
PAT18        97490      122598017
PAT19        147594     87373130
PAT2         194518     84655123
PAT20        117407     104542066
PAT21        123717     103465007
PAT22        119286     106149134
PAT23        140192     91319413
PAT24        203990     39164825
PAT25        101745     75139475
PAT26        95444      84263317
PAT27        116944     64735334
PAT28        96529      83259841
PAT29        115325     61768127
PAT3         171984     95898893
PAT30        134277     86432566
PAT31        147613     107609425
PAT32        160696     96227363
PAT33        253885     6347125
PAT34        77523      20246566
PAT4         153750     106059356
PAT5         184018     85619906
PAT6         156356     93378118
PAT7         152402     81705440
PAT8         104672     119401279
PAT9         143543     89226955
PHG          3557       26321507
PLN1         51965      101688989
PLN10        22478      121305330
PLN11        18520      152104786
PLN12        18259      152685278
PLN13        18259      152836371
PLN14        6845       158558270
PLN15        1201       171247635
PLN16        469        167649907
PLN17        6          176743046
PLN18        28549      121260884
PLN19        71821      73642969
PLN2         1463       168353876
PLN20        76675      77756882
PLN21        54841      91885489
PLN22        14060      143699427
PLN23        63706      84963142
PLN24        75110      78648641
PLN25        97976      55341897
PLN26        81407      77366514
PLN27        39829      70414992
PLN3         1647       182799929
PLN4         1896       182173398
PLN5         66467      88560089
PLN6         73895      78069079
PLN7         58026      58380266
PLN8         35567      58519332
PLN9         15145      141858453
PRI1         32832      118124368
PRI10        1458       182828344
PRI11        1275       179102729
PRI12        1455       178145178
PRI13        1589       179925322
PRI14        1605       182184488
PRI15        1269       192101792
PRI16        1138       193927573
PRI17        1102       194311498
PRI18        1351       193455703
PRI19        35825      131445235
PRI2         1635       172522504
PRI20        66924      87424025
PRI21        34154      89345003
PRI22        2643       181268061
PRI23        2190       184651140
PRI24        1642       185151077
PRI25        2079       185480807
PRI26        2125       183087291
PRI27        12231      161370579
PRI28        7648       166166850
PRI29        58073      89564865
PRI3         1308       183734483
PRI30        32774      64953410
PRI31        19222      128239167
PRI32        22330      146301005
PRI33        78291      74656969
PRI34        57038      95468019
PRI4         1343       185153158
PRI5         1196       181294625
PRI6         1186       178958872
PRI7         1236       181237397
PRI8         1316       175951021
PRI9         1244       175205631
ROD1         29177      145615235
ROD10        981        181670806
ROD11        1031       186063424
ROD12        953        183233103
ROD13        1030       188783740
ROD14        953        180699242
ROD15        965        182013459
ROD16        1006       186345373
ROD17        14501      167944868
ROD18        22603      148848395
ROD19        1166       187331422
ROD2         913        175073803
ROD20        1200       186358241
ROD21        22011      152390879
ROD22        34387      68266073
ROD23        11630      149544809
ROD24        42009      146264084
ROD25        134303     33644492
ROD26        18100      22308373
ROD3         913        173566113
ROD4         906        174168277
ROD5         929        174129383
ROD6         981        179748731
ROD7         957        179885830
ROD8         994        181944257
ROD9         1004       182728487
STS1         84256      36151809
STS10        57828      44845894
STS11        57929      43635614
STS12        64464      43031758
STS13        86552      36758497
STS14        71243      31200765
STS2         83993      48162362
STS3         69756      27454652
STS4         79049      37549640
STS5         54784      32171940
STS6         54866      31898275
STS7         54670      32202858
STS8         55682      35638370
STS9         57900      44451157
SYN1         50630      68517407
SYN2         5068       10456794
UNA          211        114018
VRL1         72055      65950088
VRL2         70802      64185386
VRL3         71177      65918787
VRL4         69548      67836593
VRL5         56632      73567476
VRL6         63295      71461952
VRL7         69207      67049737
VRL8         43330      42522341
VRT1         19731      162086473
VRT10        10440      178439784
VRT11        8659       179393039
VRT12        5006       185092070
VRT13        54924      108436774
VRT14        80615      69851879
VRT15        4979       5051039
VRT2         52076      116372797
VRT3         21692      154762215
VRT4         63705      93091331
VRT5         54696      65834167
VRT6         22983      110625187
VRT7         1217       191771171
VRT8         1268       191107555
VRT9         8286       179915066

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 163.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:

Entries        Bases   Species

11279087 12854169426   Homo sapiens
7228215   8323105071   Mus musculus
1305109   5778218766   Rattus norvegicus
2880831   4205748958   Zea mays
2057685   3845789573   Bos taurus
1584337   2832324577   Danio rerio
2121316   2304579871   Sus scrofa
227854    1352499678   Strongylocentrotus purpuratus
1418414   1136849350   Xenopus tropicalis
1130666   1005948286   Oryza sativa Japonica Group
212624     974669347   Pan troglodytes
738789     900252577   Drosophila melanogaster
1951847    881157707   Arabidopsis thaliana
802672     864709966   Gallus gallus
530099     838165327   Vitis vinifera
76348      784577143   Macaca mulatta
1221140    700538475   Canis lupus familiaris
1011784    660118364   Sorghum bicolor
1103658    656437787   Triticum aestivum
422523     536075160   Medicago truncatula

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 October 2007

                NCBI-GenBank Flat File Release 163.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 PROJECT Format

  This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
PROJECT     GenomeProject:18787

  A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second 
contains the actual project identifier ("18787").

  PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 163.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
	Andrea Gocke, Anjanette Johnston, Mark Landree,	Richard McVeigh,
	Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
	Gert Roosen, Susan Schafer, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko

Database Administration
	Slava Khotomliansky, Ben Slade, Angela Tirone

User Support
	Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
	Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
	Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
	David Wheeler 

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center