Release Notes For GenBank Release 166

GBREL.TXT          Genetic Sequence Data Bank
                         June 15 2008

               NCBI-GenBank Flat File Release 166.0

                    Distribution Release Notes

 88554578 loci, 92008611867 bases, from 88554578 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 166.0
1.2 Cutoff Date
1.3 Important Changes in Release 166.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 166.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 166.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov 

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:

	ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/  (Japan)
	ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/  (Korea)
	ftp://bio-mirror.sg.apan.net/biomirrors/genbank/     (Singapore)

1.2 Cutoff Date

  This full release, 166.0, incorporates data available to the collaborating
databases as of June 11, 2008 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 166.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 47 with this release:

  - the TSA division is now comprised of   1 file  (+1)
  - the BCT division is now comprised of  29 files (+1)
  - the CON division is now comprised of  91 files (+6)
  - the EST division is now comprised of 738 files (+25)
  - the ENV division is now comprised of   9 files (+1)
  - the GSS division is now comprised of 290 files (+5)
  - the HTG division is now comprised of 117 files (+3)
  - the PAT division is now comprised of  42 files (+4)
  - the PRI division is now comprised of  36 files (+1)

  The total number of index files increased by 4 with this release:

  - the AUT index is now comprised of  54 files  (+4)

1.3.2 New file for the Transcriptome Shotgun Assembly (TSA) division

  As announced with the previous release, Release 166.0 contains a new
divisional file (gbtsa.seq) for Transcriptome Shotgun Assembly (TSA)
mRNA sequences.

  TSA sequences are shotgun assemblies of primary sequences deposited in
dbEST, the Trace Archive (TA) or the Short-Read Archive (SRA).  Keywords
"TSA" and "Transcriptome Shotgun Assembly" are present on all TSA
records, in addition to a division code value of "TSA" on the LOCUS line.

  No format changes (new or changed line types, features, or qualifiers)
are anticipated for this new class of GenBank record.

  However, note that TSA records make use of the same PRIMARY block that
is utilized for Third-Party Annotation (TPA) records. The PRIMARY block
contains references to the underlying reads/transcripts that were assembled
to construct a TSA record.

  It might be helpful to review the content of TSA record EZ000001 and its
use of the PRIMARY block:

      http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/viewer.fcgi?db=nuccore&id=189498984

Requirements for the new Transcriptome Shotgun Assembly division include:

1. Submission of primary transcipt sequence data to dbEST, the Trace Archive,
   or the Short-Read archive (SRA).  

2. Registration of an associated transcriptome project with the International
   Nucleotide Sequence Database Collaboration (INSDC).

   For information about submitting projects via NCBI/GenBank, see:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/mpfsubmission.cgi

3. Submission of TSA sequence records to GenBank, including an assembly file
   (.ace format)

Note that TSA records and the primary transcript sequences that they are
built from must be provided by the same submitter or collaborative group.

1.3.3 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
fifty-nine of the GSS flatfiles in Release 166.0. Consider gbgss232.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                            June 15 2008

                NCBI-GenBank Flat File Release 166.0

                           GSS Sequences (Part 1)

   87182 loci,    64465152 bases, from    87182 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "232" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 Comprehensive protein FASTA file to be discontinued

  Given the availability of divisional protein FASTA files as of GenBank
Release 164.0, support for the single, large, comprehensive protein FASTA
file:

	ftp://ftp.ncbi.nih.gov/genbank/relNNN.fsa_aa.gz

(where 'NNN' represents a three-digit GenBank release number) will be
discontinued after GenBank Release 166.0 in June of 2008. The size
of this file has grown to exceed 4GB, which is unmanageable for many users.

  Users are advised to make plans to utilize the new divisional files by
August of 2008. The divisional protein FASTA files are located at:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/gbXXX.fsa_aa.gz

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1553 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut6.idx - Index of the entries according to author name, part 6.
55. gbaut7.idx - Index of the entries according to author name, part 7.
56. gbaut8.idx - Index of the entries according to author name, part 8.
57. gbaut9.idx - Index of the entries according to author name, part 9.
58. gbbct1.seq - Bacterial sequence entries, part 1.
59. gbbct10.seq - Bacterial sequence entries, part 10.
60. gbbct11.seq - Bacterial sequence entries, part 11.
61. gbbct12.seq - Bacterial sequence entries, part 12.
62. gbbct13.seq - Bacterial sequence entries, part 13.
63. gbbct14.seq - Bacterial sequence entries, part 14.
64. gbbct15.seq - Bacterial sequence entries, part 15.
65. gbbct16.seq - Bacterial sequence entries, part 16.
66. gbbct17.seq - Bacterial sequence entries, part 17.
67. gbbct18.seq - Bacterial sequence entries, part 18.
68. gbbct19.seq - Bacterial sequence entries, part 19.
69. gbbct2.seq - Bacterial sequence entries, part 2.
70. gbbct20.seq - Bacterial sequence entries, part 20.
71. gbbct21.seq - Bacterial sequence entries, part 21.
72. gbbct22.seq - Bacterial sequence entries, part 22.
73. gbbct23.seq - Bacterial sequence entries, part 23.
74. gbbct24.seq - Bacterial sequence entries, part 24.
75. gbbct25.seq - Bacterial sequence entries, part 25.
76. gbbct26.seq - Bacterial sequence entries, part 26.
77. gbbct27.seq - Bacterial sequence entries, part 27.
78. gbbct28.seq - Bacterial sequence entries, part 28.
79. gbbct29.seq - Bacterial sequence entries, part 29.
80. gbbct3.seq - Bacterial sequence entries, part 3.
81. gbbct4.seq - Bacterial sequence entries, part 4.
82. gbbct5.seq - Bacterial sequence entries, part 5.
83. gbbct6.seq - Bacterial sequence entries, part 6.
84. gbbct7.seq - Bacterial sequence entries, part 7.
85. gbbct8.seq - Bacterial sequence entries, part 8.
86. gbbct9.seq - Bacterial sequence entries, part 9.
87. gbchg.txt - Accession numbers of entries updated since the previous release.
88. gbcon1.seq - Constructed sequence entries, part 1.
89. gbcon10.seq - Constructed sequence entries, part 10.
90. gbcon11.seq - Constructed sequence entries, part 11.
91. gbcon12.seq - Constructed sequence entries, part 12.
92. gbcon13.seq - Constructed sequence entries, part 13.
93. gbcon14.seq - Constructed sequence entries, part 14.
94. gbcon15.seq - Constructed sequence entries, part 15.
95. gbcon16.seq - Constructed sequence entries, part 16.
96. gbcon17.seq - Constructed sequence entries, part 17.
97. gbcon18.seq - Constructed sequence entries, part 18.
98. gbcon19.seq - Constructed sequence entries, part 19.
99. gbcon2.seq - Constructed sequence entries, part 2.
100. gbcon20.seq - Constructed sequence entries, part 20.
101. gbcon21.seq - Constructed sequence entries, part 21.
102. gbcon22.seq - Constructed sequence entries, part 22.
103. gbcon23.seq - Constructed sequence entries, part 23.
104. gbcon24.seq - Constructed sequence entries, part 24.
105. gbcon25.seq - Constructed sequence entries, part 25.
106. gbcon26.seq - Constructed sequence entries, part 26.
107. gbcon27.seq - Constructed sequence entries, part 27.
108. gbcon28.seq - Constructed sequence entries, part 28.
109. gbcon29.seq - Constructed sequence entries, part 29.
110. gbcon3.seq - Constructed sequence entries, part 3.
111. gbcon30.seq - Constructed sequence entries, part 30.
112. gbcon31.seq - Constructed sequence entries, part 31.
113. gbcon32.seq - Constructed sequence entries, part 32.
114. gbcon33.seq - Constructed sequence entries, part 33.
115. gbcon34.seq - Constructed sequence entries, part 34.
116. gbcon35.seq - Constructed sequence entries, part 35.
117. gbcon36.seq - Constructed sequence entries, part 36.
118. gbcon37.seq - Constructed sequence entries, part 37.
119. gbcon38.seq - Constructed sequence entries, part 38.
120. gbcon39.seq - Constructed sequence entries, part 39.
121. gbcon4.seq - Constructed sequence entries, part 4.
122. gbcon40.seq - Constructed sequence entries, part 40.
123. gbcon41.seq - Constructed sequence entries, part 41.
124. gbcon42.seq - Constructed sequence entries, part 42.
125. gbcon43.seq - Constructed sequence entries, part 43.
126. gbcon44.seq - Constructed sequence entries, part 44.
127. gbcon45.seq - Constructed sequence entries, part 45.
128. gbcon46.seq - Constructed sequence entries, part 46.
129. gbcon47.seq - Constructed sequence entries, part 47.
130. gbcon48.seq - Constructed sequence entries, part 48.
131. gbcon49.seq - Constructed sequence entries, part 49.
132. gbcon5.seq - Constructed sequence entries, part 5.
133. gbcon50.seq - Constructed sequence entries, part 50.
134. gbcon51.seq - Constructed sequence entries, part 51.
135. gbcon52.seq - Constructed sequence entries, part 52.
136. gbcon53.seq - Constructed sequence entries, part 53.
137. gbcon54.seq - Constructed sequence entries, part 54.
138. gbcon55.seq - Constructed sequence entries, part 55.
139. gbcon56.seq - Constructed sequence entries, part 56.
140. gbcon57.seq - Constructed sequence entries, part 57.
141. gbcon58.seq - Constructed sequence entries, part 58.
142. gbcon59.seq - Constructed sequence entries, part 59.
143. gbcon6.seq - Constructed sequence entries, part 6.
144. gbcon60.seq - Constructed sequence entries, part 60.
145. gbcon61.seq - Constructed sequence entries, part 61.
146. gbcon62.seq - Constructed sequence entries, part 62.
147. gbcon63.seq - Constructed sequence entries, part 63.
148. gbcon64.seq - Constructed sequence entries, part 64.
149. gbcon65.seq - Constructed sequence entries, part 65.
150. gbcon66.seq - Constructed sequence entries, part 66.
151. gbcon67.seq - Constructed sequence entries, part 67.
152. gbcon68.seq - Constructed sequence entries, part 68.
153. gbcon69.seq - Constructed sequence entries, part 69.
154. gbcon7.seq - Constructed sequence entries, part 7.
155. gbcon70.seq - Constructed sequence entries, part 70.
156. gbcon71.seq - Constructed sequence entries, part 71.
157. gbcon72.seq - Constructed sequence entries, part 72.
158. gbcon73.seq - Constructed sequence entries, part 73.
159. gbcon74.seq - Constructed sequence entries, part 74.
160. gbcon75.seq - Constructed sequence entries, part 75.
161. gbcon76.seq - Constructed sequence entries, part 76.
162. gbcon77.seq - Constructed sequence entries, part 77.
163. gbcon78.seq - Constructed sequence entries, part 78.
164. gbcon79.seq - Constructed sequence entries, part 79.
165. gbcon8.seq - Constructed sequence entries, part 8.
166. gbcon80.seq - Constructed sequence entries, part 80.
167. gbcon81.seq - Constructed sequence entries, part 81.
168. gbcon82.seq - Constructed sequence entries, part 82.
169. gbcon83.seq - Constructed sequence entries, part 83.
170. gbcon84.seq - Constructed sequence entries, part 84.
171. gbcon85.seq - Constructed sequence entries, part 85.
172. gbcon86.seq - Constructed sequence entries, part 86.
173. gbcon87.seq - Constructed sequence entries, part 87.
174. gbcon88.seq - Constructed sequence entries, part 88.
175. gbcon89.seq - Constructed sequence entries, part 89.
176. gbcon9.seq - Constructed sequence entries, part 9.
177. gbcon90.seq - Constructed sequence entries, part 90.
178. gbcon91.seq - Constructed sequence entries, part 91.
179. gbdel.txt - Accession numbers of entries deleted since the previous release.
180. gbenv1.seq - Environmental sampling sequence entries, part 1.
181. gbenv2.seq - Environmental sampling sequence entries, part 2.
182. gbenv3.seq - Environmental sampling sequence entries, part 3.
183. gbenv4.seq - Environmental sampling sequence entries, part 4.
184. gbenv5.seq - Environmental sampling sequence entries, part 5.
185. gbenv6.seq - Environmental sampling sequence entries, part 6.
186. gbenv7.seq - Environmental sampling sequence entries, part 7.
187. gbenv8.seq - Environmental sampling sequence entries, part 8.
188. gbenv9.seq - Environmental sampling sequence entries, part 9.
189. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
190. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
191. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
192. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
193. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
194. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
195. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
196. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
197. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
198. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
199. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
200. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
201. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
202. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
203. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
204. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
205. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
206. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
207. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
208. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
209. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
210. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
211. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
212. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
213. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
214. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
215. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
216. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
217. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
218. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
219. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
220. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
221. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
222. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
223. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
224. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
225. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
226. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
227. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
228. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
229. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
230. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
231. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
232. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
233. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
234. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
235. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
236. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
237. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
238. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
239. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
240. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
241. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
242. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
243. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
244. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
245. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
246. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
247. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
248. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
249. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
250. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
251. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
252. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
253. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
254. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
255. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
256. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
257. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
258. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
259. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
260. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
261. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
262. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
263. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
264. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
265. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
266. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
267. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
268. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
269. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
270. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
271. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
272. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
273. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
274. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
275. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
276. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
277. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
278. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
279. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
280. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
281. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
282. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
283. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
284. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
285. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
286. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
287. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
288. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
289. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
290. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
291. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
292. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
293. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
294. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
295. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
296. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
297. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
298. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
299. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
300. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
301. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
302. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
303. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
304. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
305. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
306. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
307. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
308. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
309. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
310. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
311. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
312. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
313. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
314. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
315. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
316. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
317. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
318. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
319. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
320. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
321. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
322. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
323. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
324. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
325. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
326. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
327. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
328. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
329. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
330. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
331. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
332. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
333. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
334. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
335. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
336. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
337. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
338. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
339. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
340. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
341. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
342. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
343. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
344. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
345. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
346. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
347. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
348. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
349. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
350. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
351. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
352. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
353. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
354. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
355. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
356. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
357. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
358. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
359. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
360. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
361. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
362. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
363. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
364. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
365. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
366. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
367. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
368. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
369. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
370. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
371. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
372. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
373. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
374. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
375. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
376. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
377. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
378. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
379. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
380. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
381. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
382. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
383. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
384. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
385. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
386. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
387. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
388. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
389. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
390. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
391. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
392. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
393. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
394. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
395. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
396. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
397. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
398. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
399. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
400. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
401. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
402. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
403. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
404. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
405. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
406. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
407. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
408. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
409. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
410. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
411. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
412. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
413. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
414. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
415. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
416. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
417. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
418. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
419. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
420. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
421. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
422. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
423. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
424. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
425. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
426. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
427. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
428. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
429. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
430. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
431. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
432. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
433. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
434. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
435. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
436. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
437. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
438. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
439. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
440. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
441. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
442. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
443. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
444. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
445. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
446. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
447. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
448. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
449. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
450. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
451. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
452. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
453. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
454. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
455. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
456. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
457. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
458. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
459. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
460. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
461. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
462. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
463. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
464. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
465. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
466. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
467. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
468. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
469. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
470. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
471. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
472. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
473. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
474. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
475. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
476. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
477. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
478. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
479. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
480. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
481. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
482. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
483. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
484. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
485. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
486. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
487. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
488. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
489. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
490. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
491. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
492. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
493. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
494. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
495. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
496. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
497. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
498. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
499. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
500. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
501. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
502. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
503. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
504. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
505. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
506. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
507. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
508. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
509. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
510. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
511. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
512. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
513. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
514. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
515. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
516. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
517. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
518. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
519. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
520. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
521. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
522. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
523. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
524. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
525. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
526. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
527. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
528. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
529. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
530. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
531. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
532. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
533. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
534. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
535. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
536. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
537. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
538. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
539. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
540. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
541. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
542. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
543. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
544. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
545. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
546. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
547. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
548. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
549. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
550. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
551. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
552. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
553. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
554. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
555. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
556. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
557. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
558. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
559. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
560. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
561. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
562. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
563. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
564. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
565. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
566. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
567. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
568. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
569. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
570. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
571. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
572. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
573. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
574. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
575. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
576. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
577. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
578. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
579. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
580. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
581. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
582. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
583. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
584. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
585. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
586. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
587. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
588. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
589. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
590. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
591. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
592. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
593. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
594. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
595. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
596. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
597. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
598. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
599. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
600. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
601. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
602. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
603. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
604. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
605. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
606. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
607. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
608. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
609. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
610. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
611. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
612. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
613. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
614. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
615. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
616. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
617. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
618. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
619. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
620. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
621. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
622. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
623. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
624. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
625. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
626. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
627. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
628. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
629. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
630. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
631. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
632. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
633. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
634. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
635. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
636. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
637. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
638. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
639. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
640. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
641. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
642. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
643. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
644. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
645. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
646. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
647. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
648. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
649. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
650. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
651. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
652. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
653. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
654. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
655. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
656. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
657. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
658. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
659. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
660. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
661. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
662. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
663. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
664. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
665. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
666. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
667. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
668. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
669. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
670. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
671. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
672. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
673. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
674. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
675. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
676. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
677. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
678. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
679. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
680. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
681. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
682. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
683. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
684. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
685. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
686. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
687. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
688. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
689. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
690. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
691. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
692. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
693. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
694. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
695. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
696. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
697. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
698. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
699. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
700. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
701. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
702. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
703. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
704. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
705. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
706. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
707. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
708. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
709. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
710. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
711. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
712. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
713. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
714. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
715. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
716. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
717. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
718. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
719. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
720. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
721. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
722. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
723. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
724. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
725. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
726. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
727. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
728. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
729. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
730. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
731. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
732. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
733. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
734. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
735. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
736. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
737. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
738. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
739. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
740. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
741. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
742. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
743. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
744. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
745. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
746. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
747. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
748. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
749. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
750. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
751. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
752. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
753. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
754. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
755. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
756. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
757. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
758. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
759. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
760. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
761. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
762. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
763. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
764. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
765. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
766. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
767. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
768. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
769. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
770. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
771. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
772. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
773. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
774. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
775. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
776. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
777. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
778. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
779. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
780. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
781. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
782. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
783. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
784. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
785. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
786. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
787. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
788. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
789. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
790. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
791. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
792. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
793. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
794. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
795. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
796. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
797. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
798. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
799. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
800. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
801. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
802. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
803. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
804. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
805. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
806. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
807. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
808. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
809. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
810. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
811. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
812. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
813. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
814. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
815. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
816. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
817. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
818. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
819. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
820. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
821. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
822. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
823. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
824. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
825. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
826. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
827. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
828. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
829. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
830. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
831. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
832. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
833. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
834. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
835. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
836. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
837. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
838. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
839. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
840. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
841. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
842. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
843. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
844. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
845. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
846. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
847. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
848. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
849. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
850. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
851. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
852. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
853. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
854. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
855. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
856. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
857. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
858. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
859. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
860. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
861. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
862. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
863. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
864. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
865. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
866. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
867. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
868. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
869. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
870. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
871. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
872. gbest714.seq - EST (expressed sequence tag) sequence entries, part 714.
873. gbest715.seq - EST (expressed sequence tag) sequence entries, part 715.
874. gbest716.seq - EST (expressed sequence tag) sequence entries, part 716.
875. gbest717.seq - EST (expressed sequence tag) sequence entries, part 717.
876. gbest718.seq - EST (expressed sequence tag) sequence entries, part 718.
877. gbest719.seq - EST (expressed sequence tag) sequence entries, part 719.
878. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
879. gbest720.seq - EST (expressed sequence tag) sequence entries, part 720.
880. gbest721.seq - EST (expressed sequence tag) sequence entries, part 721.
881. gbest722.seq - EST (expressed sequence tag) sequence entries, part 722.
882. gbest723.seq - EST (expressed sequence tag) sequence entries, part 723.
883. gbest724.seq - EST (expressed sequence tag) sequence entries, part 724.
884. gbest725.seq - EST (expressed sequence tag) sequence entries, part 725.
885. gbest726.seq - EST (expressed sequence tag) sequence entries, part 726.
886. gbest727.seq - EST (expressed sequence tag) sequence entries, part 727.
887. gbest728.seq - EST (expressed sequence tag) sequence entries, part 728.
888. gbest729.seq - EST (expressed sequence tag) sequence entries, part 729.
889. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
890. gbest730.seq - EST (expressed sequence tag) sequence entries, part 730.
891. gbest731.seq - EST (expressed sequence tag) sequence entries, part 731.
892. gbest732.seq - EST (expressed sequence tag) sequence entries, part 732.
893. gbest733.seq - EST (expressed sequence tag) sequence entries, part 733.
894. gbest734.seq - EST (expressed sequence tag) sequence entries, part 734.
895. gbest735.seq - EST (expressed sequence tag) sequence entries, part 735.
896. gbest736.seq - EST (expressed sequence tag) sequence entries, part 736.
897. gbest737.seq - EST (expressed sequence tag) sequence entries, part 737.
898. gbest738.seq - EST (expressed sequence tag) sequence entries, part 738.
899. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
900. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
901. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
902. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
903. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
904. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
905. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
906. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
907. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
908. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
909. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
910. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
911. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
912. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
913. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
914. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
915. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
916. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
917. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
918. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
919. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
920. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
921. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
922. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
923. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
924. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
925. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
926. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
927. gbgen.idx - Index of the entries according to gene symbols.
928. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
929. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
930. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
931. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
932. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
933. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
934. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
935. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
936. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
937. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
938. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
939. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
940. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
941. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
942. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
943. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
944. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
945. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
946. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
947. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
948. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
949. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
950. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
951. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
952. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
953. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
954. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
955. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
956. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
957. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
958. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
959. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
960. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
961. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
962. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
963. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
964. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
965. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
966. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
967. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
968. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
969. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
970. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
971. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
972. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
973. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
974. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
975. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
976. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
977. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
978. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
979. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
980. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
981. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
982. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
983. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
984. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
985. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
986. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
987. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
988. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
989. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
990. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
991. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
992. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
993. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
994. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
995. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
996. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
997. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
998. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
999. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1000. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1001. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1002. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1003. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1004. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1005. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1006. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1007. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1008. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1009. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1010. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1011. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1012. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1013. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1014. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1015. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1016. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1017. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1018. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1019. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1020. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1021. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1022. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1023. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1024. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1025. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1026. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1027. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1028. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1029. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1030. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1031. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1032. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1033. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1034. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1035. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1036. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1037. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1038. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1039. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1040. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1041. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1042. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1043. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1044. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1045. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1046. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1047. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1048. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1049. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1050. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1051. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1052. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1053. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1054. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1055. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1056. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1057. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1058. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1059. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1060. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1061. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1062. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1063. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1064. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1065. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1066. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1067. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1068. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1069. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1070. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1071. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1072. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1073. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1074. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1075. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1076. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1077. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1078. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1079. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1080. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1081. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1082. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1083. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1084. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1085. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1086. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1087. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1088. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1089. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1090. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1091. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1092. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1093. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1094. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1095. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1096. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1097. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1098. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1099. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1100. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1101. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1102. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1103. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1104. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1105. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1106. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1107. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1108. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1109. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1110. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1111. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1112. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1113. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1114. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1115. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1116. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1117. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1118. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1119. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1120. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1121. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1122. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1123. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1124. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1125. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1126. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1127. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1128. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1129. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1130. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1131. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1132. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1133. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1134. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1135. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1136. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1137. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1138. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1139. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1140. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1141. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1142. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1143. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1144. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1145. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1146. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1147. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1148. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1149. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1150. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1151. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1152. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1153. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1154. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1155. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1156. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1157. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1158. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1159. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1160. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1161. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1162. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1163. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1164. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1165. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1166. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1167. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1168. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1169. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1170. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1171. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1172. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1173. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1174. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1175. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1176. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1177. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1178. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1179. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1180. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1181. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1182. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1183. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1184. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1185. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1186. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1187. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1188. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1189. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1190. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1191. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1192. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1193. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1194. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1195. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1196. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1197. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1198. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1199. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1200. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1201. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1202. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1203. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1204. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1205. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1206. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1207. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1208. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1209. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1210. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1211. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1212. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1213. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1214. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1215. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1216. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1217. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1218. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1219. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1220. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1221. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1222. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1223. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1224. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1225. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1226. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1227. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1228. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1229. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1230. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1231. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1232. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1233. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1234. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1235. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1236. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1237. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1238. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1239. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1240. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1241. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1242. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1243. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1244. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1245. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1246. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1247. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1248. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1249. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1250. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1251. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1252. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1253. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1254. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1255. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1256. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1257. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1258. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1259. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1260. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1261. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1262. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1263. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1264. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1265. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1266. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1267. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1268. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1269. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1270. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1271. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1272. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1273. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1274. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1275. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1276. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1277. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1278. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1279. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1280. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1281. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1282. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1283. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1284. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1285. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1286. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1287. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1288. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1289. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1290. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1291. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1292. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1293. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1294. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1295. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1296. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1297. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1298. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1299. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1300. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1301. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1302. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1303. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1304. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1305. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1306. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1307. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1308. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1309. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1310. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1311. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1312. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1313. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1314. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1315. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1316. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1317. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1318. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1319. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1320. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1321. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1322. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1323. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1324. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1325. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1326. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1327. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1328. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1329. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1330. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1331. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1332. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1333. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1334. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1335. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1336. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1337. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1338. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1339. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1340. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1341. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1342. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1343. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1344. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1345. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1346. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1347. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1348. gbinv1.seq - Invertebrate sequence entries, part 1.
1349. gbinv10.seq - Invertebrate sequence entries, part 10.
1350. gbinv11.seq - Invertebrate sequence entries, part 11.
1351. gbinv12.seq - Invertebrate sequence entries, part 12.
1352. gbinv2.seq - Invertebrate sequence entries, part 2.
1353. gbinv3.seq - Invertebrate sequence entries, part 3.
1354. gbinv4.seq - Invertebrate sequence entries, part 4.
1355. gbinv5.seq - Invertebrate sequence entries, part 5.
1356. gbinv6.seq - Invertebrate sequence entries, part 6.
1357. gbinv7.seq - Invertebrate sequence entries, part 7.
1358. gbinv8.seq - Invertebrate sequence entries, part 8.
1359. gbinv9.seq - Invertebrate sequence entries, part 9.
1360. gbjou1.idx - Index of the entries according to journal citation, part 1.
1361. gbjou2.idx - Index of the entries according to journal citation, part 2.
1362. gbjou3.idx - Index of the entries according to journal citation, part 3.
1363. gbjou4.idx - Index of the entries according to journal citation, part 4.
1364. gbjou5.idx - Index of the entries according to journal citation, part 5.
1365. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1366. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1367. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1368. gbmam1.seq - Other mammalian sequence entries, part 1.
1369. gbmam2.seq - Other mammalian sequence entries, part 2.
1370. gbmam3.seq - Other mammalian sequence entries, part 3.
1371. gbmam4.seq - Other mammalian sequence entries, part 4.
1372. gbnew.txt - Accession numbers of entries new since the previous release.
1373. gbpat1.seq - Patent sequence entries, part 1.
1374. gbpat10.seq - Patent sequence entries, part 10.
1375. gbpat11.seq - Patent sequence entries, part 11.
1376. gbpat12.seq - Patent sequence entries, part 12.
1377. gbpat13.seq - Patent sequence entries, part 13.
1378. gbpat14.seq - Patent sequence entries, part 14.
1379. gbpat15.seq - Patent sequence entries, part 15.
1380. gbpat16.seq - Patent sequence entries, part 16.
1381. gbpat17.seq - Patent sequence entries, part 17.
1382. gbpat18.seq - Patent sequence entries, part 18.
1383. gbpat19.seq - Patent sequence entries, part 19.
1384. gbpat2.seq - Patent sequence entries, part 2.
1385. gbpat20.seq - Patent sequence entries, part 20.
1386. gbpat21.seq - Patent sequence entries, part 21.
1387. gbpat22.seq - Patent sequence entries, part 22.
1388. gbpat23.seq - Patent sequence entries, part 23.
1389. gbpat24.seq - Patent sequence entries, part 24.
1390. gbpat25.seq - Patent sequence entries, part 25.
1391. gbpat26.seq - Patent sequence entries, part 26.
1392. gbpat27.seq - Patent sequence entries, part 27.
1393. gbpat28.seq - Patent sequence entries, part 28.
1394. gbpat29.seq - Patent sequence entries, part 29.
1395. gbpat3.seq - Patent sequence entries, part 3.
1396. gbpat30.seq - Patent sequence entries, part 30.
1397. gbpat31.seq - Patent sequence entries, part 31.
1398. gbpat32.seq - Patent sequence entries, part 32.
1399. gbpat33.seq - Patent sequence entries, part 33.
1400. gbpat34.seq - Patent sequence entries, part 34.
1401. gbpat35.seq - Patent sequence entries, part 35.
1402. gbpat36.seq - Patent sequence entries, part 36.
1403. gbpat37.seq - Patent sequence entries, part 37.
1404. gbpat38.seq - Patent sequence entries, part 38.
1405. gbpat39.seq - Patent sequence entries, part 39.
1406. gbpat4.seq - Patent sequence entries, part 4.
1407. gbpat40.seq - Patent sequence entries, part 40.
1408. gbpat41.seq - Patent sequence entries, part 41.
1409. gbpat42.seq - Patent sequence entries, part 42.
1410. gbpat5.seq - Patent sequence entries, part 5.
1411. gbpat6.seq - Patent sequence entries, part 6.
1412. gbpat7.seq - Patent sequence entries, part 7.
1413. gbpat8.seq - Patent sequence entries, part 8.
1414. gbpat9.seq - Patent sequence entries, part 9.
1415. gbphg.seq - Phage sequence entries.
1416. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1417. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1418. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1419. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1420. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1421. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1422. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1423. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1424. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1425. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1426. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1427. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1428. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1429. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1430. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1431. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1432. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1433. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1434. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1435. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1436. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1437. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1438. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1439. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1440. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1441. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1442. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1443. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1444. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1445. gbpri1.seq - Primate sequence entries, part 1.
1446. gbpri10.seq - Primate sequence entries, part 10.
1447. gbpri11.seq - Primate sequence entries, part 11.
1448. gbpri12.seq - Primate sequence entries, part 12.
1449. gbpri13.seq - Primate sequence entries, part 13.
1450. gbpri14.seq - Primate sequence entries, part 14.
1451. gbpri15.seq - Primate sequence entries, part 15.
1452. gbpri16.seq - Primate sequence entries, part 16.
1453. gbpri17.seq - Primate sequence entries, part 17.
1454. gbpri18.seq - Primate sequence entries, part 18.
1455. gbpri19.seq - Primate sequence entries, part 19.
1456. gbpri2.seq - Primate sequence entries, part 2.
1457. gbpri20.seq - Primate sequence entries, part 20.
1458. gbpri21.seq - Primate sequence entries, part 21.
1459. gbpri22.seq - Primate sequence entries, part 22.
1460. gbpri23.seq - Primate sequence entries, part 23.
1461. gbpri24.seq - Primate sequence entries, part 24.
1462. gbpri25.seq - Primate sequence entries, part 25.
1463. gbpri26.seq - Primate sequence entries, part 26.
1464. gbpri27.seq - Primate sequence entries, part 27.
1465. gbpri28.seq - Primate sequence entries, part 28.
1466. gbpri29.seq - Primate sequence entries, part 29.
1467. gbpri3.seq - Primate sequence entries, part 3.
1468. gbpri30.seq - Primate sequence entries, part 30.
1469. gbpri31.seq - Primate sequence entries, part 31.
1470. gbpri32.seq - Primate sequence entries, part 32.
1471. gbpri33.seq - Primate sequence entries, part 33.
1472. gbpri34.seq - Primate sequence entries, part 34.
1473. gbpri35.seq - Primate sequence entries, part 35.
1474. gbpri36.seq - Primate sequence entries, part 36.
1475. gbpri4.seq - Primate sequence entries, part 4.
1476. gbpri5.seq - Primate sequence entries, part 5.
1477. gbpri6.seq - Primate sequence entries, part 6.
1478. gbpri7.seq - Primate sequence entries, part 7.
1479. gbpri8.seq - Primate sequence entries, part 8.
1480. gbpri9.seq - Primate sequence entries, part 9.
1481. gbrel.txt - Release notes (this document).
1482. gbrod1.seq - Rodent sequence entries, part 1.
1483. gbrod10.seq - Rodent sequence entries, part 10.
1484. gbrod11.seq - Rodent sequence entries, part 11.
1485. gbrod12.seq - Rodent sequence entries, part 12.
1486. gbrod13.seq - Rodent sequence entries, part 13.
1487. gbrod14.seq - Rodent sequence entries, part 14.
1488. gbrod15.seq - Rodent sequence entries, part 15.
1489. gbrod16.seq - Rodent sequence entries, part 16.
1490. gbrod17.seq - Rodent sequence entries, part 17.
1491. gbrod18.seq - Rodent sequence entries, part 18.
1492. gbrod19.seq - Rodent sequence entries, part 19.
1493. gbrod2.seq - Rodent sequence entries, part 2.
1494. gbrod20.seq - Rodent sequence entries, part 20.
1495. gbrod21.seq - Rodent sequence entries, part 21.
1496. gbrod22.seq - Rodent sequence entries, part 22.
1497. gbrod23.seq - Rodent sequence entries, part 23.
1498. gbrod24.seq - Rodent sequence entries, part 24.
1499. gbrod25.seq - Rodent sequence entries, part 25.
1500. gbrod26.seq - Rodent sequence entries, part 26.
1501. gbrod3.seq - Rodent sequence entries, part 3.
1502. gbrod4.seq - Rodent sequence entries, part 4.
1503. gbrod5.seq - Rodent sequence entries, part 5.
1504. gbrod6.seq - Rodent sequence entries, part 6.
1505. gbrod7.seq - Rodent sequence entries, part 7.
1506. gbrod8.seq - Rodent sequence entries, part 8.
1507. gbrod9.seq - Rodent sequence entries, part 9.
1508. gbsdr1.txt - Short directory of the data bank, part 1.
1509. gbsdr2.txt - Short directory of the data bank, part 2.
1510. gbsdr3.txt - Short directory of the data bank, part 3.
1511. gbsec.idx - Index of the entries according to secondary accession number.
1512. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1513. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1514. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1515. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1516. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1517. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1518. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1519. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1520. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1521. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1522. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1523. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1524. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1525. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1526. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1527. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1528. gbtsa.seq - TSA (transcriptome shotgun assembly) sequence entries.
1529. gbuna.seq - Unannotated sequence entries.
1530. gbvrl1.seq - Viral sequence entries, part 1.
1531. gbvrl2.seq - Viral sequence entries, part 2.
1532. gbvrl3.seq - Viral sequence entries, part 3.
1533. gbvrl4.seq - Viral sequence entries, part 4.
1534. gbvrl5.seq - Viral sequence entries, part 5.
1535. gbvrl6.seq - Viral sequence entries, part 6.
1536. gbvrl7.seq - Viral sequence entries, part 7.
1537. gbvrl8.seq - Viral sequence entries, part 8.
1538. gbvrl9.seq - Viral sequence entries, part 9.
1539. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1540. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1541. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1542. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1543. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1544. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1545. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1546. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1547. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1548. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1549. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1550. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1551. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1552. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1553. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 166.0 flatfiles require roughly 343 GB (sequence
files only) or 366 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 739326431     gbacc1.idx
1750396866     gbacc2.idx
 581202012     gbacc3.idx
 188801102     gbaut1.idx
 222024867     gbaut10.idx
 202340903     gbaut11.idx
 183730340     gbaut12.idx
 227353991     gbaut13.idx
 183976302     gbaut14.idx
 185098977     gbaut15.idx
 207166674     gbaut16.idx
 193571756     gbaut17.idx
 209619575     gbaut18.idx
 185139014     gbaut19.idx
 213143613     gbaut2.idx
 206781974     gbaut20.idx
 184405166     gbaut21.idx
 184095266     gbaut22.idx
 183787349     gbaut23.idx
 183773542     gbaut24.idx
 185657873     gbaut25.idx
 184165447     gbaut26.idx
 185867865     gbaut27.idx
 183637212     gbaut28.idx
 183802535     gbaut29.idx
 228694331     gbaut3.idx
 184178897     gbaut30.idx
 184804545     gbaut31.idx
 230761361     gbaut32.idx
 183690532     gbaut33.idx
 183483998     gbaut34.idx
 185781805     gbaut35.idx
 218775885     gbaut36.idx
 184701480     gbaut37.idx
 183869970     gbaut38.idx
 185828107     gbaut39.idx
 188224649     gbaut4.idx
 189616243     gbaut40.idx
 185024421     gbaut41.idx
 183867940     gbaut42.idx
 190071561     gbaut43.idx
 185100649     gbaut44.idx
 214227286     gbaut45.idx
 208444005     gbaut46.idx
 197532368     gbaut47.idx
 183885844     gbaut48.idx
 191224223     gbaut49.idx
 184258561     gbaut5.idx
 194411090     gbaut50.idx
 185029790     gbaut51.idx
 184492623     gbaut52.idx
 183904228     gbaut53.idx
 111368902     gbaut54.idx
 203232339     gbaut6.idx
 189441425     gbaut7.idx
 186037568     gbaut8.idx
 183801345     gbaut9.idx
 250155760     gbbct1.seq
 255320229     gbbct10.seq
 250545785     gbbct11.seq
 255220272     gbbct12.seq
 252021603     gbbct13.seq
 254073213     gbbct14.seq
 255794368     gbbct15.seq
 255959445     gbbct16.seq
 258576397     gbbct17.seq
 255572149     gbbct18.seq
 252061411     gbbct19.seq
 253338622     gbbct2.seq
 255006423     gbbct20.seq
 252084333     gbbct21.seq
 261562814     gbbct22.seq
 258952172     gbbct23.seq
 260863995     gbbct24.seq
 253912537     gbbct25.seq
 256493234     gbbct26.seq
 250001584     gbbct27.seq
 250001152     gbbct28.seq
 245988743     gbbct29.seq
 260920173     gbbct3.seq
 250000899     gbbct4.seq
 250013854     gbbct5.seq
 252053715     gbbct6.seq
 250002686     gbbct7.seq
 251814711     gbbct8.seq
 256277258     gbbct9.seq
   5698601     gbchg.txt
 250294690     gbcon1.seq
 250001803     gbcon10.seq
 250616317     gbcon11.seq
 250001029     gbcon12.seq
 250000025     gbcon13.seq
 250000738     gbcon14.seq
 250465625     gbcon15.seq
 250000535     gbcon16.seq
 250001156     gbcon17.seq
 250000136     gbcon18.seq
 250001385     gbcon19.seq
 251081424     gbcon2.seq
 250000579     gbcon20.seq
 250000522     gbcon21.seq
 250000197     gbcon22.seq
 250000547     gbcon23.seq
 250000824     gbcon24.seq
 250004923     gbcon25.seq
 250005826     gbcon26.seq
 250001221     gbcon27.seq
 250000173     gbcon28.seq
 250001593     gbcon29.seq
 250062861     gbcon3.seq
 250002541     gbcon30.seq
 250005819     gbcon31.seq
 250004227     gbcon32.seq
 250002238     gbcon33.seq
 250003641     gbcon34.seq
 250003013     gbcon35.seq
 250005720     gbcon36.seq
 250001242     gbcon37.seq
 250003489     gbcon38.seq
 250003450     gbcon39.seq
 250000910     gbcon4.seq
 250001101     gbcon40.seq
 250003432     gbcon41.seq
 250001853     gbcon42.seq
 250005138     gbcon43.seq
 250000052     gbcon44.seq
 250003961     gbcon45.seq
 250002084     gbcon46.seq
 250002187     gbcon47.seq
 250003773     gbcon48.seq
 250002980     gbcon49.seq
 250001001     gbcon5.seq
 250003772     gbcon50.seq
 250002144     gbcon51.seq
 250003349     gbcon52.seq
 250000755     gbcon53.seq
 250001324     gbcon54.seq
 250002116     gbcon55.seq
 250004218     gbcon56.seq
 250002026     gbcon57.seq
 250001093     gbcon58.seq
 250000162     gbcon59.seq
 250001727     gbcon6.seq
 250000610     gbcon60.seq
 250003613     gbcon61.seq
 250004992     gbcon62.seq
 250002921     gbcon63.seq
 250004236     gbcon64.seq
 250004009     gbcon65.seq
 250006698     gbcon66.seq
 250005229     gbcon67.seq
 250001416     gbcon68.seq
 250003902     gbcon69.seq
 250001246     gbcon7.seq
 250002536     gbcon70.seq
 250004862     gbcon71.seq
 250002381     gbcon72.seq
 250000178     gbcon73.seq
 250003188     gbcon74.seq
 250000703     gbcon75.seq
 250000097     gbcon76.seq
 250004436     gbcon77.seq
 250000258     gbcon78.seq
 250001792     gbcon79.seq
 250000157     gbcon8.seq
 250005586     gbcon80.seq
 250001976     gbcon81.seq
 250000012     gbcon82.seq
 250002797     gbcon83.seq
 250002157     gbcon84.seq
 250001117     gbcon85.seq
 250004294     gbcon86.seq
 250003846     gbcon87.seq
 250000911     gbcon88.seq
 250010898     gbcon89.seq
 250285555     gbcon9.seq
 228836987     gbcon90.seq
  21400431     gbcon91.seq
    116721     gbdel.txt
 250001160     gbenv1.seq
 250000337     gbenv2.seq
 250000530     gbenv3.seq
 250001979     gbenv4.seq
 250001571     gbenv5.seq
 250001429     gbenv6.seq
 250000595     gbenv7.seq
 250000717     gbenv8.seq
  61547664     gbenv9.seq
 230688948     gbest1.seq
 230688243     gbest10.seq
 230690231     gbest100.seq
 230688330     gbest101.seq
 230687726     gbest102.seq
 230688230     gbest103.seq
 230687523     gbest104.seq
 230688046     gbest105.seq
 230688940     gbest106.seq
 230687535     gbest107.seq
 230690524     gbest108.seq
 230688809     gbest109.seq
 230688240     gbest11.seq
 230689246     gbest110.seq
 230688671     gbest111.seq
 230687625     gbest112.seq
 230688073     gbest113.seq
 230688888     gbest114.seq
 230688101     gbest115.seq
 230690868     gbest116.seq
 230688986     gbest117.seq
 230689259     gbest118.seq
 229978215     gbest119.seq
 230689913     gbest12.seq
 230688299     gbest120.seq
 230691023     gbest121.seq
 230689667     gbest122.seq
 230688258     gbest123.seq
 230687462     gbest124.seq
 230688557     gbest125.seq
 230688546     gbest126.seq
 230688847     gbest127.seq
 230687958     gbest128.seq
 230690118     gbest129.seq
 230689204     gbest13.seq
 230690427     gbest130.seq
 230690542     gbest131.seq
 230688036     gbest132.seq
 230687817     gbest133.seq
 227395785     gbest134.seq
 230689755     gbest135.seq
 230690037     gbest136.seq
 230688570     gbest137.seq
 230690079     gbest138.seq
 230688347     gbest139.seq
 230690612     gbest14.seq
 230687735     gbest140.seq
 230688150     gbest141.seq
 230690167     gbest142.seq
 230690859     gbest143.seq
 230690006     gbest144.seq
 230691366     gbest145.seq
 230689313     gbest146.seq
 230691431     gbest147.seq
 230688227     gbest148.seq
 230689831     gbest149.seq
 230690090     gbest15.seq
 230689555     gbest150.seq
 230687848     gbest151.seq
 230689537     gbest152.seq
 230687823     gbest153.seq
 230689842     gbest154.seq
 230688284     gbest155.seq
 230689900     gbest156.seq
 230689166     gbest157.seq
 230688580     gbest158.seq
 230690328     gbest159.seq
 230689082     gbest16.seq
 230688722     gbest160.seq
 230690428     gbest161.seq
 230688537     gbest162.seq
 230688702     gbest163.seq
 230689417     gbest164.seq
 230688436     gbest165.seq
 230688528     gbest166.seq
 230689852     gbest167.seq
 230689791     gbest168.seq
 230688651     gbest169.seq
 230688017     gbest17.seq
 230687930     gbest170.seq
 230689614     gbest171.seq
 230690148     gbest172.seq
 230688308     gbest173.seq
 230687636     gbest174.seq
 230688966     gbest175.seq
 230687663     gbest176.seq
 230688552     gbest177.seq
 230687550     gbest178.seq
 230688427     gbest179.seq
 230689140     gbest18.seq
 228448947     gbest180.seq
 230688682     gbest181.seq
 230687472     gbest182.seq
 230690694     gbest183.seq
 230688767     gbest184.seq
 230690691     gbest185.seq
 230689103     gbest186.seq
 230687989     gbest187.seq
 230334034     gbest188.seq
 230687551     gbest189.seq
 230690352     gbest19.seq
 230689454     gbest190.seq
 230689875     gbest191.seq
 230687691     gbest192.seq
 230687895     gbest193.seq
 230689619     gbest194.seq
 230689549     gbest195.seq
 230687671     gbest196.seq
 230687881     gbest197.seq
 230687527     gbest198.seq
 230688005     gbest199.seq
 230689740     gbest2.seq
 230688164     gbest20.seq
 230687666     gbest200.seq
 230690378     gbest201.seq
 230690677     gbest202.seq
 230689852     gbest203.seq
 230690376     gbest204.seq
 230690224     gbest205.seq
 230691153     gbest206.seq
 230690410     gbest207.seq
 230688653     gbest208.seq
 230689706     gbest209.seq
 230691927     gbest21.seq
 230688327     gbest210.seq
 230689335     gbest211.seq
 230688029     gbest212.seq
 230689376     gbest213.seq
 230688766     gbest214.seq
 230688481     gbest215.seq
 230688930     gbest216.seq
 230689145     gbest217.seq
 230688566     gbest218.seq
 230689331     gbest219.seq
 230687537     gbest22.seq
 230688098     gbest220.seq
 230688457     gbest221.seq
 230689974     gbest222.seq
 230687861     gbest223.seq
 230688291     gbest224.seq
 230687850     gbest225.seq
 230687993     gbest226.seq
 230688817     gbest227.seq
 230688366     gbest228.seq
 230690675     gbest229.seq
 230689526     gbest23.seq
 164014341     gbest230.seq
 161152572     gbest231.seq
 165440887     gbest232.seq
 168359856     gbest233.seq
 168550662     gbest234.seq
 163015882     gbest235.seq
 163915623     gbest236.seq
 163247508     gbest237.seq
 163245752     gbest238.seq
 163326322     gbest239.seq
 230689717     gbest24.seq
 163181024     gbest240.seq
 162681132     gbest241.seq
 163192504     gbest242.seq
 165936815     gbest243.seq
 160582078     gbest244.seq
 163068381     gbest245.seq
 167778592     gbest246.seq
 165838066     gbest247.seq
 164467330     gbest248.seq
 164597732     gbest249.seq
 230690253     gbest25.seq
 164240174     gbest250.seq
 163751454     gbest251.seq
 163044643     gbest252.seq
 163140851     gbest253.seq
 164432003     gbest254.seq
 169123647     gbest255.seq
 177406448     gbest256.seq
 170391546     gbest257.seq
 226391997     gbest258.seq
 230690481     gbest259.seq
 230688262     gbest26.seq
 230687919     gbest260.seq
 230689747     gbest261.seq
 230688621     gbest262.seq
 230690257     gbest263.seq
 230689946     gbest264.seq
 230690236     gbest265.seq
 230688249     gbest266.seq
 230688897     gbest267.seq
 230690004     gbest268.seq
 230687745     gbest269.seq
 230690226     gbest27.seq
 230689049     gbest270.seq
 230689909     gbest271.seq
 230689315     gbest272.seq
 230688276     gbest273.seq
 230687814     gbest274.seq
 230687949     gbest275.seq
 230691690     gbest276.seq
 230688442     gbest277.seq
 230690205     gbest278.seq
 230689220     gbest279.seq
 230688467     gbest28.seq
 230688523     gbest280.seq
 230690422     gbest281.seq
 230688501     gbest282.seq
 230688880     gbest283.seq
 230688536     gbest284.seq
 230689832     gbest285.seq
 230688525     gbest286.seq
 230687589     gbest287.seq
 230690723     gbest288.seq
 215315603     gbest289.seq
 230687512     gbest29.seq
 230688627     gbest290.seq
 230689929     gbest291.seq
 230692367     gbest292.seq
 230687603     gbest293.seq
 230690080     gbest294.seq
 230687447     gbest295.seq
 230692337     gbest296.seq
 230688008     gbest297.seq
 230688379     gbest298.seq
 230687462     gbest299.seq
 230690712     gbest3.seq
 230689476     gbest30.seq
 230689228     gbest300.seq
 230688441     gbest301.seq
 230688592     gbest302.seq
 230688086     gbest303.seq
 230689141     gbest304.seq
 230689712     gbest305.seq
 230687922     gbest306.seq
 230692669     gbest307.seq
 230688450     gbest308.seq
 230688925     gbest309.seq
 230688948     gbest31.seq
 230690929     gbest310.seq
 230689130     gbest311.seq
 230688856     gbest312.seq
 230690922     gbest313.seq
 230688869     gbest314.seq
 230689667     gbest315.seq
 230689318     gbest316.seq
 230690294     gbest317.seq
 230689043     gbest318.seq
 230689366     gbest319.seq
 230690102     gbest32.seq
 230689488     gbest320.seq
 230689792     gbest321.seq
 230688281     gbest322.seq
 230688019     gbest323.seq
 230689585     gbest324.seq
 230688508     gbest325.seq
 230689510     gbest326.seq
 230690178     gbest327.seq
 230689075     gbest328.seq
 230688048     gbest329.seq
 230688304     gbest33.seq
 230688616     gbest330.seq
 230688573     gbest331.seq
 230688766     gbest332.seq
 230689451     gbest333.seq
 230688134     gbest334.seq
 230687755     gbest335.seq
 230688983     gbest336.seq
 230688950     gbest337.seq
 230689424     gbest338.seq
 230689560     gbest339.seq
 230687739     gbest34.seq
 224823026     gbest340.seq
 220125717     gbest341.seq
 230688312     gbest342.seq
 230689209     gbest343.seq
 230688921     gbest344.seq
 230691236     gbest345.seq
 230689409     gbest346.seq
 178828736     gbest347.seq
 152184915     gbest348.seq
 230689940     gbest349.seq
 230688601     gbest35.seq
 230690674     gbest350.seq
 230688838     gbest351.seq
 230690147     gbest352.seq
 230688978     gbest353.seq
 230689467     gbest354.seq
 230688492     gbest355.seq
 230689001     gbest356.seq
 230690524     gbest357.seq
 230687493     gbest358.seq
 230689163     gbest359.seq
 230687639     gbest36.seq
 230691452     gbest360.seq
 230689145     gbest361.seq
 230690834     gbest362.seq
 230689842     gbest363.seq
 230688051     gbest364.seq
 230690431     gbest365.seq
 230688891     gbest366.seq
 230688470     gbest367.seq
 230688135     gbest368.seq
 230690870     gbest369.seq
 230687935     gbest37.seq
 222090467     gbest370.seq
 230691013     gbest371.seq
 230688523     gbest372.seq
 230689944     gbest373.seq
 230689934     gbest374.seq
 230689162     gbest375.seq
 230688850     gbest376.seq
 230687679     gbest377.seq
 230690255     gbest378.seq
 230687916     gbest379.seq
 230689184     gbest38.seq
 230689395     gbest380.seq
 230690314     gbest381.seq
 230690492     gbest382.seq
 230688902     gbest383.seq
 230688451     gbest384.seq
 230688457     gbest385.seq
 230687484     gbest386.seq
 230689312     gbest387.seq
 230688886     gbest388.seq
 230687930     gbest389.seq
 230688446     gbest39.seq
 230688878     gbest390.seq
 230688011     gbest391.seq
 230688896     gbest392.seq
 230689194     gbest393.seq
 230688891     gbest394.seq
 230687861     gbest395.seq
 230689032     gbest396.seq
 230687871     gbest397.seq
 230688254     gbest398.seq
 222413328     gbest399.seq
 230689469     gbest4.seq
 230690233     gbest40.seq
 230691091     gbest400.seq
 230688733     gbest401.seq
 230688224     gbest402.seq
 230690297     gbest403.seq
 230687562     gbest404.seq
 230690364     gbest405.seq
 230689270     gbest406.seq
 230687669     gbest407.seq
 230689528     gbest408.seq
 230687494     gbest409.seq
 230688807     gbest41.seq
 230687577     gbest410.seq
 230689539     gbest411.seq
 230688576     gbest412.seq
 230688899     gbest413.seq
 230689545     gbest414.seq
 230690022     gbest415.seq
 230688663     gbest416.seq
 230692108     gbest417.seq
 230688412     gbest418.seq
 230689825     gbest419.seq
 230689046     gbest42.seq
 230691615     gbest420.seq
 230689197     gbest421.seq
 230693902     gbest422.seq
 230687732     gbest423.seq
 214370619     gbest424.seq
 208304807     gbest425.seq
 208244605     gbest426.seq
 208409205     gbest427.seq
 208319110     gbest428.seq
 208503897     gbest429.seq
 230689095     gbest43.seq
 208847611     gbest430.seq
 210045290     gbest431.seq
 209586986     gbest432.seq
 209195237     gbest433.seq
 212328657     gbest434.seq
 209707850     gbest435.seq
 208740813     gbest436.seq
 208763936     gbest437.seq
 208905330     gbest438.seq
 208227781     gbest439.seq
 230688584     gbest44.seq
 208259099     gbest440.seq
 208314491     gbest441.seq
 208083767     gbest442.seq
 210842358     gbest443.seq
 230689136     gbest444.seq
 230689898     gbest445.seq
 230689220     gbest446.seq
 230690284     gbest447.seq
 230687582     gbest448.seq
 230690355     gbest449.seq
 230687808     gbest45.seq
 230689258     gbest450.seq
 230688402     gbest451.seq
 230690218     gbest452.seq
 230687928     gbest453.seq
 230688766     gbest454.seq
 230689327     gbest455.seq
 230688204     gbest456.seq
 230688648     gbest457.seq
 230688914     gbest458.seq
 230689301     gbest459.seq
 211192662     gbest46.seq
 230688247     gbest460.seq
 230689835     gbest461.seq
 230690646     gbest462.seq
 230687784     gbest463.seq
 230688057     gbest464.seq
 230688152     gbest465.seq
 230688725     gbest466.seq
 230688148     gbest467.seq
 230688752     gbest468.seq
 230691169     gbest469.seq
 188827655     gbest47.seq
 230689422     gbest470.seq
 230691620     gbest471.seq
 230689064     gbest472.seq
 230688073     gbest473.seq
 230687836     gbest474.seq
 230688561     gbest475.seq
 230690177     gbest476.seq
 230690940     gbest477.seq
 230689236     gbest478.seq
 230687681     gbest479.seq
 191189792     gbest48.seq
 230687636     gbest480.seq
 230690918     gbest481.seq
 230690904     gbest482.seq
 230689789     gbest483.seq
 230687994     gbest484.seq
 230688738     gbest485.seq
 230689735     gbest486.seq
 230691045     gbest487.seq
 230689455     gbest488.seq
 230688596     gbest489.seq
 214994154     gbest49.seq
 230690272     gbest490.seq
 230689911     gbest491.seq
 230687829     gbest492.seq
 230690052     gbest493.seq
 230687981     gbest494.seq
 230688944     gbest495.seq
 230687642     gbest496.seq
 230689899     gbest497.seq
 230689980     gbest498.seq
 230689120     gbest499.seq
 164140234     gbest5.seq
 214892628     gbest50.seq
 230690195     gbest500.seq
 230689574     gbest501.seq
 230691451     gbest502.seq
 230687790     gbest503.seq
 230688706     gbest504.seq
 230688001     gbest505.seq
 230691696     gbest506.seq
 230690093     gbest507.seq
 230689230     gbest508.seq
 230689618     gbest509.seq
 215011069     gbest51.seq
 230690047     gbest510.seq
 230689127     gbest511.seq
 230688448     gbest512.seq
 230688911     gbest513.seq
 230689221     gbest514.seq
 230689067     gbest515.seq
 230688752     gbest516.seq
 230687727     gbest517.seq
 225015225     gbest518.seq
 230690573     gbest519.seq
 215524678     gbest52.seq
 230688011     gbest520.seq
 230690640     gbest521.seq
 230688185     gbest522.seq
 230688869     gbest523.seq
 230687486     gbest524.seq
 230687717     gbest525.seq
 230688859     gbest526.seq
 230689344     gbest527.seq
 230688347     gbest528.seq
 230688226     gbest529.seq
 230688613     gbest53.seq
 230688287     gbest530.seq
 230689755     gbest531.seq
 230689410     gbest532.seq
 198187698     gbest533.seq
 196049962     gbest534.seq
 230688402     gbest535.seq
 230687783     gbest536.seq
 230690335     gbest537.seq
 230690254     gbest538.seq
 230690272     gbest539.seq
 230688979     gbest54.seq
 230689531     gbest540.seq
 230687993     gbest541.seq
 230687467     gbest542.seq
 230689495     gbest543.seq
 230689630     gbest544.seq
 230688747     gbest545.seq
 230688520     gbest546.seq
 230689997     gbest547.seq
 222462985     gbest548.seq
 230689774     gbest549.seq
 230689117     gbest55.seq
 230687976     gbest550.seq
 230688477     gbest551.seq
 230690254     gbest552.seq
 230690047     gbest553.seq
 230689023     gbest554.seq
 230688543     gbest555.seq
 219599967     gbest556.seq
 230688934     gbest557.seq
 230688973     gbest558.seq
 230688131     gbest559.seq
 219607951     gbest56.seq
 230689572     gbest560.seq
 230688218     gbest561.seq
 230688113     gbest562.seq
 230688549     gbest563.seq
 230689615     gbest564.seq
 230691185     gbest565.seq
 230690504     gbest566.seq
 230689070     gbest567.seq
 230687572     gbest568.seq
 230687485     gbest569.seq
 230689252     gbest57.seq
 230689598     gbest570.seq
 229399812     gbest571.seq
 230688804     gbest572.seq
 230688122     gbest573.seq
 230689237     gbest574.seq
 230690650     gbest575.seq
 230689181     gbest576.seq
 230689458     gbest577.seq
 230689990     gbest578.seq
 230689466     gbest579.seq
 230689059     gbest58.seq
 230688368     gbest580.seq
 230689214     gbest581.seq
 230689339     gbest582.seq
 230689102     gbest583.seq
 230687772     gbest584.seq
 230690759     gbest585.seq
 230687701     gbest586.seq
 230689074     gbest587.seq
 230689655     gbest588.seq
 230689212     gbest589.seq
 230687661     gbest59.seq
 230687611     gbest590.seq
 230688762     gbest591.seq
 224453362     gbest592.seq
 230688386     gbest593.seq
 230687773     gbest594.seq
 230690157     gbest595.seq
 230690159     gbest596.seq
 230687919     gbest597.seq
 230688172     gbest598.seq
 230688871     gbest599.seq
 177421852     gbest6.seq
 230691372     gbest60.seq
 230688226     gbest600.seq
 230691042     gbest601.seq
 230687635     gbest602.seq
 230688155     gbest603.seq
 230688297     gbest604.seq
 230689162     gbest605.seq
 230689754     gbest606.seq
 230688042     gbest607.seq
 230690032     gbest608.seq
 230689598     gbest609.seq
 230689095     gbest61.seq
 230691008     gbest610.seq
 230688429     gbest611.seq
 230689138     gbest612.seq
 230688057     gbest613.seq
 230687617     gbest614.seq
 230687879     gbest615.seq
 230687735     gbest616.seq
 230687802     gbest617.seq
 230688032     gbest618.seq
 230688983     gbest619.seq
 230689061     gbest62.seq
 230689439     gbest620.seq
 230687699     gbest621.seq
 230687526     gbest622.seq
 230687930     gbest623.seq
 230690817     gbest624.seq
 230687805     gbest625.seq
 230687458     gbest626.seq
 230690147     gbest627.seq
 230690526     gbest628.seq
 230690380     gbest629.seq
 230688830     gbest63.seq
 222548132     gbest630.seq
 230687442     gbest631.seq
 230688764     gbest632.seq
 230688195     gbest633.seq
 217398812     gbest634.seq
 227104417     gbest635.seq
 230687590     gbest636.seq
 199569642     gbest637.seq
 191352591     gbest638.seq
 190548996     gbest639.seq
 230688398     gbest64.seq
 194292612     gbest640.seq
 190937573     gbest641.seq
 192311296     gbest642.seq
 191257206     gbest643.seq
 193337227     gbest644.seq
 191781979     gbest645.seq
 191097596     gbest646.seq
 195091275     gbest647.seq
 230687623     gbest648.seq
 230688762     gbest649.seq
 230690141     gbest65.seq
 230687997     gbest650.seq
 230691150     gbest651.seq
 230688433     gbest652.seq
 230687887     gbest653.seq
 228946710     gbest654.seq
 175928962     gbest655.seq
 229120072     gbest656.seq
 230687551     gbest657.seq
 230689680     gbest658.seq
 230688853     gbest659.seq
 230689912     gbest66.seq
 230688206     gbest660.seq
 230687484     gbest661.seq
 230688398     gbest662.seq
 230688943     gbest663.seq
 230688882     gbest664.seq
 230687777     gbest665.seq
 230689083     gbest666.seq
 230688606     gbest667.seq
 230688192     gbest668.seq
 230687509     gbest669.seq
 230689028     gbest67.seq
 230688327     gbest670.seq
 230687961     gbest671.seq
 230690293     gbest672.seq
 230688399     gbest673.seq
 230688670     gbest674.seq
 230689075     gbest675.seq
 230688911     gbest676.seq
 230690307     gbest677.seq
 230689176     gbest678.seq
 230688510     gbest679.seq
 230691169     gbest68.seq
 230688653     gbest680.seq
 230689931     gbest681.seq
 230689496     gbest682.seq
 230688368     gbest683.seq
 230690140     gbest684.seq
 230689764     gbest685.seq
 230691507     gbest686.seq
 230687840     gbest687.seq
 230688385     gbest688.seq
 230690027     gbest689.seq
 230688775     gbest69.seq
 230689131     gbest690.seq
 230689415     gbest691.seq
 230690601     gbest692.seq
 230688649     gbest693.seq
 230690025     gbest694.seq
 230689280     gbest695.seq
 230690541     gbest696.seq
 230688907     gbest697.seq
 230690301     gbest698.seq
 230691014     gbest699.seq
 230687642     gbest7.seq
 230689543     gbest70.seq
 230688489     gbest700.seq
 230687723     gbest701.seq
 230687518     gbest702.seq
 230689775     gbest703.seq
 230691289     gbest704.seq
 230689420     gbest705.seq
 230687972     gbest706.seq
 230690155     gbest707.seq
 230689539     gbest708.seq
 230687769     gbest709.seq
 230688932     gbest71.seq
 230690910     gbest710.seq
 230687998     gbest711.seq
 230690535     gbest712.seq
 230688936     gbest713.seq
 230690152     gbest714.seq
 230688103     gbest715.seq
 205230554     gbest716.seq
 227603638     gbest717.seq
 230688833     gbest718.seq
 230689831     gbest719.seq
 228247970     gbest72.seq
 230688496     gbest720.seq
 230691133     gbest721.seq
 230689409     gbest722.seq
 230690587     gbest723.seq
 230687580     gbest724.seq
 230691341     gbest725.seq
 230689945     gbest726.seq
 230690680     gbest727.seq
 230689080     gbest728.seq
 230687560     gbest729.seq
 208557993     gbest73.seq
 230687876     gbest730.seq
 230690270     gbest731.seq
 230689071     gbest732.seq
 230688006     gbest733.seq
 230689381     gbest734.seq
 230689265     gbest735.seq
 230684714     gbest736.seq
 230688389     gbest737.seq
 101824091     gbest738.seq
 207810011     gbest74.seq
 207560203     gbest75.seq
 207999626     gbest76.seq
 209244040     gbest77.seq
 208341489     gbest78.seq
 207063578     gbest79.seq
 230688273     gbest8.seq
 208762416     gbest80.seq
 209050478     gbest81.seq
 204394706     gbest82.seq
 206105089     gbest83.seq
 206434436     gbest84.seq
 207730604     gbest85.seq
 217289956     gbest86.seq
 230688454     gbest87.seq
 230687926     gbest88.seq
 225147627     gbest89.seq
 230689556     gbest9.seq
 214981936     gbest90.seq
 212261356     gbest91.seq
 225604937     gbest92.seq
 230687454     gbest93.seq
 230689864     gbest94.seq
 230688196     gbest95.seq
 230688584     gbest96.seq
 230687682     gbest97.seq
 230688194     gbest98.seq
 230688551     gbest99.seq
  81689854     gbgen.idx
 230688965     gbgss1.seq
 230690079     gbgss10.seq
 230689183     gbgss100.seq
 227817866     gbgss101.seq
 228816050     gbgss102.seq
 228519687     gbgss103.seq
 228615643     gbgss104.seq
 227731269     gbgss105.seq
 230689722     gbgss106.seq
 230689867     gbgss107.seq
 230688912     gbgss108.seq
 230688409     gbgss109.seq
 230689764     gbgss11.seq
 230687468     gbgss110.seq
 230689467     gbgss111.seq
 230689587     gbgss112.seq
 230688378     gbgss113.seq
 230689636     gbgss114.seq
 230687884     gbgss115.seq
 230689096     gbgss116.seq
 230688113     gbgss117.seq
 230688869     gbgss118.seq
 230687489     gbgss119.seq
 230687679     gbgss12.seq
 230688165     gbgss120.seq
 230689591     gbgss121.seq
 230688989     gbgss122.seq
 230689475     gbgss123.seq
 230688300     gbgss124.seq
 230689896     gbgss125.seq
 230690277     gbgss126.seq
 230687932     gbgss127.seq
 230688873     gbgss128.seq
 230689782     gbgss129.seq
 230690347     gbgss13.seq
 230690054     gbgss130.seq
 230690033     gbgss131.seq
 230688719     gbgss132.seq
 230689747     gbgss133.seq
 230688576     gbgss134.seq
 230689965     gbgss135.seq
 230688728     gbgss136.seq
 230688916     gbgss137.seq
 230689061     gbgss138.seq
 230688304     gbgss139.seq
 230689893     gbgss14.seq
 230689197     gbgss140.seq
 230688921     gbgss141.seq
 230688815     gbgss142.seq
 230688143     gbgss143.seq
 230688800     gbgss144.seq
 224495128     gbgss145.seq
 230689276     gbgss146.seq
 230688235     gbgss147.seq
 195673979     gbgss148.seq
 230690316     gbgss149.seq
 230689648     gbgss15.seq
 230688304     gbgss150.seq
 230688386     gbgss151.seq
 230688470     gbgss152.seq
 230690496     gbgss153.seq
 230688337     gbgss154.seq
 230689648     gbgss155.seq
 230688987     gbgss156.seq
 230687753     gbgss157.seq
 230689348     gbgss158.seq
 230687925     gbgss159.seq
 230689778     gbgss16.seq
 230690016     gbgss160.seq
 230687815     gbgss161.seq
 230687635     gbgss162.seq
 230687711     gbgss163.seq
 230689726     gbgss164.seq
 230688593     gbgss165.seq
 230688195     gbgss166.seq
 230689438     gbgss167.seq
 230687975     gbgss168.seq
 230687744     gbgss169.seq
 230688655     gbgss17.seq
 229163388     gbgss170.seq
 230690136     gbgss171.seq
 230690421     gbgss172.seq
 230687773     gbgss173.seq
 213072893     gbgss174.seq
 207612803     gbgss175.seq
 210343080     gbgss176.seq
 210645462     gbgss177.seq
 209586268     gbgss178.seq
 209277065     gbgss179.seq
 230688580     gbgss18.seq
 207491743     gbgss180.seq
 207265835     gbgss181.seq
 207680359     gbgss182.seq
 209591563     gbgss183.seq
 209301916     gbgss184.seq
 208157107     gbgss185.seq
 205715803     gbgss186.seq
 205673072     gbgss187.seq
 205236847     gbgss188.seq
 205412951     gbgss189.seq
 230688247     gbgss19.seq
 205273767     gbgss190.seq
 206451832     gbgss191.seq
 207550674     gbgss192.seq
 208586602     gbgss193.seq
 207819113     gbgss194.seq
 208047455     gbgss195.seq
 208740788     gbgss196.seq
 208869443     gbgss197.seq
 208622703     gbgss198.seq
 205800882     gbgss199.seq
 230688628     gbgss2.seq
 230689216     gbgss20.seq
 206120994     gbgss200.seq
 206380413     gbgss201.seq
 205439217     gbgss202.seq
 206351402     gbgss203.seq
 207218813     gbgss204.seq
 207181512     gbgss205.seq
 207125415     gbgss206.seq
 207222731     gbgss207.seq
 207012558     gbgss208.seq
 207159248     gbgss209.seq
 230690186     gbgss21.seq
 206838808     gbgss210.seq
 206942425     gbgss211.seq
 206806003     gbgss212.seq
 207734263     gbgss213.seq
 208021711     gbgss214.seq
 209657493     gbgss215.seq
 210072874     gbgss216.seq
 209291791     gbgss217.seq
 210474742     gbgss218.seq
 218859302     gbgss219.seq
 230690133     gbgss22.seq
 218860001     gbgss220.seq
 230689682     gbgss221.seq
 230688775     gbgss222.seq
 230688639     gbgss223.seq
 230688820     gbgss224.seq
 230687920     gbgss225.seq
 227209592     gbgss226.seq
 217906383     gbgss227.seq
 217942849     gbgss228.seq
 230689666     gbgss229.seq
 230689062     gbgss23.seq
 230689204     gbgss230.seq
 215297313     gbgss231.seq
 250002759     gbgss232.seq
 250001137     gbgss233.seq
 250002459     gbgss234.seq
 250000158     gbgss235.seq
 250003258     gbgss236.seq
 250000291     gbgss237.seq
 250001291     gbgss238.seq
 250002745     gbgss239.seq
 230688100     gbgss24.seq
 250002252     gbgss240.seq
 250000108     gbgss241.seq
 250002110     gbgss242.seq
 250000507     gbgss243.seq
 250000358     gbgss244.seq
 250002807     gbgss245.seq
 250002339     gbgss246.seq
 250002772     gbgss247.seq
 250000418     gbgss248.seq
 250001202     gbgss249.seq
 230687876     gbgss25.seq
 250001484     gbgss250.seq
 250000986     gbgss251.seq
 250001883     gbgss252.seq
 250000325     gbgss253.seq
 250001266     gbgss254.seq
 250001373     gbgss255.seq
 250001271     gbgss256.seq
 250002219     gbgss257.seq
 250000383     gbgss258.seq
 250000149     gbgss259.seq
 230691504     gbgss26.seq
 250000150     gbgss260.seq
 250000764     gbgss261.seq
 250000974     gbgss262.seq
 250002359     gbgss263.seq
 250002248     gbgss264.seq
 250000413     gbgss265.seq
 250001327     gbgss266.seq
 250001623     gbgss267.seq
 250002931     gbgss268.seq
 250000245     gbgss269.seq
 230690309     gbgss27.seq
 250000004     gbgss270.seq
 250000959     gbgss271.seq
 250000644     gbgss272.seq
 250001366     gbgss273.seq
 250001971     gbgss274.seq
 250000797     gbgss275.seq
 250002675     gbgss276.seq
 250001632     gbgss277.seq
 250000834     gbgss278.seq
 250000945     gbgss279.seq
 230689913     gbgss28.seq
 250002476     gbgss280.seq
 250001601     gbgss281.seq
 250000555     gbgss282.seq
 250001549     gbgss283.seq
 250001048     gbgss284.seq
 250000242     gbgss285.seq
 250002227     gbgss286.seq
 250001922     gbgss287.seq
 250001614     gbgss288.seq
 250001498     gbgss289.seq
 230689340     gbgss29.seq
  60438546     gbgss290.seq
 230689286     gbgss3.seq
 230687533     gbgss30.seq
 230688932     gbgss31.seq
 230689492     gbgss32.seq
 230689759     gbgss33.seq
 230689716     gbgss34.seq
 230689209     gbgss35.seq
 230689522     gbgss36.seq
 230689286     gbgss37.seq
 230688422     gbgss38.seq
 230690318     gbgss39.seq
 230688064     gbgss4.seq
 230689168     gbgss40.seq
 230688008     gbgss41.seq
 230688857     gbgss42.seq
 230688640     gbgss43.seq
 230689137     gbgss44.seq
 230690180     gbgss45.seq
 230689493     gbgss46.seq
 230689696     gbgss47.seq
 230687868     gbgss48.seq
 230688869     gbgss49.seq
 230688342     gbgss5.seq
 230687880     gbgss50.seq
 230689390     gbgss51.seq
 230689605     gbgss52.seq
 230689539     gbgss53.seq
 230689182     gbgss54.seq
 230687469     gbgss55.seq
 230687758     gbgss56.seq
 230687893     gbgss57.seq
 230689383     gbgss58.seq
 230689447     gbgss59.seq
 230689182     gbgss6.seq
 230687800     gbgss60.seq
 229072014     gbgss61.seq
 230688250     gbgss62.seq
 230688760     gbgss63.seq
 230688705     gbgss64.seq
 230689648     gbgss65.seq
 230688781     gbgss66.seq
 230689584     gbgss67.seq
 230689519     gbgss68.seq
 230687509     gbgss69.seq
 230687458     gbgss7.seq
 230689198     gbgss70.seq
 230688722     gbgss71.seq
 230689543     gbgss72.seq
 230688892     gbgss73.seq
 230689214     gbgss74.seq
 230688801     gbgss75.seq
 230688974     gbgss76.seq
 230689901     gbgss77.seq
 230689589     gbgss78.seq
 230689227     gbgss79.seq
 230690430     gbgss8.seq
 230687441     gbgss80.seq
 224564448     gbgss81.seq
 194176901     gbgss82.seq
 194286413     gbgss83.seq
 230688198     gbgss84.seq
 230687908     gbgss85.seq
 230687613     gbgss86.seq
 230688523     gbgss87.seq
 230689693     gbgss88.seq
 230689537     gbgss89.seq
 230689298     gbgss9.seq
 230690147     gbgss90.seq
 230687643     gbgss91.seq
 230690390     gbgss92.seq
 230688637     gbgss93.seq
 230688008     gbgss94.seq
 230691062     gbgss95.seq
 230687491     gbgss96.seq
 230690256     gbgss97.seq
 230687710     gbgss98.seq
 230688622     gbgss99.seq
 250005012     gbhtc1.seq
 250001397     gbhtc10.seq
 250000041     gbhtc11.seq
 250001029     gbhtc12.seq
  30905579     gbhtc13.seq
 250016613     gbhtc2.seq
 250005703     gbhtc3.seq
 250002241     gbhtc4.seq
 250012414     gbhtc5.seq
 250007004     gbhtc6.seq
 250002603     gbhtc7.seq
 250001168     gbhtc8.seq
 250000386     gbhtc9.seq
 250095790     gbhtg1.seq
 250059677     gbhtg10.seq
 250109659     gbhtg100.seq
 250164109     gbhtg101.seq
 250209568     gbhtg102.seq
 250162900     gbhtg103.seq
 250196175     gbhtg104.seq
 250043014     gbhtg105.seq
 250117734     gbhtg106.seq
 250133743     gbhtg107.seq
 250117007     gbhtg108.seq
 250218872     gbhtg109.seq
 250041995     gbhtg11.seq
 250170619     gbhtg110.seq
 250049647     gbhtg111.seq
 250044227     gbhtg112.seq
 250063179     gbhtg113.seq
 250025059     gbhtg114.seq
 250129173     gbhtg115.seq
 250189666     gbhtg116.seq
  70432799     gbhtg117.seq
 250314168     gbhtg12.seq
 250259211     gbhtg13.seq
 250032869     gbhtg14.seq
 250130173     gbhtg15.seq
 250073391     gbhtg16.seq
 250176118     gbhtg17.seq
 250090631     gbhtg18.seq
 250144331     gbhtg19.seq
 250020825     gbhtg2.seq
 250179508     gbhtg20.seq
 250079452     gbhtg21.seq
 250030788     gbhtg22.seq
 250231671     gbhtg23.seq
 250255350     gbhtg24.seq
 250093455     gbhtg25.seq
 250291230     gbhtg26.seq
 250254655     gbhtg27.seq
 250244694     gbhtg28.seq
 250048863     gbhtg29.seq
 250039054     gbhtg3.seq
 250013140     gbhtg30.seq
 250112551     gbhtg31.seq
 250171750     gbhtg32.seq
 250088822     gbhtg33.seq
 250077254     gbhtg34.seq
 250169826     gbhtg35.seq
 250233081     gbhtg36.seq
 250268159     gbhtg37.seq
 250261998     gbhtg38.seq
 250252098     gbhtg39.seq
 250101899     gbhtg4.seq
 250056382     gbhtg40.seq
 250060052     gbhtg41.seq
 250290167     gbhtg42.seq
 250071541     gbhtg43.seq
 250027340     gbhtg44.seq
 250022885     gbhtg45.seq
 250104522     gbhtg46.seq
 250182886     gbhtg47.seq
 250048452     gbhtg48.seq
 250051389     gbhtg49.seq
 250209196     gbhtg5.seq
 250220576     gbhtg50.seq
 250197700     gbhtg51.seq
 250132920     gbhtg52.seq
 250269043     gbhtg53.seq
 250085992     gbhtg54.seq
 250105313     gbhtg55.seq
 250020769     gbhtg56.seq
 250051020     gbhtg57.seq
 250201746     gbhtg58.seq
 250220279     gbhtg59.seq
 250053315     gbhtg6.seq
 250133537     gbhtg60.seq
 250007131     gbhtg61.seq
 250121792     gbhtg62.seq
 250007443     gbhtg63.seq
 250166157     gbhtg64.seq
 250005637     gbhtg65.seq
 250106644     gbhtg66.seq
 250156698     gbhtg67.seq
 250149382     gbhtg68.seq
 250254925     gbhtg69.seq
 250004174     gbhtg7.seq
 250039751     gbhtg70.seq
 250079246     gbhtg71.seq
 250059412     gbhtg72.seq
 250210461     gbhtg73.seq
 250154799     gbhtg74.seq
 250009651     gbhtg75.seq
 250052850     gbhtg76.seq
 250211753     gbhtg77.seq
 250120482     gbhtg78.seq
 250078736     gbhtg79.seq
 250124022     gbhtg8.seq
 250051177     gbhtg80.seq
 250196050     gbhtg81.seq
 250071991     gbhtg82.seq
 250003103     gbhtg83.seq
 250096397     gbhtg84.seq
 250185016     gbhtg85.seq
 250107299     gbhtg86.seq
 250076244     gbhtg87.seq
 250268861     gbhtg88.seq
 250251837     gbhtg89.seq
 250009869     gbhtg9.seq
 250099407     gbhtg90.seq
 250079514     gbhtg91.seq
 250204124     gbhtg92.seq
 250045857     gbhtg93.seq
 250118694     gbhtg94.seq
 250060670     gbhtg95.seq
 250043102     gbhtg96.seq
 250148811     gbhtg97.seq
 250061042     gbhtg98.seq
 250169943     gbhtg99.seq
 250170619     gbinv1.seq
 250001028     gbinv10.seq
 250003619     gbinv11.seq
 211244218     gbinv12.seq
 250131830     gbinv2.seq
 263893072     gbinv3.seq
 250000214     gbinv4.seq
 250133157     gbinv5.seq
 250001303     gbinv6.seq
 250005776     gbinv7.seq
 250269871     gbinv8.seq
 250000262     gbinv9.seq
 150654176     gbjou1.idx
 142492121     gbjou2.idx
 222042921     gbjou3.idx
 283669338     gbjou4.idx
 133597532     gbjou5.idx
 185197400     gbkey1.idx
 222763828     gbkey2.idx
  60864345     gbkey3.idx
 250103154     gbmam1.seq
 250002985     gbmam2.seq
 250001857     gbmam3.seq
 121931647     gbmam4.seq
  54719110     gbnew.txt
 250000443     gbpat1.seq
 250001150     gbpat10.seq
 250000356     gbpat11.seq
 250001775     gbpat12.seq
 250000695     gbpat13.seq
 250000499     gbpat14.seq
 250001400     gbpat15.seq
 250001580     gbpat16.seq
 250002041     gbpat17.seq
 250000090     gbpat18.seq
 250000336     gbpat19.seq
 250000202     gbpat2.seq
 250002304     gbpat20.seq
 250000891     gbpat21.seq
 250170059     gbpat22.seq
 250000005     gbpat23.seq
 250000069     gbpat24.seq
 250004493     gbpat25.seq
 250054314     gbpat26.seq
 250007011     gbpat27.seq
 250001351     gbpat28.seq
 250013657     gbpat29.seq
 250003351     gbpat3.seq
 250001521     gbpat30.seq
 250000815     gbpat31.seq
 250001275     gbpat32.seq
 250001076     gbpat33.seq
 250000341     gbpat34.seq
 250000257     gbpat35.seq
 250022716     gbpat36.seq
 250000247     gbpat37.seq
 250000740     gbpat38.seq
 250003426     gbpat39.seq
 250002404     gbpat4.seq
 250026053     gbpat40.seq
 250000262     gbpat41.seq
 155677079     gbpat42.seq
 250000082     gbpat5.seq
 250000132     gbpat6.seq
 250001767     gbpat7.seq
 250003072     gbpat8.seq
 250000020     gbpat9.seq
  70136575     gbphg.seq
 250068711     gbpln1.seq
 250002783     gbpln10.seq
 250010266     gbpln11.seq
 250008371     gbpln12.seq
 250022637     gbpln13.seq
 250139936     gbpln14.seq
 250208877     gbpln15.seq
 288520840     gbpln16.seq
 256537862     gbpln17.seq
 250174499     gbpln18.seq
 250002646     gbpln19.seq
 250067847     gbpln2.seq
 250000925     gbpln20.seq
 250000520     gbpln21.seq
 252043455     gbpln22.seq
 257604226     gbpln23.seq
 250001275     gbpln24.seq
 250002461     gbpln25.seq
 250002110     gbpln26.seq
 250000207     gbpln27.seq
 250002413     gbpln28.seq
 213850097     gbpln29.seq
 250154084     gbpln3.seq
 250112047     gbpln4.seq
 250000775     gbpln5.seq
 250000445     gbpln6.seq
 250000139     gbpln7.seq
 250003551     gbpln8.seq
 250162033     gbpln9.seq
 250125096     gbpri1.seq
 250155727     gbpri10.seq
 250097814     gbpri11.seq
 250020417     gbpri12.seq
 250173548     gbpri13.seq
 250047561     gbpri14.seq
 250014728     gbpri15.seq
 250080593     gbpri16.seq
 250130808     gbpri17.seq
 250186927     gbpri18.seq
 250001352     gbpri19.seq
 250112557     gbpri2.seq
 250000918     gbpri20.seq
 250004126     gbpri21.seq
 250034091     gbpri22.seq
 250109527     gbpri23.seq
 250038448     gbpri24.seq
 250031079     gbpri25.seq
 250041990     gbpri26.seq
 250003712     gbpri27.seq
 250041835     gbpri28.seq
 250000404     gbpri29.seq
 250150511     gbpri3.seq
 250006918     gbpri30.seq
 250003908     gbpri31.seq
 250098854     gbpri32.seq
 250002029     gbpri33.seq
 250002795     gbpri34.seq
 250159458     gbpri35.seq
  27470888     gbpri36.seq
 250197367     gbpri4.seq
 250018852     gbpri5.seq
 250186659     gbpri6.seq
 250066610     gbpri7.seq
 250118502     gbpri8.seq
 250159568     gbpri9.seq
    295928     gbrel.txt
 250173244     gbrod1.seq
 250161035     gbrod10.seq
 250259647     gbrod11.seq
 250124387     gbrod12.seq
 250126193     gbrod13.seq
 250190987     gbrod14.seq
 250013857     gbrod15.seq
 250059630     gbrod16.seq
 250028330     gbrod17.seq
 250135427     gbrod18.seq
 250028805     gbrod19.seq
 250034745     gbrod2.seq
 250140350     gbrod20.seq
 250001369     gbrod21.seq
 250006534     gbrod22.seq
 250127013     gbrod23.seq
 250001416     gbrod24.seq
 250001452     gbrod25.seq
 151333905     gbrod26.seq
 250217806     gbrod3.seq
 250087683     gbrod4.seq
 250121636     gbrod5.seq
 250203557     gbrod6.seq
 250282886     gbrod7.seq
 250023378     gbrod8.seq
 250213254     gbrod9.seq
1374034056     gbsdr1.txt
4253472315     gbsdr2.txt
1836320299     gbsdr3.txt
 109542786     gbsec.idx
 250002011     gbsts1.seq
 250002347     gbsts10.seq
 250000919     gbsts11.seq
 250001518     gbsts12.seq
 250002657     gbsts13.seq
 228943686     gbsts14.seq
 250002002     gbsts2.seq
 250002125     gbsts3.seq
 250002390     gbsts4.seq
 250004546     gbsts5.seq
 250003582     gbsts6.seq
 250002767     gbsts7.seq
 250001975     gbsts8.seq
 250001446     gbsts9.seq
 250001206     gbsyn1.seq
 133439459     gbsyn2.seq
   1069519     gbtsa.seq
    422714     gbuna.seq
 250001165     gbvrl1.seq
 250002011     gbvrl2.seq
 250001531     gbvrl3.seq
 250002571     gbvrl4.seq
 250001885     gbvrl5.seq
 250000809     gbvrl6.seq
 250000934     gbvrl7.seq
 250002351     gbvrl8.seq
 155318719     gbvrl9.seq
 250215878     gbvrt1.seq
 250087533     gbvrt10.seq
 250065387     gbvrt11.seq
 250092731     gbvrt12.seq
 250000494     gbvrt13.seq
 250000851     gbvrt14.seq
 247206657     gbvrt15.seq
 250000014     gbvrt2.seq
 250055176     gbvrt3.seq
 250002163     gbvrt4.seq
 250005048     gbvrt5.seq
 250069479     gbvrt6.seq
 250061204     gbvrt7.seq
 250187878     gbvrt8.seq
 250149940     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         35528      100140537
BCT10        27966      105110236
BCT11        185        97209018
BCT12        85         111538705
BCT13        46         112988402
BCT14        54         114935705
BCT15        58         118953436
BCT16        66         116786530
BCT17        50         114367438
BCT18        45         112962480
BCT19        59         110366070
BCT2         3423       110264120
BCT20        73         113929811
BCT21        51         110444477
BCT22        65         113408951
BCT23        57         113456085
BCT24        54         115356157
BCT25        67         111574753
BCT26        237        107045331
BCT27        51939      91822342
BCT28        75869      80106453
BCT29        46943      90514449
BCT3         159        115987743
BCT4         22462      103652144
BCT5         54641      86800663
BCT6         5649       95824395
BCT7         14503      96474632
BCT8         4334       116099084
BCT9         41791      99316208
ENV1         91164      71495908
ENV2         95328      69640626
ENV3         83790      81749064
ENV4         89648      86303114
ENV5         113380     53051166
ENV6         124539     38264840
ENV7         90065      75853114
ENV8         87108      87326934
ENV9         24874      18545955
EST1         68126      26289737
EST10        76524      29834102
EST100       76440      39399400
EST101       71371      40690027
EST102       73786      32048292
EST103       74864      41778418
EST104       70315      34076786
EST105       76916      49981770
EST106       64824      34036974
EST107       71768      36987340
EST108       73299      43669619
EST109       72494      42729257
EST11        75175      28789994
EST110       70097      42172896
EST111       73533      41158575
EST112       69239      29938680
EST113       69732      32869664
EST114       64546      35182288
EST115       69061      39441745
EST116       70482      45960972
EST117       75853      34072426
EST118       74003      29363349
EST119       75490      25722987
EST12        77544      30745348
EST120       73355      35314499
EST121       63883      34873844
EST122       78142      42874930
EST123       79138      44698550
EST124       72494      47028594
EST125       68396      42141133
EST126       71965      48677832
EST127       69124      44293878
EST128       72631      45383497
EST129       74687      42789345
EST13        76983      29267069
EST130       73374      47332946
EST131       74066      49585579
EST132       72024      45949972
EST133       78687      41874292
EST134       74471      24136283
EST135       80870      44862974
EST136       76333      43559141
EST137       72838      43804570
EST138       64881      31493761
EST139       69200      39082258
EST14        78695      31917937
EST140       66830      36397522
EST141       67969      39465687
EST142       71100      41664173
EST143       72383      46910996
EST144       67140      39416782
EST145       72308      40674907
EST146       69008      40302555
EST147       60005      37007291
EST148       89724      48524555
EST149       101026     57678121
EST15        74572      31521278
EST150       70630      36388688
EST151       104399     55156988
EST152       115219     62989555
EST153       102149     56277252
EST154       78060      47113007
EST155       98704      57678296
EST156       104027     62347422
EST157       95752      58243654
EST158       81998      45097211
EST159       69288      39187914
EST16        75828      33339690
EST160       66193      31056934
EST161       61363      27884016
EST162       56684      27416586
EST163       65077      31432067
EST164       55362      27884468
EST165       76432      48310439
EST166       67639      40661031
EST167       71251      50994753
EST168       74910      42892366
EST169       59419      30189260
EST17        82145      33891102
EST170       63699      33910071
EST171       65500      37000193
EST172       63942      45456573
EST173       62719      35938976
EST174       104946     47276015
EST175       85434      50488299
EST176       103835     59406410
EST177       106290     59805020
EST178       97215      52193342
EST179       83493      39436108
EST18        80729      32281770
EST180       96018      42907833
EST181       98099      49808251
EST182       93434      37214158
EST183       92873      43501330
EST184       63942      45354534
EST185       69917      36024355
EST186       57964      33552140
EST187       70593      45037646
EST188       72564      27355639
EST189       76270      42535050
EST19        78591      31758130
EST190       72697      38392899
EST191       69351      35403092
EST192       68443      37805487
EST193       69763      52091219
EST194       67203      40504899
EST195       68973      34834198
EST196       68852      50479514
EST197       68380      48341213
EST198       72513      37598193
EST199       67715      44055553
EST2         74644      28644020
EST20        74641      30713555
EST200       70402      59259756
EST201       63866      47164884
EST202       63409      46665095
EST203       63663      46175796
EST204       64989      45728279
EST205       66943      51038673
EST206       61988      39503491
EST207       61984      36920829
EST208       66129      37906688
EST209       65667      35900926
EST21        73928      34320975
EST210       89690      51949696
EST211       75407      51319998
EST212       84132      49872198
EST213       112596     69666640
EST214       115415     68702905
EST215       103880     61956544
EST216       98289      64077893
EST217       117764     57302681
EST218       98787      53521762
EST219       91482      50627279
EST22        75015      30060911
EST220       96222      43892466
EST221       82943      48782197
EST222       69984      42332835
EST223       66891      50097732
EST224       68391      58723818
EST225       74174      53380083
EST226       77766      40326005
EST227       79056      49158009
EST228       72608      52084395
EST229       71112      49536332
EST23        77374      32694695
EST230       27697      10328446
EST231       28033      10628781
EST232       27338      10158258
EST233       26836      9717453
EST234       26872      9154430
EST235       27696      10117367
EST236       27406      9840023
EST237       27446      9953510
EST238       27439      11171737
EST239       27360      11837118
EST24        74777      32836423
EST240       27428      10984584
EST241       27649      9801407
EST242       27627      8947237
EST243       27352      10542542
EST244       28122      11148741
EST245       27779      11058024
EST246       26883      11550440
EST247       26983      12226868
EST248       27338      10726578
EST249       27211      11223235
EST25        74038      31909090
EST250       27247      12032617
EST251       27428      11493816
EST252       27487      10818814
EST253       27464      11010115
EST254       27309      10389675
EST255       26459      14326143
EST256       25028      17085735
EST257       26065      17745374
EST258       89962      37155073
EST259       55351      34817488
EST26        75219      31054388
EST260       97499      38847270
EST261       77170      39771981
EST262       68739      44223464
EST263       69201      44942475
EST264       69054      44425334
EST265       64135      39562122
EST266       79934      44442423
EST267       62208      43451976
EST268       68574      41920553
EST269       62363      31385806
EST27        74389      32419462
EST270       102246     47715995
EST271       83650      44648233
EST272       71971      37892427
EST273       65701      31533704
EST274       66799      40268351
EST275       71000      34675113
EST276       71610      33713251
EST277       73494      45720922
EST278       68234      37740046
EST279       66260      39298498
EST28        108020     51114577
EST280       74278      35694737
EST281       83700      45654172
EST282       74088      48340807
EST283       78153      53981338
EST284       97230      50440056
EST285       96583      45508686
EST286       77038      42967211
EST287       69636      46726005
EST288       75286      33838287
EST289       70301      31580788
EST29        97097      45908239
EST290       71483      34354512
EST291       66506      40198064
EST292       58969      37288500
EST293       70263      41217880
EST294       66242      43495667
EST295       60940      36239830
EST296       85606      44162789
EST297       80960      40750547
EST298       69655      43986059
EST299       101455     57653134
EST3         73730      29915842
EST30        98627      53907197
EST300       119439     48519511
EST301       88846      40364069
EST302       64583      35254069
EST303       70549      43080848
EST304       83602      43854683
EST305       71120      40482920
EST306       69193      43230931
EST307       68641      37511049
EST308       63129      37317295
EST309       48011      25932765
EST31        86665      50498937
EST310       72974      52928112
EST311       71635      40657425
EST312       72330      45435596
EST313       62345      34208885
EST314       70346      35724755
EST315       56076      28178086
EST316       55200      28428396
EST317       54932      29254489
EST318       53796      28629635
EST319       55237      28809294
EST32        67564      43098004
EST320       58087      24833078
EST321       57663      24510175
EST322       56477      23135892
EST323       57675      22276555
EST324       57187      22951802
EST325       58303      23200897
EST326       57220      22210348
EST327       58381      20753646
EST328       67098      38873818
EST329       78727      35430668
EST33        71441      56992725
EST330       76646      32871670
EST331       78448      33389002
EST332       82802      40942351
EST333       81574      56330299
EST334       54634      42867923
EST335       96671      58118924
EST336       96773      58461720
EST337       101973     59946488
EST338       105850     57418606
EST339       86407      48415294
EST34        85196      48655083
EST340       73493      40332192
EST341       76135      40296989
EST342       66459      54241352
EST343       63786      48595930
EST344       61015      43095163
EST345       60457      31730898
EST346       73433      49728723
EST347       56174      34049601
EST348       50905      25464771
EST349       66816      36056924
EST35        86590      43576184
EST350       65337      34668204
EST351       62282      30514908
EST352       63423      40999397
EST353       80422      44537095
EST354       72222      40390178
EST355       68150      40936441
EST356       71240      40733594
EST357       62613      43210433
EST358       82574      47521430
EST359       84599      49713237
EST36        92195      50038393
EST360       82433      45180060
EST361       63809      34994473
EST362       67161      37849609
EST363       73552      40005798
EST364       47721      24112754
EST365       62220      35566080
EST366       71440      41227808
EST367       93504      46983341
EST368       78190      41593674
EST369       72915      49260404
EST37        87016      60750353
EST370       68766      46596808
EST371       65540      37130580
EST372       67333      35026484
EST373       86661      39048154
EST374       60279      38789742
EST375       53839      38818762
EST376       64506      35715415
EST377       84680      51949774
EST378       92678      51801000
EST379       65474      38579610
EST38        76210      51411773
EST380       78580      43311002
EST381       58034      37621793
EST382       43250      22021050
EST383       56621      34906090
EST384       84129      46083611
EST385       77908      45965490
EST386       71298      44070324
EST387       80445      47267477
EST388       76786      49109527
EST389       86420      60086854
EST39        93946      55055077
EST390       78137      70236280
EST391       82476      51845338
EST392       89675      57572064
EST393       71418      58780243
EST394       72365      44997812
EST395       62843      40803465
EST396       68004      38668913
EST397       62571      36749259
EST398       66505      32280664
EST399       79608      25627318
EST4         74560      28391053
EST40        63732      49333851
EST400       74098      40417710
EST401       67583      39752543
EST402       64947      32589764
EST403       74430      46097125
EST404       71545      47453033
EST405       65900      41128100
EST406       68561      43262897
EST407       61371      34107651
EST408       69681      42265137
EST409       73776      46308044
EST41        78309      49478902
EST410       81058      48866858
EST411       84275      47753289
EST412       61513      39698130
EST413       56418      41314188
EST414       57424      40462315
EST415       60442      40664174
EST416       77629      47868287
EST417       54267      31962096
EST418       55592      36360926
EST419       63494      40428815
EST42        98996      50888599
EST420       58510      41571597
EST421       60594      42073558
EST422       48701      34279064
EST423       72949      43001461
EST424       82224      39250789
EST425       70568      38817305
EST426       70616      38764894
EST427       70485      39246876
EST428       70515      38861961
EST429       70354      39288892
EST43        89485      45225822
EST430       70011      38847075
EST431       69807      38873188
EST432       69728      39536590
EST433       69799      38964069
EST434       67909      38489651
EST435       70024      38372786
EST436       70267      39737142
EST437       70285      39022817
EST438       70238      38229772
EST439       70698      38693366
EST44        91507      47043367
EST440       70616      38876732
EST441       70520      38797729
EST442       70836      38294021
EST443       75430      40180462
EST444       92475      52526446
EST445       82548      36724713
EST446       103324     59392339
EST447       82779      46427194
EST448       75410      47533424
EST449       83332      48889903
EST45        107200     49750598
EST450       88403      52229103
EST451       97170      60465300
EST452       83093      49289626
EST453       90659      49931713
EST454       87848      48451864
EST455       76909      57667061
EST456       72385      49860042
EST457       94094      64058125
EST458       96630      66230034
EST459       102505     62346651
EST46        86163      32449899
EST460       116109     46263998
EST461       56502      40508331
EST462       51377      40457230
EST463       76949      45247492
EST464       57361      34769390
EST465       79723      46831110
EST466       116763     58894899
EST467       73881      45171816
EST468       80858      58334664
EST469       45022      24920280
EST47        70290      18728260
EST470       48160      49488469
EST471       46428      58827618
EST472       77071      55526227
EST473       63545      35852851
EST474       72423      41816798
EST475       70165      42389400
EST476       70992      43590869
EST477       61411      51481731
EST478       80917      44338869
EST479       109118     47982253
EST48        73201      19860510
EST480       83198      53308490
EST481       61991      40162679
EST482       56835      41052422
EST483       56726      38109198
EST484       66102      49005055
EST485       64779      45232010
EST486       61630      44651870
EST487       52053      37839016
EST488       53060      38268857
EST489       59266      42345587
EST49        57016      17447555
EST490       64526      36578143
EST491       69281      44530566
EST492       57209      37950486
EST493       57326      40472494
EST494       62408      46491971
EST495       63037      47540097
EST496       66847      44024117
EST497       50377      40190262
EST498       57878      38631708
EST499       53156      35382291
EST5         48193      15292129
EST50        44286      12060587
EST500       58383      39448929
EST501       61340      37909024
EST502       70724      44766436
EST503       70985      59723539
EST504       70405      49823316
EST505       69751      51883257
EST506       46553      57560574
EST507       57917      50237326
EST508       66687      44402081
EST509       65473      40558306
EST51        43743      12125030
EST510       77415      46565609
EST511       82495      53683057
EST512       81995      51357346
EST513       66960      40643168
EST514       65241      39760471
EST515       72625      50803405
EST516       81217      48982156
EST517       76838      62393308
EST518       68982      47880092
EST519       69743      46828544
EST52        43729      11473036
EST520       71258      50852083
EST521       60637      47201504
EST522       62983      45131661
EST523       86475      46942263
EST524       78118      39715816
EST525       114428     45416508
EST526       104001     51673442
EST527       71826      51742951
EST528       50443      49550464
EST529       72261      40097493
EST53        89738      38175028
EST530       99688      11076708
EST531       99770      10941126
EST532       96401      32696344
EST533       86559      32196228
EST534       86988      31697220
EST535       73285      47859936
EST536       70347      58598461
EST537       89493      54153092
EST538       80101      44325797
EST539       67753      45770367
EST54        95781      39826683
EST540       71014      45677570
EST541       80185      53285369
EST542       82417      50304412
EST543       76166      53453413
EST544       64158      47134002
EST545       75529      55809145
EST546       88180      49616621
EST547       82348      45315422
EST548       82435      44311208
EST549       81541      41491850
EST55        96126      43690735
EST550       83575      47132054
EST551       76345      52042205
EST552       72490      55108811
EST553       76105      50157082
EST554       89309      44762980
EST555       101885     48043187
EST556       110504     49175472
EST557       126392     52900018
EST558       132459     57863727
EST559       79356      53843332
EST56        93640      48211721
EST560       80051      48304329
EST561       83473      18897537
EST562       84289      8747465
EST563       110537     55639685
EST564       110821     52202364
EST565       66773      44667869
EST566       70114      40944855
EST567       71782      49791098
EST568       74973      45163734
EST569       73778      45362670
EST57        88268      40880483
EST570       71950      47218247
EST571       70602      53361008
EST572       95470      54848384
EST573       94813      48524696
EST574       66052      37204634
EST575       62943      45211477
EST576       87657      55537615
EST577       95988      56562702
EST578       75501      43790304
EST579       80032      36116705
EST58        112344     59424239
EST580       98546      10506856
EST581       98558      10485479
EST582       96811      17365111
EST583       69554      45201057
EST584       93471      46403153
EST585       76241      49527499
EST586       77199      52889744
EST587       86177      54519704
EST588       85735      55531050
EST589       84534      56094778
EST59        95011      45670975
EST590       81020      45214481
EST591       82852      48680935
EST592       72587      47789921
EST593       65805      45292160
EST594       61689      36786826
EST595       108704     33574986
EST596       55421      37762952
EST597       51329      31963612
EST598       51119      34172791
EST599       60050      41538577
EST6         54905      17436890
EST60        74341      31287912
EST600       72607      46721409
EST601       64819      48049537
EST602       109732     20268957
EST603       118216     14547589
EST604       122588     11130812
EST605       122476     11301148
EST606       107656     20947275
EST607       65396      47495197
EST608       64053      49174104
EST609       80562      52643495
EST61        68934      30646031
EST610       75734      49599077
EST611       67983      47903530
EST612       77645      44808019
EST613       63613      42947329
EST614       71547      39326926
EST615       121454     18478790
EST616       127175     11862038
EST617       80157      36745149
EST618       75052      48109502
EST619       68599      50797974
EST62        70572      30637771
EST620       95116      47525369
EST621       87674      55599620
EST622       61034      34437299
EST623       73543      40812480
EST624       72800      61243176
EST625       84723      48080360
EST626       107718     50536055
EST627       72269      49833352
EST628       61215      48439083
EST629       68783      55963153
EST63        73418      30979078
EST630       74791      36236941
EST631       87143      52707707
EST632       89021      52642594
EST633       83674      37391079
EST634       71331      47371587
EST635       71819      49993207
EST636       81125      51844531
EST637       78576      29855792
EST638       76962      25892877
EST639       77587      25463855
EST64        82156      32493116
EST640       74867      30141678
EST641       77148      25597661
EST642       75784      30623834
EST643       76482      28721441
EST644       75561      28252519
EST645       76445      28538156
EST646       76557      29443020
EST647       76225      30774377
EST648       80231      44864951
EST649       82303      60248157
EST65        72250      28177540
EST650       81957      59797288
EST651       81406      49394040
EST652       63139      33419502
EST653       64476      42074645
EST654       75807      43697584
EST655       41108      33333012
EST656       58335      42607376
EST657       58324      45888236
EST658       62745      45818294
EST659       75399      41749486
EST66        64147      28114269
EST660       68060      37150292
EST661       83281      54039221
EST662       83781      43008657
EST663       66486      41322578
EST664       70534      47481894
EST665       79298      47346955
EST666       69529      35838120
EST667       68951      47265375
EST668       77284      51717477
EST669       58275      40437219
EST67        72571      31523498
EST670       70131      50746621
EST671       72374      52313435
EST672       74276      46314003
EST673       68555      48735265
EST674       71344      54022758
EST675       81513      69977950
EST676       82256      69052498
EST677       79162      61534847
EST678       77335      39024160
EST679       71285      32327847
EST68        74773      35463116
EST680       54329      32121118
EST681       67160      47669891
EST682       63610      40473564
EST683       66281      48880593
EST684       67733      45122567
EST685       58597      39148006
EST686       54996      37887178
EST687       63943      42724683
EST688       69023      44338325
EST689       65471      44755755
EST69        73733      32286580
EST690       65788      46167255
EST691       66125      44991668
EST692       69382      44884072
EST693       68510      58164286
EST694       65444      39360906
EST695       68765      41657275
EST696       66394      44471741
EST697       57511      38579776
EST698       68351      39885270
EST699       62012      37823489
EST7         74531      29353408
EST70        75482      27018799
EST700       67886      42585699
EST701       88924      52474768
EST702       101575     50316061
EST703       67652      39977004
EST704       54816      26852149
EST705       51079      32521379
EST706       54792      34946097
EST707       58445      40674154
EST708       58285      38278327
EST709       61321      37827696
EST71        78956      30941688
EST710       65202      41803085
EST711       55981      35031048
EST712       52492      32839410
EST713       67082      40863184
EST714       83179      42470378
EST715       80885      44322164
EST716       73816      28651838
EST717       79169      38475539
EST718       78223      47578548
EST719       84515      50949827
EST72        72300      31265997
EST720       74087      47621756
EST721       84169      46651693
EST722       57431      38402392
EST723       57746      37652715
EST724       61238      42032524
EST725       59726      39209795
EST726       59872      38841607
EST727       62659      41181208
EST728       80767      43556469
EST729       82675      44321607
EST73        40893      11632955
EST730       76976      46051303
EST731       69829      41367159
EST732       70036      24830627
EST733       73420      27653003
EST734       73678      26128102
EST735       79700      27017751
EST736       73571      26834078
EST737       68558      29381305
EST738       36437      12422758
EST74        40854      11671342
EST75        41013      12838123
EST76        41248      12456355
EST77        41277      12834954
EST78        41212      13021692
EST79        41079      12426908
EST8         75810      30584478
EST80        40712      12471132
EST81        40822      12529156
EST82        41849      12202556
EST83        41567      12877719
EST84        41477      13033449
EST85        41449      13348494
EST86        45114      12185991
EST87        45940      25472944
EST88        42864      23002473
EST89        45895      18867726
EST9         77564      29870549
EST90        50442      23060523
EST91        52187      21685487
EST92        64685      36828277
EST93        85724      43181940
EST94        75029      31269926
EST95        73985      29176349
EST96        72739      32438341
EST97        77503      46923934
EST98        76108      40661717
EST99        76791      39329897
GSS1         90430      38662943
GSS10        74787      43607320
GSS100       80625      51412757
GSS101       74529      42755867
GSS102       73373      45684621
GSS103       73714      44825146
GSS104       73230      45734767
GSS105       73262      44830525
GSS106       75263      45727363
GSS107       81431      54691312
GSS108       83868      55510710
GSS109       81045      52307512
GSS11        70802      35983221
GSS110       82200      50445579
GSS111       84242      58189720
GSS112       79855      59031496
GSS113       91243      46350557
GSS114       89931      53560767
GSS115       73592      50015461
GSS116       89786      65410603
GSS117       82175      58723619
GSS118       75870      42429548
GSS119       81837      50481912
GSS12        73150      38495437
GSS120       94953      53355311
GSS121       84420      55566909
GSS122       84916      54821741
GSS123       81890      55711804
GSS124       76056      69621612
GSS125       76821      66077756
GSS126       78847      55619022
GSS127       72480      50149808
GSS128       72482      50134404
GSS129       73143      49021920
GSS13        76795      38906116
GSS130       72128      50787366
GSS131       74446      50626685
GSS132       84090      59845866
GSS133       80772      58329954
GSS134       68665      56199301
GSS135       71858      55680873
GSS136       75828      67956101
GSS137       75882      61939396
GSS138       77003      52532600
GSS139       86870      53819595
GSS14        71379      32114760
GSS140       94775      57966448
GSS141       92648      59924495
GSS142       82277      53749863
GSS143       88034      51672874
GSS144       75736      58226163
GSS145       114879     59699217
GSS146       109528     58814661
GSS147       87594      62234762
GSS148       49987      29613675
GSS149       68132      48787425
GSS15        70493      35055254
GSS150       73001      55885502
GSS151       72980      55922450
GSS152       73002      55884958
GSS153       73012      55867933
GSS154       72974      55932651
GSS155       72975      55932446
GSS156       75746      57509811
GSS157       84181      39667849
GSS158       88494      60240145
GSS159       85434      66061520
GSS16        78213      46093569
GSS160       89556      58457865
GSS161       91109      56964521
GSS162       83740      58138514
GSS163       75281      48391404
GSS164       76667      49458580
GSS165       92881      58460964
GSS166       90573      61992638
GSS167       86160      61037355
GSS168       105353     22060115
GSS169       100342     31939300
GSS17        70895      33315071
GSS170       78166      47128460
GSS171       81727      53804496
GSS172       52904      38536250
GSS173       54927      43324036
GSS174       61264      50584908
GSS175       59060      45361614
GSS176       57612      48691988
GSS177       57509      48731646
GSS178       58260      46385895
GSS179       58482      45713177
GSS18        58792      27918452
GSS180       58807      48768100
GSS181       58943      48436583
GSS182       58658      49321655
GSS183       58153      48365825
GSS184       58631      46103127
GSS185       58954      49560291
GSS186       60198      50039939
GSS187       60238      49975241
GSS188       60541      49063397
GSS189       60417      49433593
GSS19        56814      29015258
GSS190       60514      49142121
GSS191       59819      46841340
GSS192       59160      45333303
GSS193       58434      47615834
GSS194       58971      45935894
GSS195       58812      46435486
GSS196       58326      47954433
GSS197       58238      48232483
GSS198       58379      48659558
GSS199       60092      50113368
GSS2         89000      39334171
GSS20        57683      26671178
GSS200       59873      50773448
GSS201       59921      48966431
GSS202       60705      45662626
GSS203       60075      47611186
GSS204       59471      49482221
GSS205       59498      49400041
GSS206       59536      49283070
GSS207       59468      49492752
GSS208       59614      49046087
GSS209       59514      49353526
GSS21        61527      29551920
GSS210       59735      48677959
GSS211       59662      48899490
GSS212       59750      48319518
GSS213       58975      45626639
GSS214       58783      46267596
GSS215       58333      47836420
GSS216       58240      48165585
GSS217       58706      46237174
GSS218       58094      48174438
GSS219       64818      54771499
GSS22        64704      37621344
GSS220       64820      54763123
GSS221       100424     64019609
GSS222       81406      44591955
GSS223       77743      58324124
GSS224       87946      55581731
GSS225       86695      49277831
GSS226       74443      50531198
GSS227       71275      47094596
GSS228       71239      47186122
GSS229       103200     52856422
GSS23        57535      27063987
GSS230       98063      66813135
GSS231       74801      47164725
GSS232       87182      64465152
GSS233       83577      62754047
GSS234       103558     48487000
GSS235       68486      58446619
GSS236       68305      58781573
GSS237       69368      56628300
GSS238       69626      56128071
GSS239       70567      56037763
GSS24        66458      42175333
GSS240       76223      57617106
GSS241       75915      58210646
GSS242       87248      74915094
GSS243       84888      46838325
GSS244       92320      43919149
GSS245       84283      65531790
GSS246       70533      58651808
GSS247       69703      58662601
GSS248       64726      62235402
GSS249       74466      48470500
GSS25        67918      28145143
GSS250       85701      33860083
GSS251       113327     73700908
GSS252       97600      74134474
GSS253       90837      44106448
GSS254       111163     63698762
GSS255       120659     73171829
GSS256       116933     76045198
GSS257       102540     54561431
GSS258       83514      54636157
GSS259       96031      61874804
GSS26        58155      25414254
GSS260       107465     78480107
GSS261       107915     78023792
GSS262       106101     79983638
GSS263       102982     78978267
GSS264       77980      51832067
GSS265       109385     66525234
GSS266       110070     66176077
GSS267       102732     56961489
GSS268       68448      37535952
GSS269       79818      44216559
GSS27        65596      32054593
GSS270       76307      43198346
GSS271       106530     59653418
GSS272       91429      47076246
GSS273       102318     60001038
GSS274       114546     44629880
GSS275       116953     39547048
GSS276       98030      71394920
GSS277       95453      62803556
GSS278       95871      36569261
GSS279       95389      37317829
GSS28        65171      32497374
GSS280       96742      35045950
GSS281       94168      39365333
GSS282       101814     59068144
GSS283       94697      60983894
GSS284       94554      61186822
GSS285       95283      60135107
GSS286       86807      62295024
GSS287       83727      28560312
GSS288       84358      27363337
GSS289       85432      25213220
GSS29        77737      39812956
GSS290       20536      9975775
GSS3         87422      41844005
GSS30        82634      39702934
GSS31        74190      40413538
GSS32        70525      48290302
GSS33        79852      37772820
GSS34        75886      40326877
GSS35        74175      39863155
GSS36        87464      56577344
GSS37        87595      58178309
GSS38        85545      44925829
GSS39        86586      50235704
GSS4         79227      41150659
GSS40        86504      39700345
GSS41        83054      32395138
GSS42        81250      56926804
GSS43        80041      57955797
GSS44        72010      47534288
GSS45        72050      47405536
GSS46        77623      45643371
GSS47        77879      38875725
GSS48        83290      58061973
GSS49        86558      64911459
GSS5         78819      40567994
GSS50        81736      54223535
GSS51        93800      59362797
GSS52        88481      58785262
GSS53        76369      41877727
GSS54        73084      40858704
GSS55        86366      46794230
GSS56        88127      58671741
GSS57        76346      64409162
GSS58        70882      78111853
GSS59        86059      68969246
GSS6         78088      38842501
GSS60        89093      59744839
GSS61        63429      44952744
GSS62        66512      45602333
GSS63        89647      67279502
GSS64        84931      58259323
GSS65        86111      52985075
GSS66        85494      55678504
GSS67        93569      57753022
GSS68        97811      52599140
GSS69        97518      52985728
GSS7         77657      39174963
GSS70        98229      52046549
GSS71        99261      50678111
GSS72        99227      50723941
GSS73        99068      50934874
GSS74        99601      50227676
GSS75        97771      52651416
GSS76        91738      64971993
GSS77        89865      70741279
GSS78        88891      70086550
GSS79        87855      69638410
GSS8         75881      38134490
GSS80        87865      63823866
GSS81        87995      44097694
GSS82        78265      23299838
GSS83        78174      23508729
GSS84        83853      49938801
GSS85        77494      45031925
GSS86        88966      56330462
GSS87        84258      58535087
GSS88        76274      77066915
GSS89        79321      72652315
GSS9         72240      37167492
GSS90        84603      46673379
GSS91        84675      49189908
GSS92        75664      41949479
GSS93        79233      56951998
GSS94        77452      56450988
GSS95        81281      53743322
GSS96        84896      58217148
GSS97        85349      57694314
GSS98        87354      52203026
GSS99        82024      67861903
HTC1         24998      26954535
HTC10        65223      86014610
HTC11        67000      60967078
HTC12        69474      70287785
HTC13        11623      7313801
HTC2         15993      36013431
HTC3         15970      36547861
HTC4         16191      35357336
HTC5         15927      40313070
HTC6         16010      37271080
HTC7         51463      28046115
HTC8         80376      62002116
HTC9         73872      69575684
HTG1         1318       188929277
HTG10        1300       186477873
HTG100       1170       190175935
HTG101       1428       189882293
HTG102       1133       190523744
HTG103       1174       187390096
HTG104       1554       188620972
HTG105       984        193446965
HTG106       754        169026486
HTG107       1084       193942128
HTG108       1113       193094942
HTG109       1017       189876926
HTG11        1452       184100451
HTG110       1096       191838390
HTG111       1082       192379337
HTG112       1167       191822544
HTG113       1121       192092039
HTG114       1311       192097961
HTG115       1243       191967411
HTG116       1210       191102437
HTG117       491        53546392
HTG12        876        192056419
HTG13        750        192437652
HTG14        744        192158023
HTG15        782        192230176
HTG16        803        192009637
HTG17        769        192283132
HTG18        2064       171033537
HTG19        1071       187903257
HTG2         2465       186071856
HTG20        963        189548030
HTG21        784        191909290
HTG22        923        190306412
HTG23        902        190717511
HTG24        811        191592140
HTG25        776        192067539
HTG26        868        191479631
HTG27        889        190824411
HTG28        946        190168578
HTG29        899        191050856
HTG3         2517       185290576
HTG30        927        190341026
HTG31        871        191356884
HTG32        965        189699947
HTG33        884        191153425
HTG34        862        191443956
HTG35        822        191949852
HTG36        946        190207636
HTG37        931        190916264
HTG38        937        190554424
HTG39        1042       189423761
HTG4         2553       188532563
HTG40        1206       186876566
HTG41        1261       188161791
HTG42        1175       188167658
HTG43        1152       187962620
HTG44        1119       191420899
HTG45        1274       190698601
HTG46        1177       191205869
HTG47        1131       191483893
HTG48        1034       191390647
HTG49        980        189582513
HTG5         1284       185715991
HTG50        1122       190242593
HTG51        884        189782197
HTG52        1067       189910784
HTG53        934        189808696
HTG54        1008       190014843
HTG55        985        189552893
HTG56        998        189350064
HTG57        1024       189809957
HTG58        1022       189959387
HTG59        1134       186321722
HTG6         1274       185234665
HTG60        1122       189370609
HTG61        1090       189848651
HTG62        1056       189613142
HTG63        1135       188800358
HTG64        1105       189659714
HTG65        1285       184271916
HTG66        1243       185522113
HTG67        1239       184628766
HTG68        1272       184663203
HTG69        1230       185653227
HTG7         1277       185414872
HTG70        1203       189083717
HTG71        1168       187600001
HTG72        1099       191026837
HTG73        1131       191207725
HTG74        1206       191391913
HTG75        1126       190388683
HTG76        1184       190877322
HTG77        1112       190354598
HTG78        1161       190290123
HTG79        1191       190203946
HTG8         1459       184762119
HTG80        1121       190438766
HTG81        1114       190404365
HTG82        1331       186518117
HTG83        1197       190617322
HTG84        1187       190461665
HTG85        1123       191052488
HTG86        1190       190994835
HTG87        1209       191516203
HTG88        1163       191942257
HTG89        1157       192264100
HTG9         1200       186999351
HTG90        1196       192178498
HTG91        1206       191580918
HTG92        1193       192355211
HTG93        1156       190957446
HTG94        1087       189664641
HTG95        1003       189689682
HTG96        1052       189981610
HTG97        991        189602947
HTG98        1009       189691203
HTG99        1013       189605605
INV1         83544      65927961
INV10        85248      66802620
INV11        83792      67146191
INV12        26975      93831886
INV2         1464       186621591
INV3         774        164256065
INV4         50772      97277492
INV5         70453      81486295
INV6         31473      116162733
INV7         75064      73527682
INV8         67876      80461950
INV9         76667      74049041
MAM1         12215      166541987
MAM2         69389      81350593
MAM3         39215      123599092
MAM4         42249      34598520
PAT1         222610     70141260
PAT10        125437     99518322
PAT11        141739     62608396
PAT12        105795     59941764
PAT13        103555     50226564
PAT14        121472     53274905
PAT15        113046     61292248
PAT16        145018     54899867
PAT17        155517     69893240
PAT18        97490      122598017
PAT19        147594     87373130
PAT2         194518     84655123
PAT20        117407     104542066
PAT21        123717     103465007
PAT22        119286     106149134
PAT23        146235     86276184
PAT24        175261     64171100
PAT25        140514     61008050
PAT26        100420     79560422
PAT27        108697     70803288
PAT28        111347     66582863
PAT29        113599     67362592
PAT3         171984     95898893
PAT30        129236     68268266
PAT31        111310     78154097
PAT32        138113     29117410
PAT33        158492     24106541
PAT34        123461     70471555
PAT35        135780     114780158
PAT36        155702     104303390
PAT37        122512     121936381
PAT38        199012     76788395
PAT39        41134      172766506
PAT4         153750     106059356
PAT40        60612      162513557
PAT41        233110     24708076
PAT42        155628     22199191
PAT5         184018     85619906
PAT6         156356     93378118
PAT7         152402     81705440
PAT8         104672     119401279
PAT9         143543     89226955
PHG          3817       28361165
PLN1         55823      97605162
PLN10        21869      123269190
PLN11        17546      145508414
PLN12        17668      146643657
PLN13        17621      146663790
PLN14        19582      142720833
PLN15        1259       166051294
PLN16        1089       188695099
PLN17        5          168115057
PLN18        86         166971068
PLN19        42922      101712111
PLN2         1484       167314133
PLN20        76588      78092758
PLN21        77614      76552305
PLN22        37963      105007870
PLN23        24816      133149480
PLN24        46292      113207302
PLN25        75916      78298581
PLN26        98597      56233997
PLN27        81860      72226945
PLN28        80666      75289249
PLN29        46978      79507140
PLN3         1603       182757861
PLN4         1988       192354455
PLN5         41929      113092801
PLN6         76499      78438146
PLN7         70775      68181519
PLN8         30650      52981790
PLN9         25190      112791180
PRI1         33102      117753805
PRI10        1455       182691708
PRI11        1278       179187402
PRI12        1453       178017313
PRI13        1589       180139278
PRI14        1603       182108337
PRI15        1272       191877347
PRI16        1138       193893775
PRI17        1101       194429460
PRI18        1205       193697880
PRI19        14803      167638070
PRI2         1639       172621939
PRI20        45904      116385479
PRI21        58804      75636109
PRI22        19609      134368882
PRI23        2549       180280221
PRI24        1951       181535543
PRI25        1785       183789017
PRI26        2080       182002971
PRI27        4905       174182376
PRI28        9527       165350358
PRI29        25626      134570367
PRI3         1307       183697679
PRI30        51175      78618752
PRI31        33057      63285326
PRI32        10347      161382511
PRI33        58447      107929438
PRI34        48624      93581662
PRI35        66575      90026385
PRI36        1441       18064571
PRI4         1347       185401809
PRI5         1196       181284904
PRI6         1186       179051410
PRI7         1233       181111994
PRI8         1322       176524536
PRI9         1241       174683346
ROD1         29317      146227451
ROD10        976        181471200
ROD11        1037       185951637
ROD12        943        183059369
ROD13        1038       189430474
ROD14        952        180526003
ROD15        966        181898075
ROD16        1000       186142363
ROD17        10862      173958340
ROD18        26231      141453413
ROD19        1132       183049705
ROD2         911        174891232
ROD20        1184       184298528
ROD21        14162      163079513
ROD22        38420      70468563
ROD23        19125      117025634
ROD24        2301       188652928
ROD25        153666     19464713
ROD26        42406      48884017
ROD3         913        173659765
ROD4         903        174041355
ROD5         929        174192702
ROD6         983        179516606
ROD7         957        179914723
ROD8         993        182143956
ROD9         1003       182402491
STS1         84839      36527785
STS10        57841      44812491
STS11        57925      43638168
STS12        64607      43005024
STS13        88757      38310027
STS14        80364      35154556
STS2         84165      48236598
STS3         69728      27431057
STS4         78848      37497682
STS5         54788      32164909
STS6         54863      31907576
STS7         54669      32203229
STS8         55701      35698132
STS9         57887      44483446
SYN1         47604      71408271
SYN2         27452      36390375
TSA          180        197242
UNA          211        114018
VRL1         72121      66003005
VRL2         70489      64563624
VRL3         72402      63754193
VRL4         69050      69188045
VRL5         54802      73703886
VRL6         62734      72634591
VRL7         68913      66140955
VRL8         60708      72884713
VRL9         44557      43809974
VRT1         21873      158617767
VRT10        14033      172156072
VRT11        10551      175652629
VRT12        5918       183337660
VRT13        17007      166591382
VRT14        82357      67585912
VRT15        77825      67727216
VRT2         47497      123165010
VRT3         26265      147381208
VRT4         58860      100012345
VRT5         58449      66224636
VRT6         28976      85173177
VRT7         1182       191142340
VRT8         1270       190586739
VRT9         1359       189736364

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 166.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:

Entries        Bases   Species

11446685 13030388775   Homo sapiens
7251554   8351004886   Mus musculus
1640821   5988704614   Rattus norvegicus
2084839   5038805938   Bos taurus
3175570   4512823752   Zea mays
1586312   2916171886   Danio rerio
2125319   2895710456   Sus scrofa
1204686   1533066380   Oryza sativa Japonica Group
227972    1352643343   Strongylocentrotus purpuratus
1421599   1143742136   Xenopus tropicalis
212803     993604303   Pan troglodytes
2210226    911282238   Arabidopsis thaliana
777718     910123773   Drosophila melanogaster
650283     904971262   Vitis vinifera
803421     868089071   Gallus gallus
76751      800795203   Macaca mulatta
1223148    704857447   Canis lupus familiaris
1106280    663210675   Triticum aestivum
1011852    660267822   Sorghum bicolor
1177688    634539764   Oryzias latipes

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          April 15 2008

                NCBI-GenBank Flat File Release 166.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 PROJECT Format

  This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
PROJECT     GenomeProject:18787

  A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second 
contains the actual project identifier ("18787").

  PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 166.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
	Andrea Gocke, Anjanette Johnston, Mark Landree,	Richard McVeigh,
	Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
	Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev

User Support
	Medha Bhagwat, Peter Cooper, Wayne Matten, Scott McGinnis, Monica Romiti,
	Eric Sayers, Tao Tao, Majda Valjavec-Gratian, David Wheeler

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center