Release Notes For GenBank Release 164
GBREL.TXT Genetic Sequence Data Bank
February 15 2008
NCBI-GenBank Flat File Release 164.0
Distribution Release Notes
82853685 loci, 85759586764 bases, from 82853685 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 164.0
1.2 Cutoff Date
1.3 Important Changes in Release 164.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 164.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
E-MAIL: update@ncbi.nlm.nih.gov
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 164.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:
ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/ (Japan)
ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/ (Korea)
ftp://bio-mirror.sg.apan.net/biomirrors/genbank/ (Singapore)
1.2 Cutoff Date
This full release, 164.0, incorporates data available to the collaborating
databases as of February 12, 2008 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 164.0
1.3.1 Organizational changes
The total number of sequence data files increased by 10 with this release:
- the CON division is now comprised of 85 files (+1)
- the ENV division is now comprised of 8 files (+1)
- the HTC division is now comprised of 13 files (+1)
- the EST division is now comprised of 694 files (+19)
- the GSS division is now comprised of 277 files (-18) (see Note below)
- the HTG division is now comprised of 107 files (+2)
- the INV division is now comprised of 12 files (+1)
- the PAT division is now comprised of 35 files (+1)
- the PLN division is now comprised of 28 files (+1)
- the PRI division is now comprised of 35 files (+1)
The total number of index files increased by 2 with this release:
- the AUT (AUTHOR Name) index is now comprised of 50 files (+2)
NOTE:
A configuration setting that determines the average size for many
of the GSS division GenBank flatfiles was mistakenly changed for
Release 163.0. This resulted in a filesize decrease for a large
number of GSS flatfiles, from 230 MB to 210 MB. Consequently, the
total number of GSS flatfiles underwent an artificially-large
increase of 26 files.
The configuration setting was restored for GenBank Release 164.0.
As as a result, there is now an apparent net decrease of 18 GSS files.
Our apologies for any confusion that this may have caused.
1.3.2 Divisional protein FASTA files now available
Individual protein FASTA data files are now being made available for
GenBank releases, in the ASN.1 area of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/protein_fasta
Each protein FASTA file reflects the protein data content of the ASN.1
data file bearing the same division code in its name. For example, these
two "pri12" divisional files:
gbpri12.aso.gz
gbpri12.fsa_aa.gz
are 'equivalent', in that the proteins annotated on the DNA sequences
of gbpri12.aso are all present in gbpri12.fsa_aa.gz . For further
information, please see this README:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/protein_fasta/README.protein_fasta
These divisional files are a replacement (see Section 1.4.2) for the single
protein FASTA file that has been provided in conjunction with GenBank releases:
ftp://ftp.ncbi.nih.gov/genbank/relNNN.fsa_aa.gz
where 'NNN' represents a three-digit GenBank release number.
1.3.3 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
info@ncbi.nlm.nih.gov
Our apologies for any inconvenience that these changes may cause.
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
fifty-one of the GSS flatfiles in Release 164.0. Consider gbgss227.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
February 15 2008
NCBI-GenBank Flat File Release 164.0
GSS Sequences (Part 1)
86927 loci, 64285938 bases, from 86927 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "227" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New GenBank TSA division: Transcriptome Shotgun Assembly
A new GenBank division for assembled mRNA sequences, Transcriptome Shotgun
Assembly (TSA), will be included in GenBank releases on or after Release 165.0
in April of 2008.
Files in this new division will have filenames of:
gbtsaNN.aso.gz (ASN.1 format)
gbtsaNN.seq.gz (GenBank flatfile format)
where 'NN' represents an integer file-number within the TSA division.
TSA sequences are shotgun assemblies of primary sequences deposited in
dbEST, the Trace Archive (TA) or the Short-Read Archive (SRA). Keywords
"TSA" and "Transcriptome Shotgun Assembly" will be present for all TSA
records, in addition to a division code value of "TSA" on the LOCUS line.
No format changes (new or changed line types, features, or qualifiers)
are anticipated for this new class of GenBank record.
TSA records make use of the same PRIMARY block that is utilized for
Third-Party Annotation (TPA) records. The PRIMARY block will contain
references to the underlying reads/transcripts that were assembled to
construct the TSA record.
It might be helpful to review Third Party Annotation record BK005658,
which provides a good example of PRIMARY block usage:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/viewer.fcgi?db=nuccore&id=83843278
Requirements for the new Transcriptome Shotgun Assembly division include:
1. Submission of primary transcipt sequence data to dbEST, the Trace Archive,
or the Short-Read archive (SRA).
2. Registration of an associated transcriptome project with the International
Nucleotide Sequence Database Collaboration (INSDC).
For information about submitting projects via NCBI/GenBank, see:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/genomes/mpfsubmission.cgi
3. Submission of TSA sequence records to GenBank, including an assembly file
(.ace format)
Note that TSA records and the primary transcript sequences that they are
built from must be provided by the same submitter or collaborative group.
Examples of TSA records and more information about how to submit them
will be provided in future editions of these release notes, and via the
GenBank newsgroup.
1.4.2 Comprehensive protein FASTA file to be discontinued
With the availability of divisional protein FASTA files as of GenBank
Release 164.0, support for the single, large, comprehensive protein FASTA
file:
ftp://ftp.ncbi.nih.gov/genbank/relNNN.fsa_aa.gz
(where 'NNN' represents a three-digit GenBank release number) will be
discontinued after GenBank Release 166.0 in June of 2008. The size
of this file has grown to exceed 4GB, which is unmanageable for many users.
Users are advised to make plans to utilize the new divisional files by
August of 2008. If this timetable poses problems, please let us know at the
NCBI Service Desk:
info@ncbi.nlm.nih.gov
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1461 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut6.idx - Index of the entries according to author name, part 6.
51. gbaut7.idx - Index of the entries according to author name, part 7.
52. gbaut8.idx - Index of the entries according to author name, part 8.
53. gbaut9.idx - Index of the entries according to author name, part 9.
54. gbbct1.seq - Bacterial sequence entries, part 1.
55. gbbct10.seq - Bacterial sequence entries, part 10.
56. gbbct11.seq - Bacterial sequence entries, part 11.
57. gbbct12.seq - Bacterial sequence entries, part 12.
58. gbbct13.seq - Bacterial sequence entries, part 13.
59. gbbct14.seq - Bacterial sequence entries, part 14.
60. gbbct15.seq - Bacterial sequence entries, part 15.
61. gbbct16.seq - Bacterial sequence entries, part 16.
62. gbbct17.seq - Bacterial sequence entries, part 17.
63. gbbct18.seq - Bacterial sequence entries, part 18.
64. gbbct19.seq - Bacterial sequence entries, part 19.
65. gbbct2.seq - Bacterial sequence entries, part 2.
66. gbbct20.seq - Bacterial sequence entries, part 20.
67. gbbct21.seq - Bacterial sequence entries, part 21.
68. gbbct22.seq - Bacterial sequence entries, part 22.
69. gbbct23.seq - Bacterial sequence entries, part 23.
70. gbbct24.seq - Bacterial sequence entries, part 24.
71. gbbct25.seq - Bacterial sequence entries, part 25.
72. gbbct26.seq - Bacterial sequence entries, part 26.
73. gbbct3.seq - Bacterial sequence entries, part 3.
74. gbbct4.seq - Bacterial sequence entries, part 4.
75. gbbct5.seq - Bacterial sequence entries, part 5.
76. gbbct6.seq - Bacterial sequence entries, part 6.
77. gbbct7.seq - Bacterial sequence entries, part 7.
78. gbbct8.seq - Bacterial sequence entries, part 8.
79. gbbct9.seq - Bacterial sequence entries, part 9.
80. gbchg.txt - Accession numbers of entries updated since the previous release.
81. gbcon1.seq - Constructed sequence entries, part 1.
82. gbcon10.seq - Constructed sequence entries, part 10.
83. gbcon11.seq - Constructed sequence entries, part 11.
84. gbcon12.seq - Constructed sequence entries, part 12.
85. gbcon13.seq - Constructed sequence entries, part 13.
86. gbcon14.seq - Constructed sequence entries, part 14.
87. gbcon15.seq - Constructed sequence entries, part 15.
88. gbcon16.seq - Constructed sequence entries, part 16.
89. gbcon17.seq - Constructed sequence entries, part 17.
90. gbcon18.seq - Constructed sequence entries, part 18.
91. gbcon19.seq - Constructed sequence entries, part 19.
92. gbcon2.seq - Constructed sequence entries, part 2.
93. gbcon20.seq - Constructed sequence entries, part 20.
94. gbcon21.seq - Constructed sequence entries, part 21.
95. gbcon22.seq - Constructed sequence entries, part 22.
96. gbcon23.seq - Constructed sequence entries, part 23.
97. gbcon24.seq - Constructed sequence entries, part 24.
98. gbcon25.seq - Constructed sequence entries, part 25.
99. gbcon26.seq - Constructed sequence entries, part 26.
100. gbcon27.seq - Constructed sequence entries, part 27.
101. gbcon28.seq - Constructed sequence entries, part 28.
102. gbcon29.seq - Constructed sequence entries, part 29.
103. gbcon3.seq - Constructed sequence entries, part 3.
104. gbcon30.seq - Constructed sequence entries, part 30.
105. gbcon31.seq - Constructed sequence entries, part 31.
106. gbcon32.seq - Constructed sequence entries, part 32.
107. gbcon33.seq - Constructed sequence entries, part 33.
108. gbcon34.seq - Constructed sequence entries, part 34.
109. gbcon35.seq - Constructed sequence entries, part 35.
110. gbcon36.seq - Constructed sequence entries, part 36.
111. gbcon37.seq - Constructed sequence entries, part 37.
112. gbcon38.seq - Constructed sequence entries, part 38.
113. gbcon39.seq - Constructed sequence entries, part 39.
114. gbcon4.seq - Constructed sequence entries, part 4.
115. gbcon40.seq - Constructed sequence entries, part 40.
116. gbcon41.seq - Constructed sequence entries, part 41.
117. gbcon42.seq - Constructed sequence entries, part 42.
118. gbcon43.seq - Constructed sequence entries, part 43.
119. gbcon44.seq - Constructed sequence entries, part 44.
120. gbcon45.seq - Constructed sequence entries, part 45.
121. gbcon46.seq - Constructed sequence entries, part 46.
122. gbcon47.seq - Constructed sequence entries, part 47.
123. gbcon48.seq - Constructed sequence entries, part 48.
124. gbcon49.seq - Constructed sequence entries, part 49.
125. gbcon5.seq - Constructed sequence entries, part 5.
126. gbcon50.seq - Constructed sequence entries, part 50.
127. gbcon51.seq - Constructed sequence entries, part 51.
128. gbcon52.seq - Constructed sequence entries, part 52.
129. gbcon53.seq - Constructed sequence entries, part 53.
130. gbcon54.seq - Constructed sequence entries, part 54.
131. gbcon55.seq - Constructed sequence entries, part 55.
132. gbcon56.seq - Constructed sequence entries, part 56.
133. gbcon57.seq - Constructed sequence entries, part 57.
134. gbcon58.seq - Constructed sequence entries, part 58.
135. gbcon59.seq - Constructed sequence entries, part 59.
136. gbcon6.seq - Constructed sequence entries, part 6.
137. gbcon60.seq - Constructed sequence entries, part 60.
138. gbcon61.seq - Constructed sequence entries, part 61.
139. gbcon62.seq - Constructed sequence entries, part 62.
140. gbcon63.seq - Constructed sequence entries, part 63.
141. gbcon64.seq - Constructed sequence entries, part 64.
142. gbcon65.seq - Constructed sequence entries, part 65.
143. gbcon66.seq - Constructed sequence entries, part 66.
144. gbcon67.seq - Constructed sequence entries, part 67.
145. gbcon68.seq - Constructed sequence entries, part 68.
146. gbcon69.seq - Constructed sequence entries, part 69.
147. gbcon7.seq - Constructed sequence entries, part 7.
148. gbcon70.seq - Constructed sequence entries, part 70.
149. gbcon71.seq - Constructed sequence entries, part 71.
150. gbcon72.seq - Constructed sequence entries, part 72.
151. gbcon73.seq - Constructed sequence entries, part 73.
152. gbcon74.seq - Constructed sequence entries, part 74.
153. gbcon75.seq - Constructed sequence entries, part 75.
154. gbcon76.seq - Constructed sequence entries, part 76.
155. gbcon77.seq - Constructed sequence entries, part 77.
156. gbcon78.seq - Constructed sequence entries, part 78.
157. gbcon79.seq - Constructed sequence entries, part 79.
158. gbcon8.seq - Constructed sequence entries, part 8.
159. gbcon80.seq - Constructed sequence entries, part 80.
160. gbcon81.seq - Constructed sequence entries, part 81.
161. gbcon82.seq - Constructed sequence entries, part 82.
162. gbcon83.seq - Constructed sequence entries, part 83.
163. gbcon84.seq - Constructed sequence entries, part 84.
164. gbcon85.seq - Constructed sequence entries, part 85.
165. gbcon9.seq - Constructed sequence entries, part 9.
166. gbdel.txt - Accession numbers of entries deleted since the previous release.
167. gbenv1.seq - Environmental sampling sequence entries, part 1.
168. gbenv2.seq - Environmental sampling sequence entries, part 2.
169. gbenv3.seq - Environmental sampling sequence entries, part 3.
170. gbenv4.seq - Environmental sampling sequence entries, part 4.
171. gbenv5.seq - Environmental sampling sequence entries, part 5.
172. gbenv6.seq - Environmental sampling sequence entries, part 6.
173. gbenv7.seq - Environmental sampling sequence entries, part 7.
174. gbenv8.seq - Environmental sampling sequence entries, part 8.
175. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
176. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
177. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
178. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
179. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
180. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
181. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
182. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
183. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
184. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
185. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
186. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
187. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
188. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
189. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
190. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
191. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
192. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
193. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
194. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
195. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
196. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
197. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
198. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
199. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
200. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
201. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
202. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
203. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
204. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
205. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
206. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
207. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
208. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
209. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
210. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
211. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
212. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
213. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
214. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
215. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
216. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
217. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
218. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
219. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
220. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
221. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
222. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
223. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
224. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
225. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
226. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
227. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
228. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
229. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
230. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
231. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
232. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
233. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
234. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
235. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
236. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
237. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
238. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
239. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
240. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
241. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
242. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
243. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
244. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
245. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
246. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
247. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
248. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
249. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
250. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
251. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
252. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
253. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
254. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
255. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
256. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
257. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
258. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
259. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
260. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
261. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
262. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
263. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
264. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
265. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
266. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
267. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
268. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
269. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
270. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
271. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
272. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
273. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
274. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
275. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
276. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
277. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
278. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
279. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
280. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
281. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
282. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
283. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
284. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
285. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
286. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
287. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
288. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
289. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
290. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
291. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
292. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
293. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
294. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
295. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
296. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
297. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
298. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
299. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
300. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
301. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
302. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
303. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
304. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
305. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
306. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
307. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
308. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
309. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
310. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
311. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
312. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
313. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
314. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
315. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
316. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
317. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
318. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
319. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
320. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
321. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
322. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
323. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
324. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
325. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
326. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
327. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
328. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
329. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
330. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
331. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
332. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
333. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
334. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
335. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
336. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
337. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
338. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
339. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
340. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
341. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
342. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
343. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
344. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
345. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
346. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
347. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
348. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
349. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
350. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
351. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
352. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
353. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
354. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
355. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
356. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
357. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
358. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
359. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
360. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
361. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
362. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
363. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
364. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
365. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
366. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
367. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
368. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
369. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
370. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
371. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
372. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
373. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
374. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
375. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
376. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
377. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
378. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
379. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
380. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
381. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
382. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
383. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
384. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
385. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
386. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
387. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
388. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
389. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
390. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
391. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
392. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
393. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
394. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
395. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
396. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
397. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
398. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
399. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
400. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
401. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
402. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
403. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
404. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
405. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
406. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
407. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
408. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
409. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
410. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
411. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
412. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
413. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
414. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
415. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
416. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
417. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
418. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
419. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
420. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
421. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
422. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
423. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
424. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
425. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
426. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
427. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
428. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
429. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
430. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
431. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
432. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
433. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
434. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
435. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
436. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
437. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
438. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
439. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
440. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
441. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
442. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
443. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
444. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
445. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
446. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
447. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
448. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
449. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
450. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
451. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
452. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
453. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
454. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
455. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
456. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
457. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
458. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
459. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
460. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
461. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
462. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
463. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
464. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
465. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
466. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
467. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
468. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
469. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
470. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
471. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
472. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
473. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
474. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
475. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
476. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
477. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
478. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
479. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
480. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
481. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
482. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
483. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
484. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
485. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
486. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
487. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
488. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
489. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
490. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
491. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
492. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
493. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
494. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
495. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
496. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
497. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
498. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
499. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
500. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
501. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
502. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
503. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
504. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
505. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
506. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
507. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
508. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
509. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
510. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
511. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
512. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
513. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
514. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
515. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
516. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
517. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
518. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
519. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
520. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
521. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
522. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
523. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
524. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
525. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
526. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
527. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
528. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
529. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
530. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
531. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
532. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
533. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
534. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
535. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
536. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
537. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
538. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
539. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
540. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
541. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
542. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
543. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
544. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
545. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
546. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
547. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
548. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
549. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
550. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
551. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
552. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
553. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
554. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
555. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
556. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
557. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
558. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
559. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
560. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
561. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
562. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
563. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
564. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
565. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
566. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
567. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
568. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
569. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
570. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
571. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
572. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
573. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
574. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
575. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
576. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
577. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
578. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
579. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
580. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
581. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
582. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
583. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
584. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
585. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
586. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
587. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
588. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
589. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
590. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
591. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
592. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
593. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
594. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
595. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
596. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
597. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
598. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
599. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
600. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
601. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
602. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
603. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
604. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
605. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
606. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
607. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
608. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
609. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
610. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
611. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
612. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
613. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
614. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
615. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
616. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
617. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
618. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
619. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
620. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
621. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
622. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
623. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
624. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
625. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
626. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
627. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
628. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
629. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
630. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
631. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
632. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
633. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
634. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
635. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
636. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
637. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
638. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
639. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
640. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
641. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
642. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
643. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
644. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
645. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
646. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
647. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
648. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
649. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
650. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
651. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
652. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
653. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
654. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
655. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
656. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
657. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
658. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
659. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
660. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
661. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
662. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
663. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
664. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
665. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
666. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
667. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
668. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
669. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
670. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
671. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
672. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
673. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
674. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
675. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
676. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
677. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
678. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
679. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
680. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
681. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
682. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
683. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
684. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
685. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
686. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
687. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
688. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
689. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
690. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
691. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
692. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
693. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
694. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
695. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
696. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
697. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
698. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
699. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
700. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
701. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
702. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
703. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
704. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
705. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
706. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
707. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
708. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
709. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
710. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
711. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
712. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
713. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
714. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
715. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
716. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
717. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
718. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
719. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
720. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
721. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
722. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
723. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
724. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
725. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
726. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
727. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
728. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
729. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
730. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
731. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
732. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
733. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
734. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
735. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
736. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
737. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
738. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
739. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
740. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
741. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
742. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
743. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
744. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
745. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
746. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
747. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
748. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
749. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
750. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
751. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
752. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
753. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
754. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
755. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
756. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
757. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
758. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
759. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
760. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
761. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
762. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
763. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
764. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
765. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
766. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
767. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
768. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
769. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
770. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
771. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
772. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
773. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
774. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
775. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
776. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
777. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
778. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
779. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
780. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
781. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
782. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
783. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
784. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
785. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
786. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
787. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
788. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
789. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
790. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
791. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
792. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
793. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
794. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
795. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
796. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
797. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
798. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
799. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
800. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
801. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
802. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
803. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
804. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
805. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
806. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
807. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
808. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
809. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
810. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
811. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
812. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
813. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
814. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
815. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
816. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
817. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
818. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
819. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
820. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
821. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
822. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
823. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
824. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
825. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
826. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
827. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
828. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
829. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
830. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
831. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
832. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
833. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
834. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
835. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
836. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
837. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
838. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
839. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
840. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
841. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
842. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
843. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
844. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
845. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
846. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
847. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
848. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
849. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
850. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
851. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
852. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
853. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
854. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
855. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
856. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
857. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
858. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
859. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
860. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
861. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
862. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
863. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
864. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
865. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
866. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
867. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
868. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
869. gbgen.idx - Index of the entries according to gene symbols.
870. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
871. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
872. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
873. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
874. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
875. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
876. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
877. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
878. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
879. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
880. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
881. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
882. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
883. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
884. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
885. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
886. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
887. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
888. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
889. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
890. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
891. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
892. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
893. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
894. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
895. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
896. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
897. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
898. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
899. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
900. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
901. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
902. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
903. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
904. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
905. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
906. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
907. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
908. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
909. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
910. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
911. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
912. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
913. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
914. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
915. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
916. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
917. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
918. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
919. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
920. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
921. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
922. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
923. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
924. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
925. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
926. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
927. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
928. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
929. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
930. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
931. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
932. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
933. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
934. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
935. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
936. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
937. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
938. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
939. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
940. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
941. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
942. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
943. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
944. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
945. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
946. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
947. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
948. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
949. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
950. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
951. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
952. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
953. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
954. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
955. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
956. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
957. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
958. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
959. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
960. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
961. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
962. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
963. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
964. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
965. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
966. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
967. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
968. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
969. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
970. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
971. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
972. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
973. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
974. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
975. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
976. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
977. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
978. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
979. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
980. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
981. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
982. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
983. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
984. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
985. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
986. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
987. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
988. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
989. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
990. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
991. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
992. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
993. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
994. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
995. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
996. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
997. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
998. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
999. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1000. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1001. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1002. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1003. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1004. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1005. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1006. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1007. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1008. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1009. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1010. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1011. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1012. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1013. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1014. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1015. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1016. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1017. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1018. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1019. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1020. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1021. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1022. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1023. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1024. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1025. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1026. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1027. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1028. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1029. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1030. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1031. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1032. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1033. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1034. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1035. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1036. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1037. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1038. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1039. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1040. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1041. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1042. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1043. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1044. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1045. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1046. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1047. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1048. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1049. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1050. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1051. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1052. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1053. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1054. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1055. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1056. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1057. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1058. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1059. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1060. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1061. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1062. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1063. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1064. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1065. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1066. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1067. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1068. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1069. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1070. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1071. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1072. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1073. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1074. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1075. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1076. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1077. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1078. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1079. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1080. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1081. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1082. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1083. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1084. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1085. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1086. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1087. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1088. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1089. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1090. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1091. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1092. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1093. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1094. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1095. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1096. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1097. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1098. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1099. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1100. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1101. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1102. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1103. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1104. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1105. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1106. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1107. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1108. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1109. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1110. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1111. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1112. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1113. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1114. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1115. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1116. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1117. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1118. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1119. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1120. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1121. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1122. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1123. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1124. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1125. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1126. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1127. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1128. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1129. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1130. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1131. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1132. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1133. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1134. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1135. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1136. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1137. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1138. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1139. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1140. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1141. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1142. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1143. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1144. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1145. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1146. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1147. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1148. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1149. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1150. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1151. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1152. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1153. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1154. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1155. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1156. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1157. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1158. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1159. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1160. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1161. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1162. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1163. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1164. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1165. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1166. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1167. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1168. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1169. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1170. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1171. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1172. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1173. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1174. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1175. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1176. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1177. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1178. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1179. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1180. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1181. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1182. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1183. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1184. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1185. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1186. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1187. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1188. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1189. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1190. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1191. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1192. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1193. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1194. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1195. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1196. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1197. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1198. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1199. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1200. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1201. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1202. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1203. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1204. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1205. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1206. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1207. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1208. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1209. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1210. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1211. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1212. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1213. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1214. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1215. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1216. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1217. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1218. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1219. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1220. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1221. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1222. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1223. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1224. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1225. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1226. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1227. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1228. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1229. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1230. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1231. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1232. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1233. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1234. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1235. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1236. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1237. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1238. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1239. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1240. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1241. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1242. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1243. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1244. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1245. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1246. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1247. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1248. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1249. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1250. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1251. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1252. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1253. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1254. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1255. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1256. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1257. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1258. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1259. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1260. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1261. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1262. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1263. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1264. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1265. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1266. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1267. gbinv1.seq - Invertebrate sequence entries, part 1.
1268. gbinv10.seq - Invertebrate sequence entries, part 10.
1269. gbinv11.seq - Invertebrate sequence entries, part 11.
1270. gbinv12.seq - Invertebrate sequence entries, part 12.
1271. gbinv2.seq - Invertebrate sequence entries, part 2.
1272. gbinv3.seq - Invertebrate sequence entries, part 3.
1273. gbinv4.seq - Invertebrate sequence entries, part 4.
1274. gbinv5.seq - Invertebrate sequence entries, part 5.
1275. gbinv6.seq - Invertebrate sequence entries, part 6.
1276. gbinv7.seq - Invertebrate sequence entries, part 7.
1277. gbinv8.seq - Invertebrate sequence entries, part 8.
1278. gbinv9.seq - Invertebrate sequence entries, part 9.
1279. gbjou1.idx - Index of the entries according to journal citation, part 1.
1280. gbjou2.idx - Index of the entries according to journal citation, part 2.
1281. gbjou3.idx - Index of the entries according to journal citation, part 3.
1282. gbjou4.idx - Index of the entries according to journal citation, part 4.
1283. gbjou5.idx - Index of the entries according to journal citation, part 5.
1284. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1285. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1286. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1287. gbmam1.seq - Other mammalian sequence entries, part 1.
1288. gbmam2.seq - Other mammalian sequence entries, part 2.
1289. gbmam3.seq - Other mammalian sequence entries, part 3.
1290. gbmam4.seq - Other mammalian sequence entries, part 4.
1291. gbnew.txt - Accession numbers of entries new since the previous release.
1292. gbpat1.seq - Patent sequence entries, part 1.
1293. gbpat10.seq - Patent sequence entries, part 10.
1294. gbpat11.seq - Patent sequence entries, part 11.
1295. gbpat12.seq - Patent sequence entries, part 12.
1296. gbpat13.seq - Patent sequence entries, part 13.
1297. gbpat14.seq - Patent sequence entries, part 14.
1298. gbpat15.seq - Patent sequence entries, part 15.
1299. gbpat16.seq - Patent sequence entries, part 16.
1300. gbpat17.seq - Patent sequence entries, part 17.
1301. gbpat18.seq - Patent sequence entries, part 18.
1302. gbpat19.seq - Patent sequence entries, part 19.
1303. gbpat2.seq - Patent sequence entries, part 2.
1304. gbpat20.seq - Patent sequence entries, part 20.
1305. gbpat21.seq - Patent sequence entries, part 21.
1306. gbpat22.seq - Patent sequence entries, part 22.
1307. gbpat23.seq - Patent sequence entries, part 23.
1308. gbpat24.seq - Patent sequence entries, part 24.
1309. gbpat25.seq - Patent sequence entries, part 25.
1310. gbpat26.seq - Patent sequence entries, part 26.
1311. gbpat27.seq - Patent sequence entries, part 27.
1312. gbpat28.seq - Patent sequence entries, part 28.
1313. gbpat29.seq - Patent sequence entries, part 29.
1314. gbpat3.seq - Patent sequence entries, part 3.
1315. gbpat30.seq - Patent sequence entries, part 30.
1316. gbpat31.seq - Patent sequence entries, part 31.
1317. gbpat32.seq - Patent sequence entries, part 32.
1318. gbpat33.seq - Patent sequence entries, part 33.
1319. gbpat34.seq - Patent sequence entries, part 34.
1320. gbpat35.seq - Patent sequence entries, part 35.
1321. gbpat4.seq - Patent sequence entries, part 4.
1322. gbpat5.seq - Patent sequence entries, part 5.
1323. gbpat6.seq - Patent sequence entries, part 6.
1324. gbpat7.seq - Patent sequence entries, part 7.
1325. gbpat8.seq - Patent sequence entries, part 8.
1326. gbpat9.seq - Patent sequence entries, part 9.
1327. gbphg.seq - Phage sequence entries.
1328. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1329. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1330. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1331. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1332. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1333. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1334. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1335. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1336. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1337. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1338. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1339. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1340. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1341. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1342. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1343. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1344. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1345. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1346. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1347. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1348. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1349. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1350. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1351. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1352. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1353. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1354. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1355. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1356. gbpri1.seq - Primate sequence entries, part 1.
1357. gbpri10.seq - Primate sequence entries, part 10.
1358. gbpri11.seq - Primate sequence entries, part 11.
1359. gbpri12.seq - Primate sequence entries, part 12.
1360. gbpri13.seq - Primate sequence entries, part 13.
1361. gbpri14.seq - Primate sequence entries, part 14.
1362. gbpri15.seq - Primate sequence entries, part 15.
1363. gbpri16.seq - Primate sequence entries, part 16.
1364. gbpri17.seq - Primate sequence entries, part 17.
1365. gbpri18.seq - Primate sequence entries, part 18.
1366. gbpri19.seq - Primate sequence entries, part 19.
1367. gbpri2.seq - Primate sequence entries, part 2.
1368. gbpri20.seq - Primate sequence entries, part 20.
1369. gbpri21.seq - Primate sequence entries, part 21.
1370. gbpri22.seq - Primate sequence entries, part 22.
1371. gbpri23.seq - Primate sequence entries, part 23.
1372. gbpri24.seq - Primate sequence entries, part 24.
1373. gbpri25.seq - Primate sequence entries, part 25.
1374. gbpri26.seq - Primate sequence entries, part 26.
1375. gbpri27.seq - Primate sequence entries, part 27.
1376. gbpri28.seq - Primate sequence entries, part 28.
1377. gbpri29.seq - Primate sequence entries, part 29.
1378. gbpri3.seq - Primate sequence entries, part 3.
1379. gbpri30.seq - Primate sequence entries, part 30.
1380. gbpri31.seq - Primate sequence entries, part 31.
1381. gbpri32.seq - Primate sequence entries, part 32.
1382. gbpri33.seq - Primate sequence entries, part 33.
1383. gbpri34.seq - Primate sequence entries, part 34.
1384. gbpri35.seq - Primate sequence entries, part 35.
1385. gbpri4.seq - Primate sequence entries, part 4.
1386. gbpri5.seq - Primate sequence entries, part 5.
1387. gbpri6.seq - Primate sequence entries, part 6.
1388. gbpri7.seq - Primate sequence entries, part 7.
1389. gbpri8.seq - Primate sequence entries, part 8.
1390. gbpri9.seq - Primate sequence entries, part 9.
1391. gbrel.txt - Release notes (this document).
1392. gbrod1.seq - Rodent sequence entries, part 1.
1393. gbrod10.seq - Rodent sequence entries, part 10.
1394. gbrod11.seq - Rodent sequence entries, part 11.
1395. gbrod12.seq - Rodent sequence entries, part 12.
1396. gbrod13.seq - Rodent sequence entries, part 13.
1397. gbrod14.seq - Rodent sequence entries, part 14.
1398. gbrod15.seq - Rodent sequence entries, part 15.
1399. gbrod16.seq - Rodent sequence entries, part 16.
1400. gbrod17.seq - Rodent sequence entries, part 17.
1401. gbrod18.seq - Rodent sequence entries, part 18.
1402. gbrod19.seq - Rodent sequence entries, part 19.
1403. gbrod2.seq - Rodent sequence entries, part 2.
1404. gbrod20.seq - Rodent sequence entries, part 20.
1405. gbrod21.seq - Rodent sequence entries, part 21.
1406. gbrod22.seq - Rodent sequence entries, part 22.
1407. gbrod23.seq - Rodent sequence entries, part 23.
1408. gbrod24.seq - Rodent sequence entries, part 24.
1409. gbrod25.seq - Rodent sequence entries, part 25.
1410. gbrod26.seq - Rodent sequence entries, part 26.
1411. gbrod3.seq - Rodent sequence entries, part 3.
1412. gbrod4.seq - Rodent sequence entries, part 4.
1413. gbrod5.seq - Rodent sequence entries, part 5.
1414. gbrod6.seq - Rodent sequence entries, part 6.
1415. gbrod7.seq - Rodent sequence entries, part 7.
1416. gbrod8.seq - Rodent sequence entries, part 8.
1417. gbrod9.seq - Rodent sequence entries, part 9.
1418. gbsdr1.txt - Short directory of the data bank, part 1.
1419. gbsdr2.txt - Short directory of the data bank, part 2.
1420. gbsdr3.txt - Short directory of the data bank, part 3.
1421. gbsec.idx - Index of the entries according to secondary accession number.
1422. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1423. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1424. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1425. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1426. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1427. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1428. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1429. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1430. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1431. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1432. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1433. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1434. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1435. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1436. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1437. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1438. gbuna.seq - Unannotated sequence entries.
1439. gbvrl1.seq - Viral sequence entries, part 1.
1440. gbvrl2.seq - Viral sequence entries, part 2.
1441. gbvrl3.seq - Viral sequence entries, part 3.
1442. gbvrl4.seq - Viral sequence entries, part 4.
1443. gbvrl5.seq - Viral sequence entries, part 5.
1444. gbvrl6.seq - Viral sequence entries, part 6.
1445. gbvrl7.seq - Viral sequence entries, part 7.
1446. gbvrl8.seq - Viral sequence entries, part 8.
1447. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1448. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1449. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1450. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1451. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1452. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1453. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1454. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1455. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1456. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1457. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1458. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1459. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1460. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1461. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 164.0 flatfiles require roughly 321 GB (sequence
files only) or 342 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
654114756 gbacc1.idx
1647657141 gbacc2.idx
565209453 gbacc3.idx
184373931 gbaut1.idx
199965268 gbaut10.idx
253757127 gbaut11.idx
183982004 gbaut12.idx
184190909 gbaut13.idx
185504910 gbaut14.idx
183724287 gbaut15.idx
195915914 gbaut16.idx
184186337 gbaut17.idx
199942056 gbaut18.idx
200291396 gbaut19.idx
190717321 gbaut2.idx
227242805 gbaut20.idx
183818295 gbaut21.idx
184046229 gbaut22.idx
254918259 gbaut23.idx
199138651 gbaut24.idx
209659808 gbaut25.idx
188712338 gbaut26.idx
183606232 gbaut27.idx
189483993 gbaut28.idx
184805465 gbaut29.idx
219849231 gbaut3.idx
184725140 gbaut30.idx
194921574 gbaut31.idx
192772682 gbaut32.idx
192196136 gbaut33.idx
187269870 gbaut34.idx
205283833 gbaut35.idx
184416664 gbaut36.idx
185566615 gbaut37.idx
184036432 gbaut38.idx
188645366 gbaut39.idx
186979239 gbaut4.idx
183901233 gbaut40.idx
203257307 gbaut41.idx
196293776 gbaut42.idx
187288577 gbaut43.idx
184445224 gbaut44.idx
184383662 gbaut45.idx
183876207 gbaut46.idx
184239789 gbaut47.idx
232538700 gbaut48.idx
184036011 gbaut49.idx
183906758 gbaut5.idx
9968499 gbaut50.idx
184113665 gbaut6.idx
185441133 gbaut7.idx
253606779 gbaut8.idx
241355566 gbaut9.idx
253476909 gbbct1.seq
252444304 gbbct10.seq
251928735 gbbct11.seq
252628341 gbbct12.seq
254484815 gbbct13.seq
253576196 gbbct14.seq
262637436 gbbct15.seq
251937284 gbbct16.seq
250027573 gbbct17.seq
254387262 gbbct18.seq
252674640 gbbct19.seq
256810289 gbbct2.seq
251915170 gbbct20.seq
257092355 gbbct21.seq
264094279 gbbct22.seq
251854017 gbbct23.seq
250004102 gbbct24.seq
250044113 gbbct25.seq
232413579 gbbct26.seq
251984458 gbbct3.seq
250003088 gbbct4.seq
256231213 gbbct5.seq
258046253 gbbct6.seq
253270020 gbbct7.seq
250002977 gbbct8.seq
252688869 gbbct9.seq
27766908 gbchg.txt
250145885 gbcon1.seq
250000438 gbcon10.seq
250269252 gbcon11.seq
250001888 gbcon12.seq
250001660 gbcon13.seq
250001862 gbcon14.seq
250001796 gbcon15.seq
250006105 gbcon16.seq
250001483 gbcon17.seq
250036425 gbcon18.seq
250000536 gbcon19.seq
251081426 gbcon2.seq
250000061 gbcon20.seq
250000721 gbcon21.seq
250002510 gbcon22.seq
250000079 gbcon23.seq
250006161 gbcon24.seq
250002447 gbcon25.seq
250001082 gbcon26.seq
250002499 gbcon27.seq
250003170 gbcon28.seq
250000602 gbcon29.seq
250441911 gbcon3.seq
250002586 gbcon30.seq
250003252 gbcon31.seq
250001249 gbcon32.seq
250002067 gbcon33.seq
250003695 gbcon34.seq
250001005 gbcon35.seq
250004476 gbcon36.seq
250000510 gbcon37.seq
250003352 gbcon38.seq
250001235 gbcon39.seq
250000250 gbcon4.seq
250004546 gbcon40.seq
250000531 gbcon41.seq
250000674 gbcon42.seq
250002624 gbcon43.seq
250000189 gbcon44.seq
250003994 gbcon45.seq
250003038 gbcon46.seq
250003419 gbcon47.seq
250002345 gbcon48.seq
250004408 gbcon49.seq
250000045 gbcon5.seq
250004079 gbcon50.seq
250003481 gbcon51.seq
250004778 gbcon52.seq
250004431 gbcon53.seq
250001384 gbcon54.seq
250000999 gbcon55.seq
250000075 gbcon56.seq
250003580 gbcon57.seq
250001245 gbcon58.seq
250001492 gbcon59.seq
250001529 gbcon6.seq
250002271 gbcon60.seq
250003753 gbcon61.seq
250001471 gbcon62.seq
250005096 gbcon63.seq
250003978 gbcon64.seq
250002281 gbcon65.seq
250000535 gbcon66.seq
250003859 gbcon67.seq
250002161 gbcon68.seq
250000499 gbcon69.seq
250000437 gbcon7.seq
250001464 gbcon70.seq
250003279 gbcon71.seq
250000208 gbcon72.seq
250003734 gbcon73.seq
250006051 gbcon74.seq
250000836 gbcon75.seq
250002966 gbcon76.seq
250004082 gbcon77.seq
250004037 gbcon78.seq
250002474 gbcon79.seq
250000209 gbcon8.seq
250001216 gbcon80.seq
250004304 gbcon81.seq
250003015 gbcon82.seq
250007346 gbcon83.seq
65335463 gbcon84.seq
21362099 gbcon85.seq
250506544 gbcon9.seq
115479 gbdel.txt
250002984 gbenv1.seq
250001113 gbenv2.seq
250000063 gbenv3.seq
250000049 gbenv4.seq
250001388 gbenv5.seq
250000731 gbenv6.seq
250003238 gbenv7.seq
46401225 gbenv8.seq
230688948 gbest1.seq
230688875 gbest10.seq
230691322 gbest100.seq
230687716 gbest101.seq
230687965 gbest102.seq
230690349 gbest103.seq
230687652 gbest104.seq
230690733 gbest105.seq
230687673 gbest106.seq
230688733 gbest107.seq
230688833 gbest108.seq
230690852 gbest109.seq
230687781 gbest11.seq
230687792 gbest110.seq
230688388 gbest111.seq
230687559 gbest112.seq
230690423 gbest113.seq
230688907 gbest114.seq
230690045 gbest115.seq
230690384 gbest116.seq
230687930 gbest117.seq
230662921 gbest118.seq
230689381 gbest119.seq
230689451 gbest12.seq
230689674 gbest120.seq
230688951 gbest121.seq
230689754 gbest122.seq
230688211 gbest123.seq
230688604 gbest124.seq
230690458 gbest125.seq
230690526 gbest126.seq
230687621 gbest127.seq
230687480 gbest128.seq
230690628 gbest129.seq
230688456 gbest13.seq
230688662 gbest130.seq
230690113 gbest131.seq
230688974 gbest132.seq
230687732 gbest133.seq
230689988 gbest134.seq
230689449 gbest135.seq
230687956 gbest136.seq
230688774 gbest137.seq
230689864 gbest138.seq
230689576 gbest139.seq
230689402 gbest14.seq
230687907 gbest140.seq
230687864 gbest141.seq
230688818 gbest142.seq
230690939 gbest143.seq
230690243 gbest144.seq
230687503 gbest145.seq
230687567 gbest146.seq
230689030 gbest147.seq
230688304 gbest148.seq
230690948 gbest149.seq
230688027 gbest15.seq
230689630 gbest150.seq
230689467 gbest151.seq
230687795 gbest152.seq
230688493 gbest153.seq
230688400 gbest154.seq
230688786 gbest155.seq
230689352 gbest156.seq
230687898 gbest157.seq
230687743 gbest158.seq
230687758 gbest159.seq
230687951 gbest16.seq
230688896 gbest160.seq
230691670 gbest161.seq
230689321 gbest162.seq
230689569 gbest163.seq
230687789 gbest164.seq
230687873 gbest165.seq
230688285 gbest166.seq
230687798 gbest167.seq
230688206 gbest168.seq
230688455 gbest169.seq
230687939 gbest17.seq
230688080 gbest170.seq
230690028 gbest171.seq
230689001 gbest172.seq
230687460 gbest173.seq
230687753 gbest174.seq
230687928 gbest175.seq
230688321 gbest176.seq
230688187 gbest177.seq
230687715 gbest178.seq
218465522 gbest179.seq
230688574 gbest18.seq
230687588 gbest180.seq
230688833 gbest181.seq
230689129 gbest182.seq
230689833 gbest183.seq
230690065 gbest184.seq
230689075 gbest185.seq
230690485 gbest186.seq
230689107 gbest187.seq
230688117 gbest188.seq
230689157 gbest189.seq
230687737 gbest19.seq
230687683 gbest190.seq
230688440 gbest191.seq
230687680 gbest192.seq
230688735 gbest193.seq
230689462 gbest194.seq
230689712 gbest195.seq
230690159 gbest196.seq
230688898 gbest197.seq
230687942 gbest198.seq
230688824 gbest199.seq
230690014 gbest2.seq
230688202 gbest20.seq
230690743 gbest200.seq
230688430 gbest201.seq
230688906 gbest202.seq
230688094 gbest203.seq
230688130 gbest204.seq
230690451 gbest205.seq
230688593 gbest206.seq
230687551 gbest207.seq
230689269 gbest208.seq
230690266 gbest209.seq
230688406 gbest21.seq
230689896 gbest210.seq
230688331 gbest211.seq
230688632 gbest212.seq
230689112 gbest213.seq
230688658 gbest214.seq
230688588 gbest215.seq
230688636 gbest216.seq
230689085 gbest217.seq
230689128 gbest218.seq
230688902 gbest219.seq
230689768 gbest22.seq
230688108 gbest220.seq
230688793 gbest221.seq
230688515 gbest222.seq
230688472 gbest223.seq
230687625 gbest224.seq
230688015 gbest225.seq
230689427 gbest226.seq
230688436 gbest227.seq
230689434 gbest228.seq
175036443 gbest229.seq
230690442 gbest23.seq
161434425 gbest230.seq
163610292 gbest231.seq
170022348 gbest232.seq
168479469 gbest233.seq
162450121 gbest234.seq
163950319 gbest235.seq
163466724 gbest236.seq
163063453 gbest237.seq
163435699 gbest238.seq
162968299 gbest239.seq
230689389 gbest24.seq
163064499 gbest240.seq
161777046 gbest241.seq
167255967 gbest242.seq
161069995 gbest243.seq
162487940 gbest244.seq
167054269 gbest245.seq
166177491 gbest246.seq
164671318 gbest247.seq
164572808 gbest248.seq
164239066 gbest249.seq
230687453 gbest25.seq
163970167 gbest250.seq
163066074 gbest251.seq
163123674 gbest252.seq
164441304 gbest253.seq
166457708 gbest254.seq
179322951 gbest255.seq
169770725 gbest256.seq
207196797 gbest257.seq
230688536 gbest258.seq
230688124 gbest259.seq
230687989 gbest26.seq
230688154 gbest260.seq
230689058 gbest261.seq
230688015 gbest262.seq
230689168 gbest263.seq
230688960 gbest264.seq
230689181 gbest265.seq
230689401 gbest266.seq
230691189 gbest267.seq
230687801 gbest268.seq
230687630 gbest269.seq
230687477 gbest27.seq
230687479 gbest270.seq
230690718 gbest271.seq
230688023 gbest272.seq
230688307 gbest273.seq
230690861 gbest274.seq
230688568 gbest275.seq
230687632 gbest276.seq
230690545 gbest277.seq
230690832 gbest278.seq
230689557 gbest279.seq
230688073 gbest28.seq
230690411 gbest280.seq
230689630 gbest281.seq
230687507 gbest282.seq
230687947 gbest283.seq
230688609 gbest284.seq
230687871 gbest285.seq
230688624 gbest286.seq
230689630 gbest287.seq
216222646 gbest288.seq
220916564 gbest289.seq
230688053 gbest29.seq
230687596 gbest290.seq
230690587 gbest291.seq
230687571 gbest292.seq
230688000 gbest293.seq
230687900 gbest294.seq
230687476 gbest295.seq
230687824 gbest296.seq
230689532 gbest297.seq
230687768 gbest298.seq
230688528 gbest299.seq
230690086 gbest3.seq
230687805 gbest30.seq
230688004 gbest300.seq
230691044 gbest301.seq
230688665 gbest302.seq
230689497 gbest303.seq
230689023 gbest304.seq
230688868 gbest305.seq
230688693 gbest306.seq
230687955 gbest307.seq
230691671 gbest308.seq
230689863 gbest309.seq
230689945 gbest31.seq
230689334 gbest310.seq
230687531 gbest311.seq
230687918 gbest312.seq
229692618 gbest313.seq
230687610 gbest314.seq
230688167 gbest315.seq
230690925 gbest316.seq
230688430 gbest317.seq
230689157 gbest318.seq
230689604 gbest319.seq
230689985 gbest32.seq
230687946 gbest320.seq
230689821 gbest321.seq
230689955 gbest322.seq
230691085 gbest323.seq
230688411 gbest324.seq
230690287 gbest325.seq
230691193 gbest326.seq
230688581 gbest327.seq
230688290 gbest328.seq
230690032 gbest329.seq
230689078 gbest33.seq
230687631 gbest330.seq
230688659 gbest331.seq
230688181 gbest332.seq
230689180 gbest333.seq
230689005 gbest334.seq
230688713 gbest335.seq
230689703 gbest336.seq
230689272 gbest337.seq
230691588 gbest338.seq
221096857 gbest339.seq
230689714 gbest34.seq
220174857 gbest340.seq
230688732 gbest341.seq
230689619 gbest342.seq
230689157 gbest343.seq
230690861 gbest344.seq
230688285 gbest345.seq
175388644 gbest346.seq
155171279 gbest347.seq
230689287 gbest348.seq
230691423 gbest349.seq
230689626 gbest35.seq
230687770 gbest350.seq
230690559 gbest351.seq
230689444 gbest352.seq
230690433 gbest353.seq
230688164 gbest354.seq
230687529 gbest355.seq
230689214 gbest356.seq
230688407 gbest357.seq
230689116 gbest358.seq
230689673 gbest359.seq
230689566 gbest36.seq
230688651 gbest360.seq
230688545 gbest361.seq
230696777 gbest362.seq
230687587 gbest363.seq
230689027 gbest364.seq
230689798 gbest365.seq
230689070 gbest366.seq
230688056 gbest367.seq
230689027 gbest368.seq
224807431 gbest369.seq
230687601 gbest37.seq
230691164 gbest370.seq
230687577 gbest371.seq
230688408 gbest372.seq
230688900 gbest373.seq
230689428 gbest374.seq
230689809 gbest375.seq
230688251 gbest376.seq
230693291 gbest377.seq
230689752 gbest378.seq
230690847 gbest379.seq
230689812 gbest38.seq
230687755 gbest380.seq
230688633 gbest381.seq
230687660 gbest382.seq
230687586 gbest383.seq
230689616 gbest384.seq
230689052 gbest385.seq
230689894 gbest386.seq
230687925 gbest387.seq
230689550 gbest388.seq
230690089 gbest389.seq
230689995 gbest39.seq
230689931 gbest390.seq
230689768 gbest391.seq
230691327 gbest392.seq
230687823 gbest393.seq
230687633 gbest394.seq
230689595 gbest395.seq
222295385 gbest396.seq
230689350 gbest397.seq
230688033 gbest398.seq
230690754 gbest399.seq
230690012 gbest4.seq
230688633 gbest40.seq
230688436 gbest400.seq
230688573 gbest401.seq
230687801 gbest402.seq
230688591 gbest403.seq
230692546 gbest404.seq
230688950 gbest405.seq
230689006 gbest406.seq
230687796 gbest407.seq
230688684 gbest408.seq
230687821 gbest409.seq
230687670 gbest41.seq
230688896 gbest410.seq
230689160 gbest411.seq
230689377 gbest412.seq
230688987 gbest413.seq
230689654 gbest414.seq
230690350 gbest415.seq
230691219 gbest416.seq
230688124 gbest417.seq
230687949 gbest418.seq
230689835 gbest419.seq
230688056 gbest42.seq
230687592 gbest420.seq
219158444 gbest421.seq
208486600 gbest422.seq
208151807 gbest423.seq
208443049 gbest424.seq
208284121 gbest425.seq
208548445 gbest426.seq
208545827 gbest427.seq
210148584 gbest428.seq
209626161 gbest429.seq
230690483 gbest43.seq
209116960 gbest430.seq
212214003 gbest431.seq
209916498 gbest432.seq
208799116 gbest433.seq
208831173 gbest434.seq
208886808 gbest435.seq
208222466 gbest436.seq
208270091 gbest437.seq
208281852 gbest438.seq
208162362 gbest439.seq
230688072 gbest44.seq
207339014 gbest440.seq
230688072 gbest441.seq
230689046 gbest442.seq
230688800 gbest443.seq
230689442 gbest444.seq
230689980 gbest445.seq
230689075 gbest446.seq
230687460 gbest447.seq
230687986 gbest448.seq
230689853 gbest449.seq
230688249 gbest45.seq
230689608 gbest450.seq
230688981 gbest451.seq
230689578 gbest452.seq
230689478 gbest453.seq
230687449 gbest454.seq
230690648 gbest455.seq
230690928 gbest456.seq
230688427 gbest457.seq
230688904 gbest458.seq
230689367 gbest459.seq
189068532 gbest46.seq
230690075 gbest460.seq
230689066 gbest461.seq
230691632 gbest462.seq
230688494 gbest463.seq
230689313 gbest464.seq
230689306 gbest465.seq
230689743 gbest466.seq
230690227 gbest467.seq
230690667 gbest468.seq
230690116 gbest469.seq
188224339 gbest47.seq
230687768 gbest470.seq
230689528 gbest471.seq
230689523 gbest472.seq
230692342 gbest473.seq
230690116 gbest474.seq
230687450 gbest475.seq
230688065 gbest476.seq
230688302 gbest477.seq
230687646 gbest478.seq
230689646 gbest479.seq
205932833 gbest48.seq
230687547 gbest480.seq
230687823 gbest481.seq
230687533 gbest482.seq
230689512 gbest483.seq
230687918 gbest484.seq
230687478 gbest485.seq
230689233 gbest486.seq
230690105 gbest487.seq
230687533 gbest488.seq
230691015 gbest489.seq
215142341 gbest49.seq
230689559 gbest490.seq
230688238 gbest491.seq
230691312 gbest492.seq
230689721 gbest493.seq
230690589 gbest494.seq
230690863 gbest495.seq
229256903 gbest496.seq
230688867 gbest497.seq
230691653 gbest498.seq
230688465 gbest499.seq
164122622 gbest5.seq
214786874 gbest50.seq
230687846 gbest500.seq
230687788 gbest501.seq
230687686 gbest502.seq
230689110 gbest503.seq
230688076 gbest504.seq
230690838 gbest505.seq
230689192 gbest506.seq
230689244 gbest507.seq
230687695 gbest508.seq
230688856 gbest509.seq
215619147 gbest51.seq
224841992 gbest510.seq
223967867 gbest511.seq
230688144 gbest512.seq
230688569 gbest513.seq
230690339 gbest514.seq
230688415 gbest515.seq
230690279 gbest516.seq
230689351 gbest517.seq
230688730 gbest518.seq
230690473 gbest519.seq
230688543 gbest52.seq
230690335 gbest520.seq
230690196 gbest521.seq
230688524 gbest522.seq
230688848 gbest523.seq
230688480 gbest524.seq
217134780 gbest525.seq
196072998 gbest526.seq
230688663 gbest527.seq
230689951 gbest528.seq
230687631 gbest529.seq
230687525 gbest53.seq
230690293 gbest530.seq
230690315 gbest531.seq
230690298 gbest532.seq
230688678 gbest533.seq
230690149 gbest534.seq
230689674 gbest535.seq
230689457 gbest536.seq
230688703 gbest537.seq
230687832 gbest538.seq
230687901 gbest539.seq
230687605 gbest54.seq
221866228 gbest540.seq
227806089 gbest541.seq
230688741 gbest542.seq
230689868 gbest543.seq
230687452 gbest544.seq
230689745 gbest545.seq
230688137 gbest546.seq
230687529 gbest547.seq
219867710 gbest548.seq
221582965 gbest549.seq
228570082 gbest55.seq
230688008 gbest550.seq
230689242 gbest551.seq
230690279 gbest552.seq
230687851 gbest553.seq
230688178 gbest554.seq
230687940 gbest555.seq
230688425 gbest556.seq
230689296 gbest557.seq
230687531 gbest558.seq
230688168 gbest559.seq
225674339 gbest56.seq
230689650 gbest560.seq
230687520 gbest561.seq
230687566 gbest562.seq
230689512 gbest563.seq
230688148 gbest564.seq
230688299 gbest565.seq
230688437 gbest566.seq
230688313 gbest567.seq
230689735 gbest568.seq
230689461 gbest569.seq
230688418 gbest57.seq
230687970 gbest570.seq
230687522 gbest571.seq
230687960 gbest572.seq
230687805 gbest573.seq
230688236 gbest574.seq
230690614 gbest575.seq
230687935 gbest576.seq
230691338 gbest577.seq
230688287 gbest578.seq
230687801 gbest579.seq
230688856 gbest58.seq
230689031 gbest580.seq
230689625 gbest581.seq
230688894 gbest582.seq
230689815 gbest583.seq
230689588 gbest584.seq
230689820 gbest585.seq
230687971 gbest586.seq
230690447 gbest587.seq
230691803 gbest588.seq
230691132 gbest589.seq
230687909 gbest59.seq
230687828 gbest590.seq
230689050 gbest591.seq
230690334 gbest592.seq
230690741 gbest593.seq
230688431 gbest594.seq
230687837 gbest595.seq
230688133 gbest596.seq
230687824 gbest597.seq
230688228 gbest598.seq
230687646 gbest599.seq
177441695 gbest6.seq
230689846 gbest60.seq
230687474 gbest600.seq
230690021 gbest601.seq
230689711 gbest602.seq
230687622 gbest603.seq
230688031 gbest604.seq
230689811 gbest605.seq
230691512 gbest606.seq
230687968 gbest607.seq
230689262 gbest608.seq
230689210 gbest609.seq
230689008 gbest61.seq
230688659 gbest610.seq
230687648 gbest611.seq
230687661 gbest612.seq
230688720 gbest613.seq
230689847 gbest614.seq
230687451 gbest615.seq
230690795 gbest616.seq
230687843 gbest617.seq
230689230 gbest618.seq
230690032 gbest619.seq
230687881 gbest62.seq
230688247 gbest620.seq
230689531 gbest621.seq
230687907 gbest622.seq
230687892 gbest623.seq
230688434 gbest624.seq
230687756 gbest625.seq
217409621 gbest626.seq
217352916 gbest627.seq
230687446 gbest628.seq
213243071 gbest629.seq
230687622 gbest63.seq
189710080 gbest630.seq
189063243 gbest631.seq
192844042 gbest632.seq
190008804 gbest633.seq
190710700 gbest634.seq
189890756 gbest635.seq
192024671 gbest636.seq
190429232 gbest637.seq
189605127 gbest638.seq
196768182 gbest639.seq
230689675 gbest64.seq
230688461 gbest640.seq
230688736 gbest641.seq
230690288 gbest642.seq
230690972 gbest643.seq
230690903 gbest644.seq
230688265 gbest645.seq
230689317 gbest646.seq
230688649 gbest647.seq
230689216 gbest648.seq
230689864 gbest649.seq
230688368 gbest65.seq
230689404 gbest650.seq
230688353 gbest651.seq
230688880 gbest652.seq
230688461 gbest653.seq
230690374 gbest654.seq
230689647 gbest655.seq
230689475 gbest656.seq
230688722 gbest657.seq
230691173 gbest658.seq
230687790 gbest659.seq
230688614 gbest66.seq
230690295 gbest660.seq
230688049 gbest661.seq
230689682 gbest662.seq
230689666 gbest663.seq
230687478 gbest664.seq
230689417 gbest665.seq
230689420 gbest666.seq
230688918 gbest667.seq
230690512 gbest668.seq
230689122 gbest669.seq
230688351 gbest67.seq
230688760 gbest670.seq
230688960 gbest671.seq
230690092 gbest672.seq
230689324 gbest673.seq
230688757 gbest674.seq
230687761 gbest675.seq
230688368 gbest676.seq
230690139 gbest677.seq
230688597 gbest678.seq
230687664 gbest679.seq
230688451 gbest68.seq
230687527 gbest680.seq
230688096 gbest681.seq
230688676 gbest682.seq
230687885 gbest683.seq
230691221 gbest684.seq
230687492 gbest685.seq
230688941 gbest686.seq
230689652 gbest687.seq
230690231 gbest688.seq
230689154 gbest689.seq
230690592 gbest69.seq
230690248 gbest690.seq
230689154 gbest691.seq
220207006 gbest692.seq
230689460 gbest693.seq
209240248 gbest694.seq
230690906 gbest7.seq
230688371 gbest70.seq
230687905 gbest71.seq
208366677 gbest72.seq
208221057 gbest73.seq
207310299 gbest74.seq
207884314 gbest75.seq
208635111 gbest76.seq
208992290 gbest77.seq
208157374 gbest78.seq
207470667 gbest79.seq
230688637 gbest8.seq
209021342 gbest80.seq
206761322 gbest81.seq
204285960 gbest82.seq
207097253 gbest83.seq
207238003 gbest84.seq
211464117 gbest85.seq
228146357 gbest86.seq
230688634 gbest87.seq
230661373 gbest88.seq
216191065 gbest89.seq
230688701 gbest9.seq
213201279 gbest90.seq
215440473 gbest91.seq
230688901 gbest92.seq
230689616 gbest93.seq
230689100 gbest94.seq
230689647 gbest95.seq
230688801 gbest96.seq
230689876 gbest97.seq
230690308 gbest98.seq
230689973 gbest99.seq
76069869 gbgen.idx
230688414 gbgss1.seq
230688271 gbgss10.seq
230688089 gbgss100.seq
227817475 gbgss101.seq
228814796 gbgss102.seq
228519987 gbgss103.seq
228615166 gbgss104.seq
227730317 gbgss105.seq
230689448 gbgss106.seq
230689958 gbgss107.seq
230688081 gbgss108.seq
230689046 gbgss109.seq
230687891 gbgss11.seq
230689448 gbgss110.seq
230688978 gbgss111.seq
230687631 gbgss112.seq
230687583 gbgss113.seq
230689057 gbgss114.seq
230688407 gbgss115.seq
230689017 gbgss116.seq
230688380 gbgss117.seq
230687866 gbgss118.seq
230688168 gbgss119.seq
230689750 gbgss12.seq
230687841 gbgss120.seq
230687884 gbgss121.seq
230689501 gbgss122.seq
230687958 gbgss123.seq
230690565 gbgss124.seq
230687725 gbgss125.seq
230689525 gbgss126.seq
230690341 gbgss127.seq
230688576 gbgss128.seq
230688735 gbgss129.seq
230688660 gbgss13.seq
230688657 gbgss130.seq
230689877 gbgss131.seq
230689846 gbgss132.seq
230690430 gbgss133.seq
230688152 gbgss134.seq
230688279 gbgss135.seq
230688963 gbgss136.seq
230687739 gbgss137.seq
230689398 gbgss138.seq
230689673 gbgss139.seq
230687564 gbgss14.seq
230687695 gbgss140.seq
230689312 gbgss141.seq
230687915 gbgss142.seq
230690534 gbgss143.seq
230687653 gbgss144.seq
224495857 gbgss145.seq
230687573 gbgss146.seq
230687928 gbgss147.seq
195611901 gbgss148.seq
230689449 gbgss149.seq
230689219 gbgss15.seq
230688788 gbgss150.seq
230689163 gbgss151.seq
230689991 gbgss152.seq
230690434 gbgss153.seq
230689776 gbgss154.seq
230688643 gbgss155.seq
230688534 gbgss156.seq
230689485 gbgss157.seq
230690094 gbgss158.seq
230689588 gbgss159.seq
230690752 gbgss16.seq
230688087 gbgss160.seq
230689991 gbgss161.seq
230689115 gbgss162.seq
230689764 gbgss163.seq
230687708 gbgss164.seq
230689542 gbgss165.seq
230690447 gbgss166.seq
230688470 gbgss167.seq
230688895 gbgss168.seq
230687597 gbgss169.seq
230688407 gbgss17.seq
229158196 gbgss170.seq
230688997 gbgss171.seq
230690600 gbgss172.seq
230687656 gbgss173.seq
213003696 gbgss174.seq
207611789 gbgss175.seq
210357622 gbgss176.seq
210642704 gbgss177.seq
209586419 gbgss178.seq
209276231 gbgss179.seq
230688376 gbgss18.seq
207480792 gbgss180.seq
207272793 gbgss181.seq
207670196 gbgss182.seq
209612109 gbgss183.seq
209297218 gbgss184.seq
208122477 gbgss185.seq
205714480 gbgss186.seq
205680004 gbgss187.seq
205243981 gbgss188.seq
205405185 gbgss189.seq
230691315 gbgss19.seq
205270808 gbgss190.seq
206480988 gbgss191.seq
207549347 gbgss192.seq
208589759 gbgss193.seq
207808039 gbgss194.seq
208056900 gbgss195.seq
208741547 gbgss196.seq
208872593 gbgss197.seq
208600241 gbgss198.seq
205804159 gbgss199.seq
230687830 gbgss2.seq
230689026 gbgss20.seq
206124067 gbgss200.seq
206372237 gbgss201.seq
205429974 gbgss202.seq
206376214 gbgss203.seq
207218076 gbgss204.seq
207173848 gbgss205.seq
207134612 gbgss206.seq
207220400 gbgss207.seq
207012502 gbgss208.seq
207148015 gbgss209.seq
230689701 gbgss21.seq
206843373 gbgss210.seq
206940026 gbgss211.seq
206817395 gbgss212.seq
207707593 gbgss213.seq
208041160 gbgss214.seq
209672540 gbgss215.seq
210062751 gbgss216.seq
209305210 gbgss217.seq
210522072 gbgss218.seq
218860414 gbgss219.seq
230689488 gbgss22.seq
218858517 gbgss220.seq
230689662 gbgss221.seq
230688172 gbgss222.seq
230687560 gbgss223.seq
230689535 gbgss224.seq
230690082 gbgss225.seq
25574910 gbgss226.seq
250002793 gbgss227.seq
250002483 gbgss228.seq
250002459 gbgss229.seq
230690690 gbgss23.seq
250001523 gbgss230.seq
250002062 gbgss231.seq
250000351 gbgss232.seq
250003345 gbgss233.seq
250002944 gbgss234.seq
250001625 gbgss235.seq
250000330 gbgss236.seq
250002415 gbgss237.seq
250001389 gbgss238.seq
250001293 gbgss239.seq
230688833 gbgss24.seq
250002315 gbgss240.seq
250001734 gbgss241.seq
250002534 gbgss242.seq
250002473 gbgss243.seq
250000742 gbgss244.seq
250000143 gbgss245.seq
250003660 gbgss246.seq
250002350 gbgss247.seq
250000888 gbgss248.seq
250002003 gbgss249.seq
230690260 gbgss25.seq
250000197 gbgss250.seq
250000952 gbgss251.seq
250001590 gbgss252.seq
250002032 gbgss253.seq
250000808 gbgss254.seq
250001490 gbgss255.seq
250000453 gbgss256.seq
250000913 gbgss257.seq
250001488 gbgss258.seq
250001721 gbgss259.seq
230691303 gbgss26.seq
250001974 gbgss260.seq
250001654 gbgss261.seq
250001453 gbgss262.seq
250002747 gbgss263.seq
250001649 gbgss264.seq
250003146 gbgss265.seq
250000767 gbgss266.seq
250002403 gbgss267.seq
250001875 gbgss268.seq
250001937 gbgss269.seq
230690240 gbgss27.seq
250001150 gbgss270.seq
250000446 gbgss271.seq
250001761 gbgss272.seq
250001611 gbgss273.seq
250001817 gbgss274.seq
250002575 gbgss275.seq
250001091 gbgss276.seq
50689743 gbgss277.seq
230689798 gbgss28.seq
230689139 gbgss29.seq
230689815 gbgss3.seq
230687481 gbgss30.seq
230688825 gbgss31.seq
230688447 gbgss32.seq
230690153 gbgss33.seq
230689863 gbgss34.seq
230689930 gbgss35.seq
230689533 gbgss36.seq
230688945 gbgss37.seq
230688521 gbgss38.seq
230690270 gbgss39.seq
230690070 gbgss4.seq
230688258 gbgss40.seq
230689817 gbgss41.seq
230688649 gbgss42.seq
230689607 gbgss43.seq
230688275 gbgss44.seq
230688883 gbgss45.seq
230688531 gbgss46.seq
230689502 gbgss47.seq
230688052 gbgss48.seq
230687981 gbgss49.seq
230690443 gbgss5.seq
230689016 gbgss50.seq
230688841 gbgss51.seq
230687952 gbgss52.seq
230688474 gbgss53.seq
230689400 gbgss54.seq
230687824 gbgss55.seq
230689258 gbgss56.seq
230689188 gbgss57.seq
230689760 gbgss58.seq
230688382 gbgss59.seq
230688472 gbgss6.seq
230689598 gbgss60.seq
229072004 gbgss61.seq
230688694 gbgss62.seq
230690151 gbgss63.seq
230690062 gbgss64.seq
230688428 gbgss65.seq
230689464 gbgss66.seq
230687783 gbgss67.seq
230689707 gbgss68.seq
230689132 gbgss69.seq
230687967 gbgss7.seq
230688982 gbgss70.seq
230687508 gbgss71.seq
230689502 gbgss72.seq
230687445 gbgss73.seq
230689501 gbgss74.seq
230689589 gbgss75.seq
230689787 gbgss76.seq
230688954 gbgss77.seq
230688157 gbgss78.seq
230688098 gbgss79.seq
230688343 gbgss8.seq
230687746 gbgss80.seq
224549701 gbgss81.seq
194177491 gbgss82.seq
194284293 gbgss83.seq
230690121 gbgss84.seq
230689278 gbgss85.seq
230689750 gbgss86.seq
230690378 gbgss87.seq
230690260 gbgss88.seq
230687951 gbgss89.seq
230689849 gbgss9.seq
230688418 gbgss90.seq
230688952 gbgss91.seq
230689656 gbgss92.seq
230690153 gbgss93.seq
230688008 gbgss94.seq
230688289 gbgss95.seq
230688491 gbgss96.seq
230689383 gbgss97.seq
230689517 gbgss98.seq
230689725 gbgss99.seq
250005014 gbhtc1.seq
250001630 gbhtc10.seq
250002237 gbhtc11.seq
250002096 gbhtc12.seq
5773466 gbhtc13.seq
250016615 gbhtc2.seq
250005705 gbhtc3.seq
250002243 gbhtc4.seq
250012416 gbhtc5.seq
250007006 gbhtc6.seq
250000669 gbhtc7.seq
250000407 gbhtc8.seq
250002591 gbhtc9.seq
250096214 gbhtg1.seq
250059679 gbhtg10.seq
250179745 gbhtg100.seq
250109119 gbhtg101.seq
250039628 gbhtg102.seq
250161313 gbhtg103.seq
250220446 gbhtg104.seq
250160615 gbhtg105.seq
250067553 gbhtg106.seq
19104323 gbhtg107.seq
250041997 gbhtg11.seq
250102353 gbhtg12.seq
250169246 gbhtg13.seq
250071311 gbhtg14.seq
250007173 gbhtg15.seq
250092266 gbhtg16.seq
250319709 gbhtg17.seq
250203720 gbhtg18.seq
250217492 gbhtg19.seq
250020785 gbhtg2.seq
250283300 gbhtg20.seq
250173029 gbhtg21.seq
250120813 gbhtg22.seq
250218151 gbhtg23.seq
250163426 gbhtg24.seq
250277816 gbhtg25.seq
250198590 gbhtg26.seq
250025295 gbhtg27.seq
250158083 gbhtg28.seq
250113050 gbhtg29.seq
250039038 gbhtg3.seq
250223183 gbhtg30.seq
250267818 gbhtg31.seq
250236152 gbhtg32.seq
250123734 gbhtg33.seq
250194454 gbhtg34.seq
250215065 gbhtg35.seq
250001897 gbhtg36.seq
250196286 gbhtg37.seq
250227441 gbhtg38.seq
250139750 gbhtg39.seq
250101895 gbhtg4.seq
250235547 gbhtg40.seq
250551578 gbhtg41.seq
250163328 gbhtg42.seq
250139824 gbhtg43.seq
250032520 gbhtg44.seq
250005966 gbhtg45.seq
250022771 gbhtg46.seq
250238212 gbhtg47.seq
250078541 gbhtg48.seq
250213304 gbhtg49.seq
250209186 gbhtg5.seq
250120823 gbhtg50.seq
250141064 gbhtg51.seq
250193486 gbhtg52.seq
250204098 gbhtg53.seq
250046024 gbhtg54.seq
250132375 gbhtg55.seq
250158491 gbhtg56.seq
250112880 gbhtg57.seq
250191051 gbhtg58.seq
250192163 gbhtg59.seq
250053315 gbhtg6.seq
250199153 gbhtg60.seq
250121781 gbhtg61.seq
250139560 gbhtg62.seq
250066832 gbhtg63.seq
250308403 gbhtg64.seq
250246954 gbhtg65.seq
250182708 gbhtg66.seq
250218223 gbhtg67.seq
250089886 gbhtg68.seq
250123031 gbhtg69.seq
250004176 gbhtg7.seq
250041651 gbhtg70.seq
250008455 gbhtg71.seq
250120392 gbhtg72.seq
250069734 gbhtg73.seq
250056945 gbhtg74.seq
250106999 gbhtg75.seq
250137835 gbhtg76.seq
250058990 gbhtg77.seq
250182241 gbhtg78.seq
250203804 gbhtg79.seq
250124024 gbhtg8.seq
250161667 gbhtg80.seq
250172875 gbhtg81.seq
250083731 gbhtg82.seq
250186185 gbhtg83.seq
250095857 gbhtg84.seq
250128400 gbhtg85.seq
250226724 gbhtg86.seq
250104092 gbhtg87.seq
250072545 gbhtg88.seq
250021589 gbhtg89.seq
250009871 gbhtg9.seq
250093633 gbhtg90.seq
250117339 gbhtg91.seq
250095150 gbhtg92.seq
250002613 gbhtg93.seq
250135295 gbhtg94.seq
250020171 gbhtg95.seq
250245668 gbhtg96.seq
250264295 gbhtg97.seq
250364353 gbhtg98.seq
250401271 gbhtg99.seq
250031821 gbinv1.seq
250000766 gbinv10.seq
250017929 gbinv11.seq
143503 gbinv12.seq
250049525 gbinv2.seq
250002313 gbinv3.seq
250001685 gbinv4.seq
250002275 gbinv5.seq
250000411 gbinv6.seq
250001424 gbinv7.seq
250001077 gbinv8.seq
250000913 gbinv9.seq
149309013 gbjou1.idx
139772337 gbjou2.idx
227629930 gbjou3.idx
284592669 gbjou4.idx
29868175 gbjou5.idx
182490773 gbkey1.idx
179887372 gbkey2.idx
49109956 gbkey3.idx
250005248 gbmam1.seq
250006167 gbmam2.seq
250002702 gbmam3.seq
75692517 gbmam4.seq
39487875 gbnew.txt
250000433 gbpat1.seq
250001176 gbpat10.seq
250000358 gbpat11.seq
250001744 gbpat12.seq
250000859 gbpat13.seq
250000501 gbpat14.seq
250001402 gbpat15.seq
250001582 gbpat16.seq
250002043 gbpat17.seq
250000092 gbpat18.seq
250000338 gbpat19.seq
250000204 gbpat2.seq
250002306 gbpat20.seq
250000860 gbpat21.seq
250170067 gbpat22.seq
250079335 gbpat23.seq
250001470 gbpat24.seq
250005164 gbpat25.seq
250002362 gbpat26.seq
250001296 gbpat27.seq
250008087 gbpat28.seq
250000947 gbpat29.seq
250003353 gbpat3.seq
250000492 gbpat30.seq
250000268 gbpat31.seq
250002379 gbpat32.seq
250000522 gbpat33.seq
250000223 gbpat34.seq
12204094 gbpat35.seq
250002406 gbpat4.seq
250000084 gbpat5.seq
250000245 gbpat6.seq
250001692 gbpat7.seq
250003074 gbpat8.seq
250000011 gbpat9.seq
66079828 gbphg.seq
250013178 gbpln1.seq
250015146 gbpln10.seq
250001880 gbpln11.seq
250048131 gbpln12.seq
250001679 gbpln13.seq
250014315 gbpln14.seq
250042265 gbpln15.seq
300960380 gbpln16.seq
289182528 gbpln17.seq
250002779 gbpln18.seq
250000586 gbpln19.seq
250184380 gbpln2.seq
250002492 gbpln20.seq
250003704 gbpln21.seq
250002237 gbpln22.seq
250005409 gbpln23.seq
250424445 gbpln24.seq
250000477 gbpln25.seq
250000483 gbpln26.seq
250078090 gbpln27.seq
66086902 gbpln28.seq
250053274 gbpln3.seq
250060276 gbpln4.seq
250001895 gbpln5.seq
250000060 gbpln6.seq
250004713 gbpln7.seq
250001356 gbpln8.seq
250126888 gbpln9.seq
250103431 gbpri1.seq
250233099 gbpri10.seq
250054978 gbpri11.seq
250034661 gbpri12.seq
250051012 gbpri13.seq
250109059 gbpri14.seq
250192902 gbpri15.seq
250064479 gbpri16.seq
250006722 gbpri17.seq
250183172 gbpri18.seq
250002174 gbpri19.seq
250050433 gbpri2.seq
250001365 gbpri20.seq
250000391 gbpri21.seq
250252034 gbpri22.seq
250159570 gbpri23.seq
250083485 gbpri24.seq
250144620 gbpri25.seq
250040986 gbpri26.seq
250034598 gbpri27.seq
250101595 gbpri28.seq
250000059 gbpri29.seq
250084754 gbpri3.seq
250003011 gbpri30.seq
250106605 gbpri31.seq
250004184 gbpri32.seq
250018823 gbpri33.seq
250000321 gbpri34.seq
87078775 gbpri35.seq
250172956 gbpri4.seq
250001650 gbpri5.seq
250101718 gbpri6.seq
250105457 gbpri7.seq
250516005 gbpri8.seq
250025759 gbpri9.seq
285601 gbrel.txt
250187007 gbrod1.seq
250176831 gbrod10.seq
250240842 gbrod11.seq
250192037 gbrod12.seq
250232574 gbrod13.seq
250072874 gbrod14.seq
250039882 gbrod15.seq
250043959 gbrod16.seq
250001549 gbrod17.seq
250050498 gbrod18.seq
250024869 gbrod19.seq
250058252 gbrod2.seq
250136300 gbrod20.seq
250050319 gbrod21.seq
250001769 gbrod22.seq
250067704 gbrod23.seq
250000722 gbrod24.seq
250000346 gbrod25.seq
82456639 gbrod26.seq
250030954 gbrod3.seq
250219690 gbrod4.seq
250091509 gbrod5.seq
250212969 gbrod6.seq
250224264 gbrod7.seq
250219193 gbrod8.seq
250147115 gbrod9.seq
1229045732 gbsdr1.txt
4004403371 gbsdr2.txt
1735963032 gbsdr3.txt
98506132 gbsec.idx
250001375 gbsts1.seq
250001644 gbsts10.seq
250001066 gbsts11.seq
250002414 gbsts12.seq
250000103 gbsts13.seq
200538536 gbsts14.seq
250001597 gbsts2.seq
250002222 gbsts3.seq
250000978 gbsts4.seq
250003720 gbsts5.seq
250000849 gbsts6.seq
250001658 gbsts7.seq
250001601 gbsts8.seq
250001074 gbsts9.seq
250011055 gbsyn1.seq
29407567 gbsyn2.seq
425453 gbuna.seq
250000096 gbvrl1.seq
250002178 gbvrl2.seq
250190663 gbvrl3.seq
250001483 gbvrl4.seq
250000367 gbvrl5.seq
250002319 gbvrl6.seq
250001083 gbvrl7.seq
201704605 gbvrl8.seq
250214629 gbvrt1.seq
250000217 gbvrt10.seq
250134869 gbvrt11.seq
250010868 gbvrt12.seq
250000183 gbvrt13.seq
250000203 gbvrt14.seq
87850533 gbvrt15.seq
250001499 gbvrt2.seq
250116558 gbvrt3.seq
250022729 gbvrt4.seq
250000686 gbvrt5.seq
250112448 gbvrt6.seq
250059296 gbvrt7.seq
250085212 gbvrt8.seq
250154303 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 34190 101844193
BCT10 99 111433721
BCT11 159 98958722
BCT12 57 113394778
BCT13 52 114400114
BCT14 56 117370496
BCT15 52 120387849
BCT16 69 113109919
BCT17 42 110971097
BCT18 57 111904346
BCT19 67 110577847
BCT2 3542 111636068
BCT20 57 112792989
BCT21 65 110402514
BCT22 54 115681422
BCT23 76 107263450
BCT24 34483 94161862
BCT25 77344 78831811
BCT26 41449 87051731
BCT3 160 112232466
BCT4 23023 104072614
BCT5 54394 87686564
BCT6 5492 98525394
BCT7 15818 100410014
BCT8 13970 110852148
BCT9 56863 88658870
ENV1 91355 70860362
ENV2 95203 69655806
ENV3 82738 86193590
ENV4 94281 80748778
ENV5 120777 46062360
ENV6 114299 48554193
ENV7 94068 75267631
ENV8 17704 14395564
EST1 68126 26289737
EST10 76536 29843847
EST100 71636 43028551
EST101 72391 36725513
EST102 74904 38903540
EST103 70458 37435820
EST104 76788 44322409
EST105 69743 39902759
EST106 69556 35538150
EST107 73334 34860570
EST108 71396 47220837
EST109 70433 43340396
EST11 75185 28804451
EST110 72502 43613494
EST111 71429 31514538
EST112 70865 30482209
EST113 65852 36960820
EST114 68320 37287198
EST115 68777 45053617
EST116 73816 31836140
EST117 74949 34863593
EST118 74588 27213408
EST119 73663 35564706
EST12 77561 30740392
EST120 72065 34732038
EST121 68237 40171102
EST122 80165 44269507
EST123 76600 45830378
EST124 68518 43672269
EST125 66973 42788394
EST126 74218 50080718
EST127 69613 42533377
EST128 74726 43359897
EST129 73465 46306126
EST13 77005 29270444
EST130 71674 47646575
EST131 73322 51050731
EST132 78572 39809335
EST133 75843 30723783
EST134 78427 37897009
EST135 77728 44075654
EST136 76208 46278471
EST137 61710 29519589
EST138 71909 38523372
EST139 68550 39627057
EST14 78630 31875384
EST140 65658 35976198
EST141 71865 42908815
EST142 72096 45139035
EST143 68403 39632718
EST144 71761 39199485
EST145 70517 44051262
EST146 65153 39655064
EST147 71386 39934960
EST148 104395 56666409
EST149 72122 40727692
EST15 74652 31549134
EST150 98527 51671434
EST151 113307 60569788
EST152 105578 58526636
EST153 85054 50093156
EST154 94021 52538528
EST155 101569 63192639
EST156 95297 58494331
EST157 87232 48526619
EST158 75937 44205945
EST159 68380 33717614
EST16 75794 33337598
EST160 63508 29174299
EST161 54388 24893072
EST162 65922 31337976
EST163 61368 31427442
EST164 66159 35321742
EST165 72356 51629475
EST166 63939 43515720
EST167 82361 49276428
EST168 59086 29763867
EST169 61245 31107537
EST17 82219 33937304
EST170 66567 40410389
EST171 65243 34682976
EST172 63590 44884359
EST173 88446 45281127
EST174 93841 46005066
EST175 96409 57272485
EST176 103990 60262685
EST177 94954 52625777
EST178 89578 44901855
EST179 92935 38154811
EST18 80855 32235256
EST180 99060 50991723
EST181 93437 40301268
EST182 97494 42095226
EST183 70683 38931230
EST184 68458 43646017
EST185 64244 36920399
EST186 65461 42877641
EST187 68486 30726142
EST188 76435 32168713
EST189 69254 43587856
EST19 78505 31820707
EST190 82584 40994162
EST191 61944 32146328
EST192 67163 47985204
EST193 70574 46039109
EST194 67487 36610865
EST195 66866 44403214
EST196 70122 54421780
EST197 68473 32786295
EST198 72097 40347072
EST199 69239 58931336
EST2 74651 28647346
EST20 74699 30643128
EST200 66231 50108872
EST201 63741 46373847
EST202 63290 46858424
EST203 65062 45800480
EST204 64326 44873750
EST205 63464 48649143
EST206 62347 39103853
EST207 65233 33831659
EST208 63387 37355458
EST209 84890 46793734
EST21 73787 34320567
EST210 84435 54934225
EST211 66832 39281883
EST212 111922 70528645
EST213 114668 69246812
EST214 115100 68233953
EST215 109202 70410533
EST216 114474 59696897
EST217 106167 53694221
EST218 89210 53396928
EST219 97875 42240004
EST22 75286 30183767
EST220 84919 47764101
EST221 72425 45312911
EST222 66875 46689005
EST223 68283 58843209
EST224 71117 55897544
EST225 78835 39721259
EST226 79922 48089304
EST227 74273 52908725
EST228 70716 51382807
EST229 34692 15236749
EST23 77332 32670279
EST230 28007 10684247
EST231 27648 10226348
EST232 26536 9729323
EST233 26889 9055918
EST234 27827 10140720
EST235 27416 9890601
EST236 27415 9897397
EST237 27489 10754152
EST238 27338 12018827
EST239 27437 11226534
EST24 74802 32888100
EST240 27570 9952032
EST241 27839 9328867
EST242 27147 9621666
EST243 28042 11303815
EST244 27861 11073324
EST245 27052 11409903
EST246 26918 12191301
EST247 27306 11189756
EST248 27235 10958953
EST249 27236 11992123
EST25 73892 31805496
EST250 27396 11560646
EST251 27480 10869673
EST252 27468 10976082
EST253 27302 10432755
EST254 26934 12858505
EST255 24681 17258165
EST256 26211 17612349
EST257 70808 29249806
EST258 69542 40122320
EST259 83079 34954634
EST26 75346 31135299
EST260 85326 40274180
EST261 69443 44448144
EST262 69083 44858208
EST263 69109 44167701
EST264 66233 41168630
EST265 75288 42983514
EST266 65358 40887459
EST267 71407 48727852
EST268 55729 27270703
EST269 99352 47207228
EST27 74547 32484391
EST270 90171 44899894
EST271 71604 40029719
EST272 61690 28766127
EST273 70805 42428545
EST274 71785 36565006
EST275 71921 33290438
EST276 70582 41493562
EST277 72671 42059996
EST278 64764 38424726
EST279 69905 33413208
EST28 108032 51153958
EST280 86779 46646914
EST281 71758 45379007
EST282 80264 54303135
EST283 93231 52461756
EST284 100638 46419089
EST285 79391 45132852
EST286 67954 43169700
EST287 75705 36486154
EST288 68811 32532278
EST289 71655 31588950
EST29 97071 45974907
EST290 66969 39092858
EST291 59931 36613920
EST292 67610 40981791
EST293 69148 41080022
EST294 60558 41290812
EST295 83891 42324431
EST296 77258 41560319
EST297 71973 42234600
EST298 94207 54866375
EST299 116465 49435657
EST3 73738 29918375
EST30 98312 53737989
EST300 99587 43851481
EST301 66028 35976230
EST302 70138 41196765
EST303 78051 45410275
EST304 75784 38741750
EST305 71167 45463171
EST306 69549 37289341
EST307 60516 37189734
EST308 49713 25761258
EST309 72858 52240474
EST31 86628 50446448
EST310 69181 40423934
EST311 70880 42949900
EST312 65534 37853349
EST313 71796 37360749
EST314 56119 28262797
EST315 55609 28400108
EST316 54378 29466261
EST317 54426 28559788
EST318 54108 30331080
EST319 58221 23857448
EST32 67477 43158984
EST320 58075 25174452
EST321 56257 23020094
EST322 57572 22498604
EST323 56926 22612332
EST324 58720 23642323
EST325 56988 22272900
EST326 58329 20945047
EST327 63609 32649824
EST328 77429 37441239
EST329 76803 34805412
EST33 71495 56922217
EST330 79489 33768870
EST331 78401 34283084
EST332 90976 59857531
EST333 70145 54307232
EST334 96425 58498814
EST335 96848 58384344
EST336 102184 59973863
EST337 105760 57412568
EST338 84940 47421383
EST339 73046 40144468
EST34 85199 48639510
EST340 75884 40173472
EST341 66373 54524296
EST342 63650 48434708
EST343 62815 43645476
EST344 59595 31394562
EST345 74422 50784338
EST346 54816 32760106
EST347 52660 26103523
EST348 65516 36080260
EST349 65158 34548190
EST35 86596 43591483
EST350 62967 30960282
EST351 63286 40736957
EST352 81184 44338112
EST353 72072 40625335
EST354 67972 41360170
EST355 70470 40245640
EST356 62242 42815511
EST357 84059 48139180
EST358 84557 49781763
EST359 81166 44393703
EST36 92300 50124220
EST360 64095 35772154
EST361 67541 37144566
EST362 72631 39820434
EST363 48013 24325706
EST364 63489 36399722
EST365 70970 41354502
EST366 94923 46541823
EST367 77291 42670044
EST368 72576 48670012
EST369 69432 46535751
EST37 87071 60647554
EST370 64953 36980322
EST371 69643 35345269
EST372 84575 38937559
EST373 60583 39134142
EST374 53879 38828909
EST375 65914 36488699
EST376 84590 51751731
EST377 89817 49854855
EST378 67276 40448479
EST379 78427 42593294
EST38 76118 51520881
EST380 57883 38283707
EST381 43304 21157320
EST382 58170 36329795
EST383 83159 45090422
EST384 78745 46535486
EST385 72803 45020066
EST386 80306 47192787
EST387 76684 49300469
EST388 87928 60674118
EST389 76803 71229496
EST39 93369 54848166
EST390 83764 49969036
EST391 76534 38671538
EST392 64445 39869214
EST393 67899 40287872
EST394 64194 37205088
EST395 62319 33056413
EST396 79742 25279415
EST397 76056 38598712
EST398 66310 40105561
EST399 69417 34716733
EST4 74568 28391284
EST40 63688 49422758
EST400 72277 44314906
EST401 71035 45460818
EST402 65325 42120546
EST403 65563 41794343
EST404 68050 38408986
EST405 67986 40839729
EST406 70060 44926953
EST407 80091 48900157
EST408 87253 48769426
EST409 60849 39226405
EST41 80077 49751504
EST410 58244 41273022
EST411 57393 40386815
EST412 58726 40616359
EST413 78170 47680611
EST414 55215 32608050
EST415 54249 35783581
EST416 65084 40775656
EST417 58679 41239772
EST418 60576 42317228
EST419 52484 37473700
EST42 105122 52309316
EST420 60831 39635209
EST421 89668 40122662
EST422 70468 38958901
EST423 70693 38538905
EST424 70464 39361924
EST425 70549 38734947
EST426 70301 39419627
EST427 70216 38887383
EST428 69767 38876189
EST429 69654 39466230
EST43 103810 45243665
EST430 69860 39139617
EST431 68013 38464695
EST432 69857 38274640
EST433 70266 39727980
EST434 70205 38965360
EST435 70261 38168487
EST436 70699 38717871
EST437 70637 38913692
EST438 70541 38753725
EST439 70725 38588098
EST44 93715 51611506
EST440 71919 37465301
EST441 94296 54857984
EST442 82660 37005078
EST443 101645 57367102
EST444 84755 48034015
EST445 74975 46217583
EST446 84518 49935649
EST447 86570 51032684
EST448 96555 60038507
EST449 86905 51542401
EST45 102848 44373249
EST450 87119 48419587
EST451 87826 48343911
EST452 77891 57361115
EST453 58762 42531860
EST454 52004 40798318
EST455 70889 44388155
EST456 63355 37499633
EST457 71165 42223323
EST458 110752 55756277
EST459 78698 48600770
EST46 70173 18890147
EST460 84905 56753583
EST461 50743 32114541
EST462 48890 41756659
EST463 46669 58992191
EST464 69702 56809004
EST465 65572 37697427
EST466 73218 42731053
EST467 71039 42448146
EST468 67405 43936018
EST469 65677 45821512
EST47 70432 18842464
EST470 69328 48032094
EST471 109206 47916035
EST472 94165 47237960
EST473 64425 48925853
EST474 55452 40268694
EST475 56551 38983689
EST476 63979 44600575
EST477 65116 46497418
EST478 62943 46682726
EST479 54212 37811443
EST48 71560 21354989
EST480 51493 39365044
EST481 60062 41518703
EST482 59110 35830440
EST483 72632 44618643
EST484 59151 39215803
EST485 56934 38881897
EST486 62459 46385858
EST487 58376 45733642
EST488 73370 47359032
EST489 50273 40013626
EST49 44075 12104149
EST490 57622 40252615
EST491 53965 34204529
EST492 57387 40674877
EST493 55540 35033679
EST494 75620 44843033
EST495 67366 57240286
EST496 69854 50793564
EST497 76025 49364353
EST498 45754 59667806
EST499 55719 48977284
EST5 48195 15293879
EST50 44028 12280370
EST500 67697 48961285
EST501 57633 39448169
EST502 77794 44177083
EST503 83469 53683167
EST504 82741 52515339
EST505 72802 43698976
EST506 58990 38365501
EST507 73072 49653239
EST508 80782 49210090
EST509 79151 58934470
EST51 43808 11805954
EST510 70195 47571947
EST511 72794 51698721
EST512 68460 46180921
EST513 62006 49426388
EST514 62866 45145493
EST515 75249 44123766
EST516 71645 43363984
EST517 110091 45012355
EST518 116942 48585705
EST519 85061 52332718
EST52 67930 25765800
EST520 50557 50327510
EST521 60510 46020248
EST522 95809 17369939
EST523 99728 11009065
EST524 99427 18735209
EST525 91102 40856744
EST526 86974 31721491
EST527 83586 40867378
EST528 63551 61196416
EST529 90839 56342204
EST53 95892 39247964
EST530 81560 45146572
EST531 67667 42903088
EST532 72442 48564963
EST533 77282 50513670
EST534 87056 51596436
EST535 72563 52832003
EST536 67969 48204290
EST537 71163 54012599
EST538 84199 51830941
EST539 84869 45531321
EST54 97068 43336328
EST540 82847 45434923
EST541 84520 39741408
EST542 81633 44251970
EST543 77343 52249330
EST544 73149 55903332
EST545 74351 51957813
EST546 79255 44484129
EST547 102626 47883209
EST548 111564 48290982
EST549 118646 49675052
EST55 96802 46879914
EST550 131311 59598513
EST551 96650 53921023
EST552 79649 53737037
EST553 79994 25113658
EST554 84289 8750605
EST555 99699 38704565
EST556 124028 62044568
EST557 71139 43358633
EST558 61865 37782997
EST559 76043 49485293
EST56 92417 45562068
EST560 77498 47719332
EST561 70883 43978067
EST562 75557 45834575
EST563 67966 53264814
EST564 89267 54685210
EST565 97287 51812590
EST566 72176 36641712
EST567 63840 43110191
EST568 76322 52943548
EST569 103213 61718332
EST57 105341 52782119
EST570 76066 44070509
EST571 78153 41109761
EST572 94073 13909723
EST573 98519 10551752
EST574 98466 10646552
EST575 75069 42286894
EST576 87537 46698418
EST577 85121 47302256
EST578 71046 52101438
EST579 84778 55017820
EST58 105351 53773560
EST580 87241 55310105
EST581 85058 56800390
EST582 79487 46799336
EST583 87705 52890749
EST584 74719 43575114
EST585 69773 49403386
EST586 56239 35908039
EST587 108489 33647669
EST588 62088 39902667
EST589 51092 32328014
EST59 76264 32856968
EST590 51293 33300916
EST591 53254 37074308
EST592 76094 49125130
EST593 65505 47049645
EST594 96971 28540788
EST595 122589 11128313
EST596 118236 14516873
EST597 122482 11290901
EST598 119897 13047409
EST599 65768 47065423
EST6 54921 17444667
EST60 66500 28808828
EST600 63844 49695000
EST601 77204 50950295
EST602 79214 50423048
EST603 68398 49416101
EST604 77206 44943160
EST605 63242 42727282
EST606 69258 40096153
EST607 111265 24664001
EST608 127227 11792225
EST609 90172 29369600
EST61 72960 32476434
EST610 72104 50074221
EST611 73755 50683153
EST612 90076 45184142
EST613 90844 54486980
EST614 69110 40869933
EST615 67016 35192087
EST616 77259 63234236
EST617 75875 47400477
EST618 108969 48766461
EST619 79407 52127912
EST62 70868 29963508
EST620 61488 48664435
EST621 67456 55828009
EST622 73851 39633708
EST623 83846 47361910
EST624 93119 54524631
EST625 83221 37667939
EST626 71430 46936938
EST627 71405 47102012
EST628 73111 50480307
EST629 86882 37941344
EST63 79997 32524524
EST630 78911 26479911
EST631 79469 24985300
EST632 76631 30392066
EST633 78631 26024351
EST634 77720 30489851
EST635 78220 28982116
EST636 77250 28624700
EST637 78176 28832641
EST638 78394 29487491
EST639 77869 32379218
EST64 75011 29551248
EST640 80541 45302530
EST641 81788 60189661
EST642 81958 59791145
EST643 76742 46568959
EST644 62866 34317444
EST645 68465 43700660
EST646 70516 47426226
EST647 58038 45182514
EST648 57910 44143984
EST649 77057 43344328
EST65 71123 28668180
EST650 68210 37077336
EST651 83141 54126821
EST652 83515 42553903
EST653 66294 41485181
EST654 71079 47736184
EST655 83920 48200474
EST656 65288 38156719
EST657 71394 49938230
EST658 72231 47436492
EST659 61595 43358883
EST66 64489 29697457
EST660 70706 52141113
EST661 75498 50067583
EST662 71728 47500682
EST663 69217 49912362
EST664 70098 45933922
EST665 79718 35226832
EST666 65005 32758772
EST667 59539 38309931
EST668 63233 44527251
EST669 64178 41866315
EST67 74283 33310665
EST670 68080 49898542
EST671 64193 41621893
EST672 58645 38618584
EST673 57548 39673570
EST674 65540 41805527
EST675 66546 45108641
EST676 65930 45523275
EST677 65922 45821468
EST678 67387 44695669
EST679 70722 55110938
EST68 78178 34897366
EST680 70579 49977584
EST681 62801 37831424
EST682 66800 40171641
EST683 65980 46534257
EST684 63728 35255750
EST685 61249 40999006
EST686 61956 38229176
EST687 69971 42998029
EST688 69550 26413047
EST689 72198 27036822
EST69 72755 28988153
EST690 73515 26117765
EST691 72033 26110201
EST692 77286 26057492
EST693 71428 28955403
EST694 68062 25548171
EST7 74544 29357867
EST70 75708 25719381
EST71 86765 41793921
EST72 41593 11756397
EST73 40880 11263822
EST74 40837 12564162
EST75 41265 12744994
EST76 41301 12454629
EST77 41219 13150362
EST78 41004 13056066
EST79 41001 12231276
EST8 75833 30592306
EST80 40628 12189698
EST81 41462 12865441
EST82 41835 11991387
EST83 41504 13214618
EST84 41328 13197742
EST85 43246 12881412
EST86 46878 18721767
EST87 43102 26995757
EST88 43325 18941973
EST89 49977 20923633
EST9 77569 29868098
EST90 51645 21861164
EST91 50540 22246950
EST92 87975 52047168
EST93 77511 36199577
EST94 74126 28633160
EST95 72264 29596298
EST96 76690 42710613
EST97 77470 41004945
EST98 75640 41951286
EST99 77641 34523989
GSS1 90443 38669065
GSS10 74784 43607435
GSS100 80624 51405399
GSS101 74528 42757342
GSS102 73373 45683648
GSS103 73714 44825370
GSS104 73230 45734348
GSS105 73261 44831622
GSS106 75263 45728351
GSS107 81433 54691302
GSS108 83870 55509617
GSS109 81047 52305168
GSS11 70801 35982415
GSS110 82197 50450049
GSS111 84235 58192780
GSS112 79854 59024328
GSS113 91244 46353734
GSS114 89929 53560184
GSS115 73594 50017474
GSS116 89786 65410570
GSS117 82175 58721640
GSS118 75986 42539812
GSS119 81852 50442651
GSS12 73152 38497965
GSS120 94951 53347627
GSS121 84408 55583540
GSS122 84911 54829624
GSS123 81885 55721660
GSS124 76053 69623911
GSS125 76839 66065203
GSS126 78829 55597189
GSS127 72480 50151876
GSS128 72480 50137715
GSS129 73146 49015571
GSS13 76795 38904781
GSS130 72128 50786335
GSS131 74464 50641270
GSS132 84089 59848185
GSS133 80759 58314089
GSS134 68668 56208998
GSS135 71882 55687162
GSS136 75827 67961232
GSS137 75886 61922166
GSS138 76999 52530274
GSS139 86891 53827086
GSS14 71378 32115094
GSS140 94777 57962677
GSS141 92621 59919437
GSS142 82304 53746712
GSS143 87967 51669139
GSS144 75779 58218072
GSS145 114879 59699656
GSS146 109515 58813011
GSS147 87605 62221768
GSS148 49927 29596660
GSS149 68143 48803781
GSS15 70495 35056603
GSS150 73001 55885898
GSS151 72980 55923055
GSS152 73003 55884410
GSS153 73012 55867886
GSS154 72974 55933784
GSS155 72975 55931660
GSS156 75746 57508467
GSS157 84188 39671144
GSS158 88497 60243153
GSS159 85423 66072049
GSS16 78211 46092545
GSS160 89576 58450208
GSS161 91097 56964571
GSS162 83751 58137930
GSS163 75272 48379997
GSS164 76686 49473805
GSS165 92880 58464618
GSS166 90544 62107010
GSS167 86193 60993545
GSS168 105448 21913276
GSS169 100228 32079057
GSS17 70895 33314865
GSS170 78165 47137437
GSS171 81546 53800073
GSS172 52827 38475521
GSS173 55057 43461796
GSS174 61230 50525779
GSS175 59061 45358805
GSS176 57605 48704458
GSS177 57510 48727432
GSS178 58260 46386337
GSS179 58483 45710427
GSS18 58790 27918205
GSS180 58808 48789028
GSS181 58939 48449872
GSS182 58662 49305810
GSS183 58146 48368777
GSS184 58633 46095421
GSS185 58970 49560633
GSS186 60200 50035409
GSS187 60233 49990161
GSS188 60537 49076431
GSS189 60425 49412464
GSS19 56815 29014985
GSS190 60519 49130559
GSS191 59800 46851176
GSS192 59161 45330534
GSS193 58435 47616303
GSS194 58979 45911156
GSS195 58803 46461011
GSS196 58327 47952997
GSS197 58234 48242987
GSS198 58391 48666037
GSS199 60091 50117826
GSS2 89001 39334201
GSS20 57683 26671031
GSS200 59871 50779607
GSS201 59927 48930652
GSS202 60713 45639948
GSS203 60058 47663683
GSS204 59471 49481643
GSS205 59503 49384420
GSS206 59530 49301780
GSS207 59469 49489017
GSS208 59614 49046142
GSS209 59519 49334984
GSS21 61528 29556817
GSS210 59732 48687410
GSS211 59664 48893740
GSS212 59740 48316779
GSS213 58996 45563433
GSS214 58769 46311284
GSS215 58326 47857333
GSS216 58248 48141484
GSS217 58693 46267925
GSS218 58139 48204748
GSS219 64818 54772318
GSS22 64703 37615575
GSS220 64821 54761365
GSS221 100632 64074005
GSS222 81327 44442958
GSS223 77649 58421636
GSS224 88388 55479305
GSS225 86082 49800504
GSS226 8556 5470135
GSS227 86927 64285938
GSS228 83571 62767381
GSS229 103190 48235401
GSS23 57535 27065281
GSS230 68602 58515612
GSS231 68308 58775390
GSS232 69367 56630089
GSS233 69630 56121775
GSS234 70538 56026304
GSS235 76223 57616520
GSS236 75920 58201422
GSS237 84912 72794085
GSS238 84405 46919386
GSS239 92240 44612495
GSS24 66462 42176233
GSS240 84626 64772119
GSS241 71199 59041478
GSS242 69700 58668372
GSS243 65105 62485870
GSS244 73190 48799974
GSS245 86647 34677964
GSS246 113983 73143890
GSS247 97622 74127357
GSS248 90807 44064839
GSS249 111204 63740039
GSS25 67915 28144005
GSS250 120657 73172960
GSS251 116923 76049143
GSS252 102515 54546033
GSS253 83531 54635709
GSS254 96039 61891757
GSS255 107470 78475732
GSS256 107911 78027865
GSS257 106097 79988105
GSS258 102962 78953277
GSS259 78007 51843931
GSS26 58155 25414083
GSS260 109380 66529531
GSS261 110078 66166852
GSS262 106025 58544471
GSS263 82466 44799370
GSS264 104840 50673285
GSS265 85539 50266682
GSS266 98220 65837235
GSS267 95094 72942412
GSS268 95666 43318174
GSS269 95626 36919297
GSS27 65600 32056279
GSS270 96127 36079147
GSS271 94853 38214812
GSS272 96392 44617425
GSS273 92087 64779829
GSS274 83788 28464438
GSS275 84423 27237613
GSS276 85575 25013885
GSS277 17080 9146704
GSS28 65167 32497043
GSS29 77744 39814762
GSS3 87418 41844418
GSS30 82631 39704812
GSS31 74191 40411366
GSS32 70524 48292061
GSS33 79854 37772089
GSS34 75886 40327031
GSS35 74176 39860902
GSS36 87465 56585034
GSS37 87596 58176577
GSS38 85547 44927547
GSS39 86584 50232157
GSS4 79232 41152022
GSS40 86513 39694114
GSS41 83045 32404639
GSS42 81250 56926619
GSS43 80039 57953625
GSS44 72009 47535577
GSS45 72050 47404489
GSS46 77625 45640911
GSS47 77879 38880433
GSS48 83292 58062763
GSS49 86558 64914904
GSS5 78819 40568447
GSS50 81738 54221296
GSS51 93801 59364095
GSS52 88481 58786823
GSS53 76363 41868292
GSS54 73091 40866002
GSS55 86364 46791928
GSS56 88131 58673192
GSS57 76341 64416395
GSS58 70883 78110690
GSS59 86064 68967261
GSS6 78086 38841516
GSS60 89085 59739583
GSS61 63429 44953283
GSS62 66521 45606239
GSS63 89647 67280606
GSS64 84934 58252730
GSS65 86107 52989495
GSS66 85494 55678120
GSS67 93571 57751945
GSS68 97811 52599294
GSS69 97519 52985673
GSS7 77655 39174950
GSS70 98229 52046408
GSS71 99261 50677143
GSS72 99228 50722555
GSS73 99068 50933758
GSS74 99600 50229224
GSS75 97770 52653369
GSS76 91737 64976218
GSS77 89864 70741742
GSS78 88890 70085729
GSS79 87854 69638744
GSS8 75882 38134392
GSS80 87866 63811061
GSS81 87986 44095006
GSS82 78265 23300260
GSS83 78174 23507057
GSS84 83849 49951306
GSS85 77498 45025682
GSS86 88958 56326528
GSS87 84258 58535399
GSS88 76274 77068500
GSS89 79320 72648843
GSS9 72242 37164759
GSS90 84603 46674523
GSS91 84675 49187527
GSS92 75664 41948908
GSS93 79233 56954895
GSS94 77457 56454526
GSS95 81278 53744179
GSS96 84901 58216342
GSS97 85348 57694130
GSS98 87356 52204150
GSS99 82025 67866313
HTC1 24998 26954535
HTC10 64337 86935230
HTC11 67142 59770354
HTC12 75872 74225593
HTC13 2258 1360644
HTC2 15993 36013431
HTC3 15970 36547861
HTC4 16191 35357336
HTC5 15927 40313070
HTC6 16010 37271080
HTC7 51171 28266248
HTC8 81749 62831078
HTC9 74467 69785771
HTG1 1318 188929277
HTG10 1300 186477873
HTG100 1110 192846639
HTG101 1064 192789580
HTG102 1062 188155746
HTG103 1098 191736808
HTG104 1239 191113946
HTG105 1197 191581300
HTG106 1365 191063773
HTG107 176 14476447
HTG11 1452 184100451
HTG12 875 191896857
HTG13 750 192365866
HTG14 744 192188335
HTG15 781 192139581
HTG16 803 192026419
HTG17 768 192399151
HTG18 2064 171146175
HTG19 1066 188031360
HTG2 2465 186071856
HTG20 970 189530122
HTG21 784 191984192
HTG22 924 190372575
HTG23 902 190702795
HTG24 809 191533381
HTG25 778 192201563
HTG26 866 191415656
HTG27 883 190754720
HTG28 951 189996953
HTG29 897 191115019
HTG3 2517 185290576
HTG30 928 190505680
HTG31 872 191472053
HTG32 967 189748433
HTG33 880 191207376
HTG34 864 191529591
HTG35 822 191983367
HTG36 944 190044431
HTG37 931 190863324
HTG38 937 190512918
HTG39 1035 189391231
HTG4 2553 188532563
HTG40 1186 187380337
HTG41 1275 188125558
HTG42 1175 188312185
HTG43 1155 187706334
HTG44 1111 191453647
HTG45 1285 190767290
HTG46 1170 191030285
HTG47 1133 191353679
HTG48 1037 191233229
HTG49 940 189533426
HTG5 1284 185715991
HTG50 1068 189746893
HTG51 885 189669477
HTG52 1058 189788175
HTG53 912 189650289
HTG54 1023 189868116
HTG55 970 189657941
HTG56 1000 189305795
HTG57 1018 189817931
HTG58 985 189536109
HTG59 1139 185866207
HTG6 1274 185234665
HTG60 1041 189024120
HTG61 996 189183175
HTG62 1006 188904360
HTG63 1004 189086418
HTG64 1118 189055975
HTG65 1168 186880999
HTG66 1292 184529152
HTG67 1220 185520405
HTG68 1245 184707370
HTG69 1248 184741800
HTG7 1277 185414872
HTG70 1287 186904293
HTG71 1229 187244731
HTG72 1222 189827578
HTG73 1117 191007537
HTG74 1205 191631309
HTG75 1130 190872859
HTG76 1181 191075470
HTG77 1141 190702271
HTG78 1175 190730465
HTG79 1194 190481218
HTG8 1459 184762119
HTG80 1118 190636518
HTG81 1131 190783384
HTG82 1330 186789069
HTG83 1213 191220116
HTG84 1200 191211251
HTG85 1139 191465019
HTG86 1164 191687528
HTG87 1255 191368226
HTG88 1160 191723111
HTG89 1181 191957088
HTG9 1200 186999351
HTG90 1177 191993869
HTG91 1229 191070751
HTG92 1301 190706783
HTG93 1342 190470653
HTG94 1180 189854832
HTG95 1098 187410651
HTG96 1605 187202082
HTG97 959 193619541
HTG98 743 169175019
HTG99 1093 194093698
INV1 43586 121556191
INV10 87373 65019858
INV11 40166 105456713
INV12 27 58965
INV2 1635 181230943
INV3 975 145012151
INV4 70857 80761057
INV5 60692 87899819
INV6 38101 107266518
INV7 81349 71938775
INV8 62502 86671397
INV9 83440 66022560
MAM1 12037 166699525
MAM2 71587 74736255
MAM3 49695 116608842
MAM4 24198 22370259
PAT1 222610 70141260
PAT10 125437 99518322
PAT11 141739 62608396
PAT12 105795 59941764
PAT13 103555 50226564
PAT14 121472 53274905
PAT15 113046 61292248
PAT16 145018 54899867
PAT17 155517 69893240
PAT18 97490 122598017
PAT19 147594 87373130
PAT2 194518 84655123
PAT20 117407 104542066
PAT21 123717 103465007
PAT22 119286 106149134
PAT23 140192 91319413
PAT24 203990 39164825
PAT25 101745 75139475
PAT26 95444 84263317
PAT27 116944 64735334
PAT28 96529 83259841
PAT29 115325 61768127
PAT3 171984 95898893
PAT30 131596 79586043
PAT31 142405 110766890
PAT32 152887 106220056
PAT33 167360 80194181
PAT34 251170 21866376
PAT35 12585 3035990
PAT4 153750 106059356
PAT5 184018 85619906
PAT6 156356 93378118
PAT7 152402 81705440
PAT8 104672 119401279
PAT9 143543 89226955
PHG 3705 26690104
PLN1 53258 100182067
PLN10 23994 118742562
PLN11 17732 145616275
PLN12 17596 146891793
PLN13 17660 146650172
PLN14 14956 147881188
PLN15 1267 166534271
PLN16 903 196315207
PLN17 6 190239137
PLN18 20812 137822847
PLN19 68368 70127647
PLN2 1470 168222590
PLN20 74616 79706153
PLN21 68381 81175708
PLN22 9353 140911123
PLN23 54165 99422705
PLN24 76612 78223721
PLN25 98707 56469480
PLN26 79887 73292174
PLN27 69394 84717973
PLN28 11881 25611516
PLN3 1640 182594773
PLN4 1972 193114287
PLN5 53588 95898012
PLN6 74302 79521432
PLN7 65750 61736595
PLN8 32829 55871234
PLN9 18509 128744339
PRI1 32877 118057234
PRI10 1458 182828344
PRI11 1275 179102729
PRI12 1455 178145178
PRI13 1589 179925322
PRI14 1605 182184488
PRI15 1269 192101792
PRI16 1138 193927573
PRI17 1102 194288790
PRI18 1229 193682232
PRI19 27581 145243103
PRI2 1635 172547772
PRI20 61124 101865446
PRI21 41357 80143979
PRI22 9556 164528441
PRI23 2295 184271577
PRI24 1640 185072688
PRI25 2061 185618960
PRI26 2037 184492506
PRI27 12520 158263147
PRI28 1296 183396049
PRI29 52266 94426016
PRI3 1308 183753298
PRI30 37959 70555068
PRI31 22122 108362933
PRI32 19731 151128477
PRI33 69211 85339899
PRI34 70200 81992739
PRI35 15818 44629045
PRI4 1344 185301440
PRI5 1196 181253772
PRI6 1186 178995588
PRI7 1236 181211623
PRI8 1317 176088268
PRI9 1244 175205631
ROD1 29188 145499631
ROD10 980 181694515
ROD11 1033 186095339
ROD12 952 183263796
ROD13 1031 189111133
ROD14 952 180537245
ROD15 966 181882767
ROD16 1005 186310817
ROD17 13404 169737403
ROD18 23701 147164816
ROD19 1161 187087187
ROD2 912 174997582
ROD20 1203 186469926
ROD21 20434 154678513
ROD22 35295 68824460
ROD23 12725 145165327
ROD24 34533 153741262
ROD25 138661 30557089
ROD26 22358 26611853
ROD3 913 173539554
ROD4 905 174156111
ROD5 929 174172738
ROD6 982 179706073
ROD7 957 179974440
ROD8 994 182004678
ROD9 1004 182710197
STS1 84288 36163014
STS10 57827 44849140
STS11 57929 43635606
STS12 64448 43031914
STS13 86556 36773249
STS14 71502 31305760
STS2 83979 48150828
STS3 69755 27454954
STS4 79069 37563049
STS5 54784 32171340
STS6 54866 31897688
STS7 54670 32202285
STS8 55680 35632633
STS9 57901 44447624
SYN1 50366 68354681
SYN2 5488 11863623
UNA 212 114577
VRL1 72291 65772499
VRL2 70270 64743068
VRL3 72305 64117793
VRL4 69215 68554927
VRL5 56399 73558034
VRL6 63443 71535174
VRL7 69086 67240830
VRL8 56926 56739087
VRT1 20487 160881498
VRT10 8983 180505969
VRT11 10105 177287486
VRT12 4646 185687862
VRT13 43374 126939701
VRT14 80598 68720790
VRT15 27549 25611207
VRT2 50391 118927931
VRT3 23381 152060513
VRT4 62010 95795021
VRT5 56063 65946877
VRT6 25515 100427124
VRT7 1213 191664242
VRT8 1273 191154621
VRT9 8266 180128320
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 164.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:
Entries Bases Species
11303126 12894142723 Homo sapiens
7230246 8327335794 Mus musculus
1305619 5775981064 Rattus norvegicus
3172189 4336075669 Zea mays
2059099 3873883323 Bos taurus
1585040 2847364624 Danio rerio
2122719 2473157720 Sus scrofa
1199536 1530420274 Oryza sativa Japonica Group
227868 1352527121 Strongylocentrotus purpuratus
1419721 1139107711 Xenopus tropicalis
212712 982300241 Pan troglodytes
2204459 906821781 Arabidopsis thaliana
772171 906400002 Drosophila melanogaster
802835 866274272 Gallus gallus
530132 838210062 Vitis vinifera
76550 792897169 Macaca mulatta
1221270 700937530 Canis lupus familiaris
1103796 661041882 Triticum aestivum
1011798 660131821 Sorghum bicolor
422581 539861544 Medicago truncatula
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
February 15 2008
NCBI-GenBank Flat File Release 164.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 PROJECT Format
This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
PROJECT GenomeProject:18787
A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second
contains the actual project identifier ("18787").
PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
bits-request@ncbi.nlm.nih.gov
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to
indicate the GenBank release number (e.g., Release 164.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
Andrea Gocke, Anjanette Johnston, Mark Landree, Richard McVeigh,
Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko
Database Administration
Slava Khotomliansky, Ben Slade, Angela Tirone
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
