Release Notes For GenBank Release 167

GBREL.TXT          Genetic Sequence Data Bank
                         August 15 2008

               NCBI-GenBank Flat File Release 167.0

                    Distribution Release Notes

 92748599 loci, 95033791652 bases, from 92748599 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 167.0
1.2 Cutoff Date
1.3 Important Changes in Release 167.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 167.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 167.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:

	ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/  (Japan)
	ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/  (Korea)
	ftp://bio-mirror.sg.apan.net/biomirrors/genbank/     (Singapore)

1.2 Cutoff Date

  This full release, 167.0, incorporates data available to the collaborating
databases as of August 19, 2008 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 167.0

1.3.1 Announcements for upcoming changes absent from Release 166.0

  An oversight during GenBank Release 166.0 processing resulted in the
exclusion of several announcements for changes that will be implemented
as of GenBank Release 168.0 in October 2008 (see section 1.4, below).

  This means that only two months advance notice can be provided for those
changes, rather than the customary four months. Our apologies for this
oversight and any inconvenience that it may cause.

1.3.2 Organizational changes

  The total number of sequence data files increased by 58 with this release:

  - the BCT division is now comprised of  30 files (+1)
  - the CON division is now comprised of  97 files (+6)
  - the ENV division is now comprised of  10 files (+1)
  - the EST division is now comprised of 762 files (+24)
  - the GSS division is now comprised of 306 files (+16)
  - the HTG division is now comprised of 120 files (+3)
  - the INV division is now comprised of  13 files (+1)
  - the PAT division is now comprised of  46 files (+4)
  - the PLN division is now comprised of  30 files (+1)
  - the VRL division is now comprised of  10 files (+1)
  - the VRT division is now comprised of  16 files (+1)

  The total number of index files increased by 5 with this release:

  - the AUT index is now comprised of  59 files  (+5)

1.3.3 Comprehensive protein FASTA file has been discontinued

  'Divisional' protein FASTA files :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/gbXXX.fsa_aa.gz

where 'XXX' represents an alphanumeric GenBank division code (such as
pri10) were made available starting with GenBank Release 164.0 . Given
their availability, support for the single, comprehensive protein FASTA
file:

	ftp://ftp.ncbi.nih.gov/genbank/relNNN.fsa_aa.gz

(where 'NNN' represents a three-digit GenBank release number) was
discontinued as of GenBank Release 166.0 in June 2008. The size of the
comprehensive file had exceeded 4GB, which was unmanageable for many users.

  The final comprehensive protein FASTA file was: rel166.fsa_aa .

1.3.4 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.5 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
fifty-nine of the GSS flatfiles in Release 167.0. Consider gbgss248.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                           August 15 2008

                NCBI-GenBank Flat File Release 167.0

                           GSS Sequences (Part 1)

   87184 loci,    64446495 bases, from    87184 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "248" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 Changes related to ncRNA features, /ncRNA_class, and /moltype

  The list of allowed values for the /ncRNA_class qualifier, which is
mandatory for all ncRNA features, will be expanded to include:

	/ncRNA_class="ribozyme"

Non-coding RNAs which are not yet in the INSDC's controlled vocabulary:

	http://www.insdc.org/page.php?page=rna_vocab

previously required /ncRNA_class="other" plus an accompanying /note
qualifer to describes the nature of the ncRNA. This requirement will
be changed, such that *either* a /product or a /note qualifier must
accompany "other" ncRNAs features.

  The list of allowed /mol_type qualifiers for the source feature
currently includes:

	/mol_type="snoRNA"
	/mol_type="snRNA"
	/mol_type="scRNA"
	/mol_type="tmRNA"

All of these molecule types will be collapsed into a single value:

	/mol_type="transcribed RNA"

Sequence records which represent one of these four types of molecules
will thus have:

	an ncRNA feature with /ncRNA_class of "snoRNA", "scRNA" or "snRNA"
	a source feature with /mol_type of "transcribed RNA"
or
	a tmRNA feature
	a source feature with /mol_type of "transcribed RNA"

All of these changes will take effect as of Release 169.0 in October 2008.

1.4.2 Merging the satellite and repeat_unit features into repeat_region

  Satellites, minisatellites and microsatellites are comprised of repetitive
units of DNA, with a variety of lengths and repeat patterns. With the 
addition of a new qualifier (/satellite), the satellite and repeat_unit
features can be represented by the repeat_region feature.

   Qualifier       /satellite=

   Definition      identifier for satellite DNA marker; many tandem repeats 
                   (identical or related) of a short basic repeating unit; many 
                   have a base composition or other property different from the 
                   genome average that allows them to be separated from the bulk 
                   genomic DNA;

   Value format    "<satellite_type>[:<class>][ <identifier>]" 

                   where satellite_type is one of the following 
                   "satellite", "microsatellite", "minisatellite"

   Example         /satellite="satellite: S1a"
                   /satellite="satellite: alpha"
                   /satellite="satellite: gamma III"
                   /satellite="microsatellite: DC130"

  As of the October 2008 GenBank release, all satellite features will be 
transformed into repeat_region features with /satellite qualifiers of
type "satellite", and all repeat_unit features will be transformed into
repeat_region features.
  
1.4.3 New /gene_synonym qualifier

  Gene symbols are presented via the /gene qualifier. When synonymous or 
alternative gene symbols are available, they have often been presented via
multiple /gene qualifiers.

  To distinguish what might be an approved or official gene symbol from its
synonyms or alternatives, a new /gene_synonym qualifier will be introduced
for GenBank Release 168.0 .

   Qualifier       /gene_synonym=

   Definition      synonymous or alternative symbol for a gene corresponding to
                   a sequence region
   Value format    "text"

   Examples        /gene="CF"
                   /gene="ABCC7"

1.4.4 New /mating_type qualifier

  Because the /sex qualifier has a free-text value format, is has been
innapropriately utilized for certain organisms, such as bacteria, fungi,
and some insects and worms. In such cases, a more appropriate term would
be 'mating type'.

In October 2008, a new qualifier will be made available for non-sexual
reproductive strategies:

   Qualifier       /mating_type=

   Definition      mating type of the organism from which the sequence was obtained
   Value format    "text"

   Example         /mating_type="Mating type A"

1.4.5 Renaming of /specific_host as /host

  The definition of /specific_host in the Feature Table document is as follows:

   Qualifier       /specific_host=

   Definition      natural host from which the sequence was obtained
   Value format    "text"

   Example         /specific_host="Rhizobium NGR234"

  The usage of /specific_host, and particularly the distinction between it and
/lab_host, is not made clear with this definition. So the qualifier is going
to be renamed and redefined, starting with Release 168.0 in October 2008 :

   Qualifier       /host=

   Definition      Natural (as opposed to laboratory) host to the organism from
                   which the sequenced molecule was obtained
   Value format    "text"

   Example         /host="Homo sapiens"
                   /host="Homo sapiens 12 year old girl"

1.4.6 New value for /organelle

  In October 2008, the list of allowed values for /organelle will be expanded
to include:

	/organelle="chromatophore"

1.4.7 Modification to value format for /frequency

  The current definition of /frequency is :

   Qualifier       /frequency=

   Definition      frequency of the occurrence of a feature

   Value format    text representing the fraction of population carrying the
                   variation expressed as a decimal fraction

   Example         /frequency=".85"

Although this format is appropriate and useful in some contexts (for 
example, within a global population of individuals), it does not convey
the number of sequences that might have been included in a variation
study. As of Release 168.0, the format of /frequency will be expanded:

   Value format    text representing the fraction of population carrying the
                   variation expressed as a decimal fraction, or the number
                   observed instances vs the total number of sequenced isolates

   Example         /frequency=".85"
                   /frequency="23/108"
                   /frequency="1 in 12"

1.4.8 /cons_splice qualifier to be removed

  The /cons_splice qualifier has almost no usage within the sequence
database. In addition, it does not account for the variation in splice
signals that might be used by different classes of introns. So this
qualfier will be removed from sequence records, and the Feature Table
document, as of Release 168.0 in October 2008.

1.4.9 /virion qualifier to be removed

  The intent of /virion is to indicate that a sequenced molecule
is from an encapsidated viral particle (as opposed to the proviral
form of a virus, integrated into the host's genome). Viral sequences
derived from a blood sample taken from an infected organism might
typically be flagged with /virion, if it is believed that the sample
contained viral particles.

  However, a review of the database reveals that this qualifier is
not used consistently, and furthermore, submitters often are unable
to conclusively state that a virus sequence derives from the 
encapsidated form. So the /virion qualifier will be removed from 
sequence records, and the Feature Table document, as of Release 168.0
in October 2008.

1.4.10 Updated value format for /exception

  Only three values for the /exception qualifier have been approved
for use by the INSDC : 

	"rearrangement required for product"
	"RNA editing"
	"reasons given in citation"

However, the definition of /exception in the Feature Table document
does not indicate that the contents of /exception are controlled.
This oversight will be corrected in the October 2008.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1617 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut7.idx - Index of the entries according to author name, part 7.
61. gbaut8.idx - Index of the entries according to author name, part 8.
62. gbaut9.idx - Index of the entries according to author name, part 9.
63. gbbct1.seq - Bacterial sequence entries, part 1.
64. gbbct10.seq - Bacterial sequence entries, part 10.
65. gbbct11.seq - Bacterial sequence entries, part 11.
66. gbbct12.seq - Bacterial sequence entries, part 12.
67. gbbct13.seq - Bacterial sequence entries, part 13.
68. gbbct14.seq - Bacterial sequence entries, part 14.
69. gbbct15.seq - Bacterial sequence entries, part 15.
70. gbbct16.seq - Bacterial sequence entries, part 16.
71. gbbct17.seq - Bacterial sequence entries, part 17.
72. gbbct18.seq - Bacterial sequence entries, part 18.
73. gbbct19.seq - Bacterial sequence entries, part 19.
74. gbbct2.seq - Bacterial sequence entries, part 2.
75. gbbct20.seq - Bacterial sequence entries, part 20.
76. gbbct21.seq - Bacterial sequence entries, part 21.
77. gbbct22.seq - Bacterial sequence entries, part 22.
78. gbbct23.seq - Bacterial sequence entries, part 23.
79. gbbct24.seq - Bacterial sequence entries, part 24.
80. gbbct25.seq - Bacterial sequence entries, part 25.
81. gbbct26.seq - Bacterial sequence entries, part 26.
82. gbbct27.seq - Bacterial sequence entries, part 27.
83. gbbct28.seq - Bacterial sequence entries, part 28.
84. gbbct29.seq - Bacterial sequence entries, part 29.
85. gbbct3.seq - Bacterial sequence entries, part 3.
86. gbbct30.seq - Bacterial sequence entries, part 30.
87. gbbct4.seq - Bacterial sequence entries, part 4.
88. gbbct5.seq - Bacterial sequence entries, part 5.
89. gbbct6.seq - Bacterial sequence entries, part 6.
90. gbbct7.seq - Bacterial sequence entries, part 7.
91. gbbct8.seq - Bacterial sequence entries, part 8.
92. gbbct9.seq - Bacterial sequence entries, part 9.
93. gbchg.txt - Accession numbers of entries updated since the previous release.
94. gbcon1.seq - Constructed sequence entries, part 1.
95. gbcon10.seq - Constructed sequence entries, part 10.
96. gbcon11.seq - Constructed sequence entries, part 11.
97. gbcon12.seq - Constructed sequence entries, part 12.
98. gbcon13.seq - Constructed sequence entries, part 13.
99. gbcon14.seq - Constructed sequence entries, part 14.
100. gbcon15.seq - Constructed sequence entries, part 15.
101. gbcon16.seq - Constructed sequence entries, part 16.
102. gbcon17.seq - Constructed sequence entries, part 17.
103. gbcon18.seq - Constructed sequence entries, part 18.
104. gbcon19.seq - Constructed sequence entries, part 19.
105. gbcon2.seq - Constructed sequence entries, part 2.
106. gbcon20.seq - Constructed sequence entries, part 20.
107. gbcon21.seq - Constructed sequence entries, part 21.
108. gbcon22.seq - Constructed sequence entries, part 22.
109. gbcon23.seq - Constructed sequence entries, part 23.
110. gbcon24.seq - Constructed sequence entries, part 24.
111. gbcon25.seq - Constructed sequence entries, part 25.
112. gbcon26.seq - Constructed sequence entries, part 26.
113. gbcon27.seq - Constructed sequence entries, part 27.
114. gbcon28.seq - Constructed sequence entries, part 28.
115. gbcon29.seq - Constructed sequence entries, part 29.
116. gbcon3.seq - Constructed sequence entries, part 3.
117. gbcon30.seq - Constructed sequence entries, part 30.
118. gbcon31.seq - Constructed sequence entries, part 31.
119. gbcon32.seq - Constructed sequence entries, part 32.
120. gbcon33.seq - Constructed sequence entries, part 33.
121. gbcon34.seq - Constructed sequence entries, part 34.
122. gbcon35.seq - Constructed sequence entries, part 35.
123. gbcon36.seq - Constructed sequence entries, part 36.
124. gbcon37.seq - Constructed sequence entries, part 37.
125. gbcon38.seq - Constructed sequence entries, part 38.
126. gbcon39.seq - Constructed sequence entries, part 39.
127. gbcon4.seq - Constructed sequence entries, part 4.
128. gbcon40.seq - Constructed sequence entries, part 40.
129. gbcon41.seq - Constructed sequence entries, part 41.
130. gbcon42.seq - Constructed sequence entries, part 42.
131. gbcon43.seq - Constructed sequence entries, part 43.
132. gbcon44.seq - Constructed sequence entries, part 44.
133. gbcon45.seq - Constructed sequence entries, part 45.
134. gbcon46.seq - Constructed sequence entries, part 46.
135. gbcon47.seq - Constructed sequence entries, part 47.
136. gbcon48.seq - Constructed sequence entries, part 48.
137. gbcon49.seq - Constructed sequence entries, part 49.
138. gbcon5.seq - Constructed sequence entries, part 5.
139. gbcon50.seq - Constructed sequence entries, part 50.
140. gbcon51.seq - Constructed sequence entries, part 51.
141. gbcon52.seq - Constructed sequence entries, part 52.
142. gbcon53.seq - Constructed sequence entries, part 53.
143. gbcon54.seq - Constructed sequence entries, part 54.
144. gbcon55.seq - Constructed sequence entries, part 55.
145. gbcon56.seq - Constructed sequence entries, part 56.
146. gbcon57.seq - Constructed sequence entries, part 57.
147. gbcon58.seq - Constructed sequence entries, part 58.
148. gbcon59.seq - Constructed sequence entries, part 59.
149. gbcon6.seq - Constructed sequence entries, part 6.
150. gbcon60.seq - Constructed sequence entries, part 60.
151. gbcon61.seq - Constructed sequence entries, part 61.
152. gbcon62.seq - Constructed sequence entries, part 62.
153. gbcon63.seq - Constructed sequence entries, part 63.
154. gbcon64.seq - Constructed sequence entries, part 64.
155. gbcon65.seq - Constructed sequence entries, part 65.
156. gbcon66.seq - Constructed sequence entries, part 66.
157. gbcon67.seq - Constructed sequence entries, part 67.
158. gbcon68.seq - Constructed sequence entries, part 68.
159. gbcon69.seq - Constructed sequence entries, part 69.
160. gbcon7.seq - Constructed sequence entries, part 7.
161. gbcon70.seq - Constructed sequence entries, part 70.
162. gbcon71.seq - Constructed sequence entries, part 71.
163. gbcon72.seq - Constructed sequence entries, part 72.
164. gbcon73.seq - Constructed sequence entries, part 73.
165. gbcon74.seq - Constructed sequence entries, part 74.
166. gbcon75.seq - Constructed sequence entries, part 75.
167. gbcon76.seq - Constructed sequence entries, part 76.
168. gbcon77.seq - Constructed sequence entries, part 77.
169. gbcon78.seq - Constructed sequence entries, part 78.
170. gbcon79.seq - Constructed sequence entries, part 79.
171. gbcon8.seq - Constructed sequence entries, part 8.
172. gbcon80.seq - Constructed sequence entries, part 80.
173. gbcon81.seq - Constructed sequence entries, part 81.
174. gbcon82.seq - Constructed sequence entries, part 82.
175. gbcon83.seq - Constructed sequence entries, part 83.
176. gbcon84.seq - Constructed sequence entries, part 84.
177. gbcon85.seq - Constructed sequence entries, part 85.
178. gbcon86.seq - Constructed sequence entries, part 86.
179. gbcon87.seq - Constructed sequence entries, part 87.
180. gbcon88.seq - Constructed sequence entries, part 88.
181. gbcon89.seq - Constructed sequence entries, part 89.
182. gbcon9.seq - Constructed sequence entries, part 9.
183. gbcon90.seq - Constructed sequence entries, part 90.
184. gbcon91.seq - Constructed sequence entries, part 91.
185. gbcon92.seq - Constructed sequence entries, part 92.
186. gbcon93.seq - Constructed sequence entries, part 93.
187. gbcon94.seq - Constructed sequence entries, part 94.
188. gbcon95.seq - Constructed sequence entries, part 95.
189. gbcon96.seq - Constructed sequence entries, part 96.
190. gbcon97.seq - Constructed sequence entries, part 97.
191. gbdel.txt - Accession numbers of entries deleted since the previous release.
192. gbenv1.seq - Environmental sampling sequence entries, part 1.
193. gbenv10.seq - Environmental sampling sequence entries, part 10.
194. gbenv2.seq - Environmental sampling sequence entries, part 2.
195. gbenv3.seq - Environmental sampling sequence entries, part 3.
196. gbenv4.seq - Environmental sampling sequence entries, part 4.
197. gbenv5.seq - Environmental sampling sequence entries, part 5.
198. gbenv6.seq - Environmental sampling sequence entries, part 6.
199. gbenv7.seq - Environmental sampling sequence entries, part 7.
200. gbenv8.seq - Environmental sampling sequence entries, part 8.
201. gbenv9.seq - Environmental sampling sequence entries, part 9.
202. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
203. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
204. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
205. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
206. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
207. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
208. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
209. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
210. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
211. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
212. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
213. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
214. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
215. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
216. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
217. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
218. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
219. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
220. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
221. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
222. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
223. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
224. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
225. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
226. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
227. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
228. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
229. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
230. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
231. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
232. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
233. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
234. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
235. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
236. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
237. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
238. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
239. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
240. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
241. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
242. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
243. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
244. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
245. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
246. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
247. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
248. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
249. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
250. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
251. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
252. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
253. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
254. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
255. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
256. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
257. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
258. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
259. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
260. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
261. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
262. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
263. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
264. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
265. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
266. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
267. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
268. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
269. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
270. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
271. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
272. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
273. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
274. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
275. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
276. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
277. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
278. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
279. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
280. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
281. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
282. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
283. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
284. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
285. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
286. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
287. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
288. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
289. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
290. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
291. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
292. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
293. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
294. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
295. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
296. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
297. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
298. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
299. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
300. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
301. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
302. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
303. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
304. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
305. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
306. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
307. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
308. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
309. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
310. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
311. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
312. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
313. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
314. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
315. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
316. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
317. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
318. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
319. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
320. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
321. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
322. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
323. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
324. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
325. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
326. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
327. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
328. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
329. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
330. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
331. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
332. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
333. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
334. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
335. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
336. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
337. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
338. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
339. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
340. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
341. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
342. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
343. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
344. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
345. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
346. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
347. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
348. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
349. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
350. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
351. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
352. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
353. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
354. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
355. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
356. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
357. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
358. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
359. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
360. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
361. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
362. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
363. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
364. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
365. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
366. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
367. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
368. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
369. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
370. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
371. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
372. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
373. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
374. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
375. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
376. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
377. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
378. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
379. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
380. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
381. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
382. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
383. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
384. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
385. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
386. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
387. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
388. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
389. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
390. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
391. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
392. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
393. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
394. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
395. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
396. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
397. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
398. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
399. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
400. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
401. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
402. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
403. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
404. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
405. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
406. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
407. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
408. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
409. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
410. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
411. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
412. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
413. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
414. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
415. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
416. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
417. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
418. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
419. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
420. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
421. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
422. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
423. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
424. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
425. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
426. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
427. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
428. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
429. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
430. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
431. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
432. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
433. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
434. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
435. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
436. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
437. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
438. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
439. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
440. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
441. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
442. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
443. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
444. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
445. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
446. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
447. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
448. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
449. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
450. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
451. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
452. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
453. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
454. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
455. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
456. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
457. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
458. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
459. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
460. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
461. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
462. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
463. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
464. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
465. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
466. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
467. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
468. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
469. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
470. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
471. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
472. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
473. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
474. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
475. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
476. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
477. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
478. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
479. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
480. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
481. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
482. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
483. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
484. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
485. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
486. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
487. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
488. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
489. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
490. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
491. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
492. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
493. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
494. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
495. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
496. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
497. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
498. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
499. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
500. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
501. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
502. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
503. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
504. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
505. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
506. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
507. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
508. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
509. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
510. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
511. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
512. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
513. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
514. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
515. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
516. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
517. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
518. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
519. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
520. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
521. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
522. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
523. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
524. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
525. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
526. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
527. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
528. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
529. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
530. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
531. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
532. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
533. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
534. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
535. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
536. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
537. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
538. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
539. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
540. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
541. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
542. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
543. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
544. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
545. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
546. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
547. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
548. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
549. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
550. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
551. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
552. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
553. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
554. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
555. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
556. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
557. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
558. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
559. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
560. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
561. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
562. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
563. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
564. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
565. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
566. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
567. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
568. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
569. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
570. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
571. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
572. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
573. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
574. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
575. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
576. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
577. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
578. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
579. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
580. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
581. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
582. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
583. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
584. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
585. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
586. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
587. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
588. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
589. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
590. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
591. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
592. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
593. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
594. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
595. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
596. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
597. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
598. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
599. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
600. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
601. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
602. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
603. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
604. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
605. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
606. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
607. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
608. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
609. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
610. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
611. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
612. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
613. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
614. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
615. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
616. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
617. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
618. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
619. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
620. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
621. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
622. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
623. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
624. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
625. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
626. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
627. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
628. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
629. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
630. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
631. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
632. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
633. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
634. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
635. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
636. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
637. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
638. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
639. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
640. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
641. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
642. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
643. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
644. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
645. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
646. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
647. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
648. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
649. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
650. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
651. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
652. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
653. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
654. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
655. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
656. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
657. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
658. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
659. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
660. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
661. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
662. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
663. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
664. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
665. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
666. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
667. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
668. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
669. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
670. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
671. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
672. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
673. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
674. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
675. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
676. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
677. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
678. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
679. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
680. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
681. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
682. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
683. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
684. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
685. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
686. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
687. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
688. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
689. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
690. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
691. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
692. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
693. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
694. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
695. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
696. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
697. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
698. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
699. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
700. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
701. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
702. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
703. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
704. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
705. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
706. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
707. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
708. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
709. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
710. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
711. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
712. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
713. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
714. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
715. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
716. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
717. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
718. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
719. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
720. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
721. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
722. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
723. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
724. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
725. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
726. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
727. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
728. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
729. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
730. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
731. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
732. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
733. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
734. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
735. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
736. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
737. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
738. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
739. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
740. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
741. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
742. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
743. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
744. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
745. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
746. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
747. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
748. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
749. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
750. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
751. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
752. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
753. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
754. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
755. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
756. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
757. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
758. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
759. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
760. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
761. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
762. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
763. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
764. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
765. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
766. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
767. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
768. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
769. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
770. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
771. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
772. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
773. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
774. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
775. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
776. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
777. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
778. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
779. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
780. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
781. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
782. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
783. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
784. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
785. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
786. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
787. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
788. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
789. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
790. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
791. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
792. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
793. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
794. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
795. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
796. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
797. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
798. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
799. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
800. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
801. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
802. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
803. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
804. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
805. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
806. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
807. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
808. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
809. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
810. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
811. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
812. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
813. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
814. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
815. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
816. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
817. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
818. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
819. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
820. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
821. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
822. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
823. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
824. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
825. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
826. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
827. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
828. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
829. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
830. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
831. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
832. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
833. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
834. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
835. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
836. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
837. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
838. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
839. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
840. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
841. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
842. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
843. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
844. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
845. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
846. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
847. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
848. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
849. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
850. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
851. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
852. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
853. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
854. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
855. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
856. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
857. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
858. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
859. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
860. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
861. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
862. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
863. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
864. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
865. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
866. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
867. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
868. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
869. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
870. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
871. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
872. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
873. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
874. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
875. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
876. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
877. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
878. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
879. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
880. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
881. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
882. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
883. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
884. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
885. gbest714.seq - EST (expressed sequence tag) sequence entries, part 714.
886. gbest715.seq - EST (expressed sequence tag) sequence entries, part 715.
887. gbest716.seq - EST (expressed sequence tag) sequence entries, part 716.
888. gbest717.seq - EST (expressed sequence tag) sequence entries, part 717.
889. gbest718.seq - EST (expressed sequence tag) sequence entries, part 718.
890. gbest719.seq - EST (expressed sequence tag) sequence entries, part 719.
891. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
892. gbest720.seq - EST (expressed sequence tag) sequence entries, part 720.
893. gbest721.seq - EST (expressed sequence tag) sequence entries, part 721.
894. gbest722.seq - EST (expressed sequence tag) sequence entries, part 722.
895. gbest723.seq - EST (expressed sequence tag) sequence entries, part 723.
896. gbest724.seq - EST (expressed sequence tag) sequence entries, part 724.
897. gbest725.seq - EST (expressed sequence tag) sequence entries, part 725.
898. gbest726.seq - EST (expressed sequence tag) sequence entries, part 726.
899. gbest727.seq - EST (expressed sequence tag) sequence entries, part 727.
900. gbest728.seq - EST (expressed sequence tag) sequence entries, part 728.
901. gbest729.seq - EST (expressed sequence tag) sequence entries, part 729.
902. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
903. gbest730.seq - EST (expressed sequence tag) sequence entries, part 730.
904. gbest731.seq - EST (expressed sequence tag) sequence entries, part 731.
905. gbest732.seq - EST (expressed sequence tag) sequence entries, part 732.
906. gbest733.seq - EST (expressed sequence tag) sequence entries, part 733.
907. gbest734.seq - EST (expressed sequence tag) sequence entries, part 734.
908. gbest735.seq - EST (expressed sequence tag) sequence entries, part 735.
909. gbest736.seq - EST (expressed sequence tag) sequence entries, part 736.
910. gbest737.seq - EST (expressed sequence tag) sequence entries, part 737.
911. gbest738.seq - EST (expressed sequence tag) sequence entries, part 738.
912. gbest739.seq - EST (expressed sequence tag) sequence entries, part 739.
913. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
914. gbest740.seq - EST (expressed sequence tag) sequence entries, part 740.
915. gbest741.seq - EST (expressed sequence tag) sequence entries, part 741.
916. gbest742.seq - EST (expressed sequence tag) sequence entries, part 742.
917. gbest743.seq - EST (expressed sequence tag) sequence entries, part 743.
918. gbest744.seq - EST (expressed sequence tag) sequence entries, part 744.
919. gbest745.seq - EST (expressed sequence tag) sequence entries, part 745.
920. gbest746.seq - EST (expressed sequence tag) sequence entries, part 746.
921. gbest747.seq - EST (expressed sequence tag) sequence entries, part 747.
922. gbest748.seq - EST (expressed sequence tag) sequence entries, part 748.
923. gbest749.seq - EST (expressed sequence tag) sequence entries, part 749.
924. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
925. gbest750.seq - EST (expressed sequence tag) sequence entries, part 750.
926. gbest751.seq - EST (expressed sequence tag) sequence entries, part 751.
927. gbest752.seq - EST (expressed sequence tag) sequence entries, part 752.
928. gbest753.seq - EST (expressed sequence tag) sequence entries, part 753.
929. gbest754.seq - EST (expressed sequence tag) sequence entries, part 754.
930. gbest755.seq - EST (expressed sequence tag) sequence entries, part 755.
931. gbest756.seq - EST (expressed sequence tag) sequence entries, part 756.
932. gbest757.seq - EST (expressed sequence tag) sequence entries, part 757.
933. gbest758.seq - EST (expressed sequence tag) sequence entries, part 758.
934. gbest759.seq - EST (expressed sequence tag) sequence entries, part 759.
935. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
936. gbest760.seq - EST (expressed sequence tag) sequence entries, part 760.
937. gbest761.seq - EST (expressed sequence tag) sequence entries, part 761.
938. gbest762.seq - EST (expressed sequence tag) sequence entries, part 762.
939. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
940. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
941. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
942. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
943. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
944. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
945. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
946. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
947. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
948. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
949. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
950. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
951. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
952. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
953. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
954. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
955. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
956. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
957. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
958. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
959. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
960. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
961. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
962. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
963. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
964. gbgen.idx - Index of the entries according to gene symbols.
965. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
966. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
967. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
968. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
969. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
970. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
971. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
972. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
973. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
974. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
975. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
976. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
977. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
978. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
979. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
980. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
981. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
982. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
983. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
984. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
985. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
986. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
987. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
988. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
989. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
990. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
991. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
992. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
993. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
994. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
995. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
996. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
997. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
998. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
999. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1000. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1001. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1002. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1003. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1004. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1005. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1006. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1007. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1008. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1009. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1010. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1011. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1012. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1013. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1014. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1015. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1016. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1017. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1018. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1019. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1020. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1021. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1022. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1023. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1024. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1025. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1026. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1027. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1028. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1029. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1030. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1031. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1032. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1033. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1034. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1035. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1036. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1037. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1038. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1039. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1040. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1041. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1042. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1043. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1044. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1045. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1046. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1047. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1048. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1049. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1050. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1051. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1052. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1053. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1054. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1055. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1056. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1057. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1058. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1059. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1060. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1061. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1062. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1063. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1064. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1065. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1066. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1067. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1068. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1069. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1070. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1071. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1072. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1073. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1074. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1075. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1076. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1077. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1078. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1079. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1080. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1081. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1082. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1083. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1084. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1085. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1086. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1087. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1088. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1089. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1090. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1091. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1092. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1093. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1094. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1095. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1096. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1097. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1098. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1099. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1100. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1101. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1102. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1103. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1104. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1105. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1106. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1107. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1108. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1109. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1110. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1111. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1112. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1113. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1114. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1115. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1116. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1117. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1118. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1119. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1120. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1121. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1122. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1123. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1124. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1125. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1126. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1127. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1128. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1129. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1130. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1131. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1132. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1133. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1134. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1135. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1136. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1137. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1138. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1139. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1140. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1141. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1142. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1143. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1144. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1145. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1146. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1147. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1148. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1149. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1150. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1151. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1152. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1153. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1154. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1155. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1156. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1157. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1158. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1159. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1160. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1161. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1162. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1163. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1164. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1165. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1166. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1167. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1168. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1169. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1170. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1171. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1172. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1173. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1174. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1175. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1176. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1177. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1178. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1179. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1180. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1181. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1182. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1183. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1184. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1185. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1186. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1187. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1188. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1189. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1190. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1191. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1192. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1193. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1194. gbgss305.seq - GSS (genome survey sequence) sequence entries, part 305.
1195. gbgss306.seq - GSS (genome survey sequence) sequence entries, part 306.
1196. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1197. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1198. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1199. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1200. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1201. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1202. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1203. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1204. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1205. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1206. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1207. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1208. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1209. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1210. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1211. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1212. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1213. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1214. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1215. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1216. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1217. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1218. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1219. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1220. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1221. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1222. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1223. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1224. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1225. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1226. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1227. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1228. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1229. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1230. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1231. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1232. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1233. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1234. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1235. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1236. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1237. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1238. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1239. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1240. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1241. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1242. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1243. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1244. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1245. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1246. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1247. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1248. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1249. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1250. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1251. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1252. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1253. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1254. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1255. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1256. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1257. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1258. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1259. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1260. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1261. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1262. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1263. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1264. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1265. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1266. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1267. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1268. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1269. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1270. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1271. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1272. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1273. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1274. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1275. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1276. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1277. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1278. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1279. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1280. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1281. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1282. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1283. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1284. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1285. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1286. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1287. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1288. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1289. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1290. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1291. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1292. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1293. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1294. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1295. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1296. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1297. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1298. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1299. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1300. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1301. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1302. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1303. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1304. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1305. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1306. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1307. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1308. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1309. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1310. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1311. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1312. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1313. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1314. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1315. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1316. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1317. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1318. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1319. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1320. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1321. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1322. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1323. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1324. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1325. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1326. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1327. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1328. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1329. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1330. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1331. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1332. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1333. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1334. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1335. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1336. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1337. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1338. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1339. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1340. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1341. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1342. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1343. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1344. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1345. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1346. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1347. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1348. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1349. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1350. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1351. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1352. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1353. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1354. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1355. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1356. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1357. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1358. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1359. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1360. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1361. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1362. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1363. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1364. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1365. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1366. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1367. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1368. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1369. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1370. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1371. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1372. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1373. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1374. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1375. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1376. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1377. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1378. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1379. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1380. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1381. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1382. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1383. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1384. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1385. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1386. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1387. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1388. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1389. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1390. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1391. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1392. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1393. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1394. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1395. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1396. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1397. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1398. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1399. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1400. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1401. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1402. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1403. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1404. gbinv1.seq - Invertebrate sequence entries, part 1.
1405. gbinv10.seq - Invertebrate sequence entries, part 10.
1406. gbinv11.seq - Invertebrate sequence entries, part 11.
1407. gbinv12.seq - Invertebrate sequence entries, part 12.
1408. gbinv13.seq - Invertebrate sequence entries, part 13.
1409. gbinv2.seq - Invertebrate sequence entries, part 2.
1410. gbinv3.seq - Invertebrate sequence entries, part 3.
1411. gbinv4.seq - Invertebrate sequence entries, part 4.
1412. gbinv5.seq - Invertebrate sequence entries, part 5.
1413. gbinv6.seq - Invertebrate sequence entries, part 6.
1414. gbinv7.seq - Invertebrate sequence entries, part 7.
1415. gbinv8.seq - Invertebrate sequence entries, part 8.
1416. gbinv9.seq - Invertebrate sequence entries, part 9.
1417. gbjou1.idx - Index of the entries according to journal citation, part 1.
1418. gbjou2.idx - Index of the entries according to journal citation, part 2.
1419. gbjou3.idx - Index of the entries according to journal citation, part 3.
1420. gbjou4.idx - Index of the entries according to journal citation, part 4.
1421. gbjou5.idx - Index of the entries according to journal citation, part 5.
1422. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1423. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1424. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1425. gbmam1.seq - Other mammalian sequence entries, part 1.
1426. gbmam2.seq - Other mammalian sequence entries, part 2.
1427. gbmam3.seq - Other mammalian sequence entries, part 3.
1428. gbmam4.seq - Other mammalian sequence entries, part 4.
1429. gbnew.txt - Accession numbers of entries new since the previous release.
1430. gbpat1.seq - Patent sequence entries, part 1.
1431. gbpat10.seq - Patent sequence entries, part 10.
1432. gbpat11.seq - Patent sequence entries, part 11.
1433. gbpat12.seq - Patent sequence entries, part 12.
1434. gbpat13.seq - Patent sequence entries, part 13.
1435. gbpat14.seq - Patent sequence entries, part 14.
1436. gbpat15.seq - Patent sequence entries, part 15.
1437. gbpat16.seq - Patent sequence entries, part 16.
1438. gbpat17.seq - Patent sequence entries, part 17.
1439. gbpat18.seq - Patent sequence entries, part 18.
1440. gbpat19.seq - Patent sequence entries, part 19.
1441. gbpat2.seq - Patent sequence entries, part 2.
1442. gbpat20.seq - Patent sequence entries, part 20.
1443. gbpat21.seq - Patent sequence entries, part 21.
1444. gbpat22.seq - Patent sequence entries, part 22.
1445. gbpat23.seq - Patent sequence entries, part 23.
1446. gbpat24.seq - Patent sequence entries, part 24.
1447. gbpat25.seq - Patent sequence entries, part 25.
1448. gbpat26.seq - Patent sequence entries, part 26.
1449. gbpat27.seq - Patent sequence entries, part 27.
1450. gbpat28.seq - Patent sequence entries, part 28.
1451. gbpat29.seq - Patent sequence entries, part 29.
1452. gbpat3.seq - Patent sequence entries, part 3.
1453. gbpat30.seq - Patent sequence entries, part 30.
1454. gbpat31.seq - Patent sequence entries, part 31.
1455. gbpat32.seq - Patent sequence entries, part 32.
1456. gbpat33.seq - Patent sequence entries, part 33.
1457. gbpat34.seq - Patent sequence entries, part 34.
1458. gbpat35.seq - Patent sequence entries, part 35.
1459. gbpat36.seq - Patent sequence entries, part 36.
1460. gbpat37.seq - Patent sequence entries, part 37.
1461. gbpat38.seq - Patent sequence entries, part 38.
1462. gbpat39.seq - Patent sequence entries, part 39.
1463. gbpat4.seq - Patent sequence entries, part 4.
1464. gbpat40.seq - Patent sequence entries, part 40.
1465. gbpat41.seq - Patent sequence entries, part 41.
1466. gbpat42.seq - Patent sequence entries, part 42.
1467. gbpat43.seq - Patent sequence entries, part 43.
1468. gbpat44.seq - Patent sequence entries, part 44.
1469. gbpat45.seq - Patent sequence entries, part 45.
1470. gbpat46.seq - Patent sequence entries, part 46.
1471. gbpat5.seq - Patent sequence entries, part 5.
1472. gbpat6.seq - Patent sequence entries, part 6.
1473. gbpat7.seq - Patent sequence entries, part 7.
1474. gbpat8.seq - Patent sequence entries, part 8.
1475. gbpat9.seq - Patent sequence entries, part 9.
1476. gbphg.seq - Phage sequence entries.
1477. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1478. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1479. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1480. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1481. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1482. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1483. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1484. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1485. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1486. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1487. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1488. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1489. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1490. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1491. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1492. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1493. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1494. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1495. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1496. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1497. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1498. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1499. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1500. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1501. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1502. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1503. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1504. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1505. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1506. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1507. gbpri1.seq - Primate sequence entries, part 1.
1508. gbpri10.seq - Primate sequence entries, part 10.
1509. gbpri11.seq - Primate sequence entries, part 11.
1510. gbpri12.seq - Primate sequence entries, part 12.
1511. gbpri13.seq - Primate sequence entries, part 13.
1512. gbpri14.seq - Primate sequence entries, part 14.
1513. gbpri15.seq - Primate sequence entries, part 15.
1514. gbpri16.seq - Primate sequence entries, part 16.
1515. gbpri17.seq - Primate sequence entries, part 17.
1516. gbpri18.seq - Primate sequence entries, part 18.
1517. gbpri19.seq - Primate sequence entries, part 19.
1518. gbpri2.seq - Primate sequence entries, part 2.
1519. gbpri20.seq - Primate sequence entries, part 20.
1520. gbpri21.seq - Primate sequence entries, part 21.
1521. gbpri22.seq - Primate sequence entries, part 22.
1522. gbpri23.seq - Primate sequence entries, part 23.
1523. gbpri24.seq - Primate sequence entries, part 24.
1524. gbpri25.seq - Primate sequence entries, part 25.
1525. gbpri26.seq - Primate sequence entries, part 26.
1526. gbpri27.seq - Primate sequence entries, part 27.
1527. gbpri28.seq - Primate sequence entries, part 28.
1528. gbpri29.seq - Primate sequence entries, part 29.
1529. gbpri3.seq - Primate sequence entries, part 3.
1530. gbpri30.seq - Primate sequence entries, part 30.
1531. gbpri31.seq - Primate sequence entries, part 31.
1532. gbpri32.seq - Primate sequence entries, part 32.
1533. gbpri33.seq - Primate sequence entries, part 33.
1534. gbpri34.seq - Primate sequence entries, part 34.
1535. gbpri35.seq - Primate sequence entries, part 35.
1536. gbpri36.seq - Primate sequence entries, part 36.
1537. gbpri4.seq - Primate sequence entries, part 4.
1538. gbpri5.seq - Primate sequence entries, part 5.
1539. gbpri6.seq - Primate sequence entries, part 6.
1540. gbpri7.seq - Primate sequence entries, part 7.
1541. gbpri8.seq - Primate sequence entries, part 8.
1542. gbpri9.seq - Primate sequence entries, part 9.
1543. gbrel.txt - Release notes (this document).
1544. gbrod1.seq - Rodent sequence entries, part 1.
1545. gbrod10.seq - Rodent sequence entries, part 10.
1546. gbrod11.seq - Rodent sequence entries, part 11.
1547. gbrod12.seq - Rodent sequence entries, part 12.
1548. gbrod13.seq - Rodent sequence entries, part 13.
1549. gbrod14.seq - Rodent sequence entries, part 14.
1550. gbrod15.seq - Rodent sequence entries, part 15.
1551. gbrod16.seq - Rodent sequence entries, part 16.
1552. gbrod17.seq - Rodent sequence entries, part 17.
1553. gbrod18.seq - Rodent sequence entries, part 18.
1554. gbrod19.seq - Rodent sequence entries, part 19.
1555. gbrod2.seq - Rodent sequence entries, part 2.
1556. gbrod20.seq - Rodent sequence entries, part 20.
1557. gbrod21.seq - Rodent sequence entries, part 21.
1558. gbrod22.seq - Rodent sequence entries, part 22.
1559. gbrod23.seq - Rodent sequence entries, part 23.
1560. gbrod24.seq - Rodent sequence entries, part 24.
1561. gbrod25.seq - Rodent sequence entries, part 25.
1562. gbrod26.seq - Rodent sequence entries, part 26.
1563. gbrod3.seq - Rodent sequence entries, part 3.
1564. gbrod4.seq - Rodent sequence entries, part 4.
1565. gbrod5.seq - Rodent sequence entries, part 5.
1566. gbrod6.seq - Rodent sequence entries, part 6.
1567. gbrod7.seq - Rodent sequence entries, part 7.
1568. gbrod8.seq - Rodent sequence entries, part 8.
1569. gbrod9.seq - Rodent sequence entries, part 9.
1570. gbsdr1.txt - Short directory of the data bank, part 1.
1571. gbsdr2.txt - Short directory of the data bank, part 2.
1572. gbsdr3.txt - Short directory of the data bank, part 3.
1573. gbsec.idx - Index of the entries according to secondary accession number.
1574. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1575. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1576. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1577. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1578. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1579. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1580. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1581. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1582. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1583. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1584. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1585. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1586. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1587. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1588. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1589. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1590. gbtsa.seq - TSA (transcriptome shotgun assembly) sequence entries.
1591. gbuna.seq - Unannotated sequence entries.
1592. gbvrl1.seq - Viral sequence entries, part 1.
1593. gbvrl10.seq - Viral sequence entries, part 10.
1594. gbvrl2.seq - Viral sequence entries, part 2.
1595. gbvrl3.seq - Viral sequence entries, part 3.
1596. gbvrl4.seq - Viral sequence entries, part 4.
1597. gbvrl5.seq - Viral sequence entries, part 5.
1598. gbvrl6.seq - Viral sequence entries, part 6.
1599. gbvrl7.seq - Viral sequence entries, part 7.
1600. gbvrl8.seq - Viral sequence entries, part 8.
1601. gbvrl9.seq - Viral sequence entries, part 9.
1602. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1603. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1604. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1605. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1606. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1607. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1608. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1609. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1610. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1611. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1612. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1613. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1614. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1615. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1616. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1617. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 167.0 flatfiles require roughly 357 GB (sequence
files only) or 381 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 780100423     gbacc1.idx
1804376616     gbacc2.idx
 628914963     gbacc3.idx
 238918373     gbaut1.idx
 184342927     gbaut10.idx
 184838442     gbaut11.idx
 183872388     gbaut12.idx
 225165568     gbaut13.idx
 241279952     gbaut14.idx
 252497843     gbaut15.idx
 240983344     gbaut16.idx
 184129451     gbaut17.idx
 184168871     gbaut18.idx
 183914697     gbaut19.idx
 233735650     gbaut2.idx
 183787332     gbaut20.idx
 186846488     gbaut21.idx
 198603546     gbaut22.idx
 183764720     gbaut23.idx
 183973246     gbaut24.idx
 184328419     gbaut25.idx
 183847365     gbaut26.idx
 183639097     gbaut27.idx
 220781272     gbaut28.idx
 185071351     gbaut29.idx
 183708230     gbaut3.idx
 186396516     gbaut30.idx
 188234295     gbaut31.idx
 188404459     gbaut32.idx
 184513820     gbaut33.idx
 185627499     gbaut34.idx
 185681682     gbaut35.idx
 184500518     gbaut36.idx
 184274256     gbaut37.idx
 183728712     gbaut38.idx
 183832471     gbaut39.idx
 184886389     gbaut4.idx
 185007068     gbaut40.idx
 187553069     gbaut41.idx
 212903201     gbaut42.idx
 233859084     gbaut43.idx
 187215960     gbaut44.idx
 184928334     gbaut45.idx
 207912176     gbaut46.idx
 222932539     gbaut47.idx
 228105666     gbaut48.idx
 184984678     gbaut49.idx
 250020531     gbaut5.idx
 235436359     gbaut50.idx
 184281062     gbaut51.idx
 239142295     gbaut52.idx
 183703478     gbaut53.idx
 183858735     gbaut54.idx
 186655786     gbaut55.idx
 184756949     gbaut56.idx
 184239186     gbaut57.idx
 185967868     gbaut58.idx
 145036791     gbaut59.idx
 185544638     gbaut6.idx
 184805009     gbaut7.idx
 186271089     gbaut8.idx
 184819928     gbaut9.idx
 256569046     gbbct1.seq
 255809926     gbbct10.seq
 250682882     gbbct11.seq
 251360417     gbbct12.seq
 256138920     gbbct13.seq
 255351775     gbbct14.seq
 256612328     gbbct15.seq
 250980809     gbbct16.seq
 272143467     gbbct17.seq
 250847047     gbbct18.seq
 251598768     gbbct19.seq
 253387342     gbbct2.seq
 253401435     gbbct20.seq
 254408565     gbbct21.seq
 260569046     gbbct22.seq
 259692982     gbbct23.seq
 255061629     gbbct24.seq
 257249409     gbbct25.seq
 252456819     gbbct26.seq
 256585747     gbbct27.seq
 250002525     gbbct28.seq
 250001860     gbbct29.seq
 260920174     gbbct3.seq
 232701989     gbbct30.seq
 250004816     gbbct4.seq
 250013643     gbbct5.seq
 252396923     gbbct6.seq
 251646875     gbbct7.seq
 258783494     gbbct8.seq
 250014862     gbbct9.seq
  14625441     gbchg.txt
 250191830     gbcon1.seq
 250008277     gbcon10.seq
 252904240     gbcon11.seq
 250006510     gbcon12.seq
 251113149     gbcon13.seq
 250000541     gbcon14.seq
 250005565     gbcon15.seq
 250002594     gbcon16.seq
 250000503     gbcon17.seq
 250002092     gbcon18.seq
 250036286     gbcon19.seq
 251495535     gbcon2.seq
 250000726     gbcon20.seq
 250001292     gbcon21.seq
 250001078     gbcon22.seq
 250006315     gbcon23.seq
 250002370     gbcon24.seq
 250001365     gbcon25.seq
 250000587     gbcon26.seq
 250000155     gbcon27.seq
 250000399     gbcon28.seq
 250001146     gbcon29.seq
 250119853     gbcon3.seq
 250005244     gbcon30.seq
 250001561     gbcon31.seq
 250003323     gbcon32.seq
 250001813     gbcon33.seq
 250003486     gbcon34.seq
 250002748     gbcon35.seq
 250005619     gbcon36.seq
 250004929     gbcon37.seq
 250002120     gbcon38.seq
 250005837     gbcon39.seq
 250000457     gbcon4.seq
 250001071     gbcon40.seq
 250000308     gbcon41.seq
 250004430     gbcon42.seq
 250000576     gbcon43.seq
 250000069     gbcon44.seq
 250006375     gbcon45.seq
 250001970     gbcon46.seq
 250004036     gbcon47.seq
 250004103     gbcon48.seq
 250003544     gbcon49.seq
 250000751     gbcon5.seq
 250004779     gbcon50.seq
 250000855     gbcon51.seq
 250001006     gbcon52.seq
 250001911     gbcon53.seq
 250001180     gbcon54.seq
 250000491     gbcon55.seq
 250000531     gbcon56.seq
 250000131     gbcon57.seq
 250001394     gbcon58.seq
 250000648     gbcon59.seq
 250007297     gbcon6.seq
 250000917     gbcon60.seq
 250005218     gbcon61.seq
 250003315     gbcon62.seq
 250005275     gbcon63.seq
 250004100     gbcon64.seq
 250001532     gbcon65.seq
 250002533     gbcon66.seq
 250003589     gbcon67.seq
 250003215     gbcon68.seq
 250000608     gbcon69.seq
 250001359     gbcon7.seq
 250004484     gbcon70.seq
 250004909     gbcon71.seq
 250002779     gbcon72.seq
 250002004     gbcon73.seq
 250000445     gbcon74.seq
 250000285     gbcon75.seq
 250001671     gbcon76.seq
 250002888     gbcon77.seq
 250000131     gbcon78.seq
 250004723     gbcon79.seq
 250000873     gbcon8.seq
 250001310     gbcon80.seq
 250001054     gbcon81.seq
 250005646     gbcon82.seq
 250000060     gbcon83.seq
 250003905     gbcon84.seq
 250004259     gbcon85.seq
 250004187     gbcon86.seq
 250004116     gbcon87.seq
 250000333     gbcon88.seq
 250004294     gbcon89.seq
 250006299     gbcon9.seq
 250002412     gbcon90.seq
 250003497     gbcon91.seq
 250002501     gbcon92.seq
 250004085     gbcon93.seq
 250002161     gbcon94.seq
 250001678     gbcon95.seq
 199646369     gbcon96.seq
  21418186     gbcon97.seq
    106132     gbdel.txt
 250001215     gbenv1.seq
  44199440     gbenv10.seq
 250000277     gbenv2.seq
 250000388     gbenv3.seq
 250000742     gbenv4.seq
 250001188     gbenv5.seq
 250000163     gbenv6.seq
 250001460     gbenv7.seq
 250000505     gbenv8.seq
 250002323     gbenv9.seq
 230688615     gbest1.seq
 230687850     gbest10.seq
 230688869     gbest100.seq
 230688509     gbest101.seq
 230687761     gbest102.seq
 230690325     gbest103.seq
 230689487     gbest104.seq
 230688320     gbest105.seq
 230688226     gbest106.seq
 230689929     gbest107.seq
 230688837     gbest108.seq
 230688628     gbest109.seq
 230688467     gbest11.seq
 230688413     gbest110.seq
 230687453     gbest111.seq
 230689437     gbest112.seq
 230689758     gbest113.seq
 230691549     gbest114.seq
 230692103     gbest115.seq
 230688725     gbest116.seq
 230689527     gbest117.seq
 230687750     gbest118.seq
 230535338     gbest119.seq
 230689872     gbest12.seq
 230688657     gbest120.seq
 230689578     gbest121.seq
 230688691     gbest122.seq
 230689238     gbest123.seq
 230690215     gbest124.seq
 230689367     gbest125.seq
 230689909     gbest126.seq
 230687858     gbest127.seq
 230688620     gbest128.seq
 230688224     gbest129.seq
 230689821     gbest13.seq
 230689575     gbest130.seq
 230689241     gbest131.seq
 230689717     gbest132.seq
 230688836     gbest133.seq
 230689764     gbest134.seq
 230687650     gbest135.seq
 230689603     gbest136.seq
 230689684     gbest137.seq
 230688476     gbest138.seq
 230688035     gbest139.seq
 230690064     gbest14.seq
 230690794     gbest140.seq
 230687462     gbest141.seq
 230690334     gbest142.seq
 230687906     gbest143.seq
 230689493     gbest144.seq
 230688893     gbest145.seq
 230690268     gbest146.seq
 230690664     gbest147.seq
 230687629     gbest148.seq
 230688776     gbest149.seq
 230689448     gbest15.seq
 230687807     gbest150.seq
 230689702     gbest151.seq
 230687648     gbest152.seq
 230688409     gbest153.seq
 230690929     gbest154.seq
 230688809     gbest155.seq
 230689336     gbest156.seq
 230688462     gbest157.seq
 230688190     gbest158.seq
 230688555     gbest159.seq
 230688640     gbest16.seq
 230687967     gbest160.seq
 230689480     gbest161.seq
 230688463     gbest162.seq
 230687965     gbest163.seq
 230690896     gbest164.seq
 230690671     gbest165.seq
 230688433     gbest166.seq
 230690152     gbest167.seq
 230690624     gbest168.seq
 230687942     gbest169.seq
 230688616     gbest17.seq
 230690418     gbest170.seq
 230689977     gbest171.seq
 230689503     gbest172.seq
 230690337     gbest173.seq
 230688265     gbest174.seq
 230688525     gbest175.seq
 230687708     gbest176.seq
 230687851     gbest177.seq
 230689289     gbest178.seq
 230688666     gbest179.seq
 230689787     gbest18.seq
 218651035     gbest180.seq
 230688169     gbest181.seq
 230687890     gbest182.seq
 230688795     gbest183.seq
 230691288     gbest184.seq
 230688139     gbest185.seq
 230687514     gbest186.seq
 230689655     gbest187.seq
 230689490     gbest188.seq
 230690633     gbest189.seq
 230689707     gbest19.seq
 230687953     gbest190.seq
 230690099     gbest191.seq
 230691812     gbest192.seq
 230689203     gbest193.seq
 230690233     gbest194.seq
 230688390     gbest195.seq
 230688592     gbest196.seq
 230688809     gbest197.seq
 230689207     gbest198.seq
 230690600     gbest199.seq
 230689833     gbest2.seq
 230688635     gbest20.seq
 230690018     gbest200.seq
 230688047     gbest201.seq
 230689348     gbest202.seq
 230689334     gbest203.seq
 230690977     gbest204.seq
 230688704     gbest205.seq
 230690841     gbest206.seq
 230688940     gbest207.seq
 230689411     gbest208.seq
 230687519     gbest209.seq
 230688774     gbest21.seq
 230688247     gbest210.seq
 230688648     gbest211.seq
 230689026     gbest212.seq
 230689424     gbest213.seq
 230687525     gbest214.seq
 230688452     gbest215.seq
 230689119     gbest216.seq
 230687859     gbest217.seq
 230688276     gbest218.seq
 230689769     gbest219.seq
 230688401     gbest22.seq
 230688675     gbest220.seq
 230690959     gbest221.seq
 230689535     gbest222.seq
 230690450     gbest223.seq
 230689102     gbest224.seq
 230690206     gbest225.seq
 230688717     gbest226.seq
 230689986     gbest227.seq
 230689681     gbest228.seq
 230689546     gbest229.seq
 230689475     gbest23.seq
 183718735     gbest230.seq
 161530825     gbest231.seq
 162793143     gbest232.seq
 170073688     gbest233.seq
 169000543     gbest234.seq
 162335322     gbest235.seq
 164000064     gbest236.seq
 163571066     gbest237.seq
 162945086     gbest238.seq
 163491161     gbest239.seq
 230688532     gbest24.seq
 162977230     gbest240.seq
 163117190     gbest241.seq
 161800884     gbest242.seq
 167280080     gbest243.seq
 161254058     gbest244.seq
 162175175     gbest245.seq
 166648398     gbest246.seq
 166406146     gbest247.seq
 164737796     gbest248.seq
 164576554     gbest249.seq
 230688793     gbest25.seq
 164255308     gbest250.seq
 164026196     gbest251.seq
 163108634     gbest252.seq
 163113005     gbest253.seq
 164272402     gbest254.seq
 165521019     gbest255.seq
 179895945     gbest256.seq
 169985881     gbest257.seq
 198815132     gbest258.seq
 230689190     gbest259.seq
 230688426     gbest26.seq
 230687701     gbest260.seq
 230689434     gbest261.seq
 230690530     gbest262.seq
 230688336     gbest263.seq
 230689664     gbest264.seq
 230687539     gbest265.seq
 230688778     gbest266.seq
 230690712     gbest267.seq
 230691222     gbest268.seq
 230688861     gbest269.seq
 230688935     gbest27.seq
 230688160     gbest270.seq
 230689068     gbest271.seq
 230689136     gbest272.seq
 230689742     gbest273.seq
 230687443     gbest274.seq
 230691095     gbest275.seq
 230690305     gbest276.seq
 230688753     gbest277.seq
 230689065     gbest278.seq
 230690106     gbest279.seq
 230688309     gbest28.seq
 230689526     gbest280.seq
 230688955     gbest281.seq
 230688264     gbest282.seq
 230688896     gbest283.seq
 230690087     gbest284.seq
 230688792     gbest285.seq
 230690448     gbest286.seq
 230688889     gbest287.seq
 230689785     gbest288.seq
 230687814     gbest289.seq
 230689384     gbest29.seq
 207616669     gbest290.seq
 230687637     gbest291.seq
 230687768     gbest292.seq
 230689297     gbest293.seq
 230688593     gbest294.seq
 230689023     gbest295.seq
 230689008     gbest296.seq
 230689393     gbest297.seq
 230689036     gbest298.seq
 230687738     gbest299.seq
 230690315     gbest3.seq
 230687687     gbest30.seq
 230688109     gbest300.seq
 230688212     gbest301.seq
 230688143     gbest302.seq
 230689637     gbest303.seq
 230689608     gbest304.seq
 230689507     gbest305.seq
 230689388     gbest306.seq
 230688078     gbest307.seq
 230687579     gbest308.seq
 230689336     gbest309.seq
 230689869     gbest31.seq
 230689688     gbest310.seq
 230690447     gbest311.seq
 230689067     gbest312.seq
 230690579     gbest313.seq
 230687769     gbest314.seq
 230688080     gbest315.seq
 230690097     gbest316.seq
 230690367     gbest317.seq
 230689182     gbest318.seq
 230688934     gbest319.seq
 230688885     gbest32.seq
 230690668     gbest320.seq
 230689396     gbest321.seq
 230688198     gbest322.seq
 230688383     gbest323.seq
 230691193     gbest324.seq
 230689614     gbest325.seq
 230687514     gbest326.seq
 230690810     gbest327.seq
 230688354     gbest328.seq
 230687506     gbest329.seq
 230688605     gbest33.seq
 230688695     gbest330.seq
 230688383     gbest331.seq
 230689676     gbest332.seq
 230688996     gbest333.seq
 230688150     gbest334.seq
 230688751     gbest335.seq
 230688552     gbest336.seq
 230688758     gbest337.seq
 230688457     gbest338.seq
 230687951     gbest339.seq
 230690249     gbest34.seq
 230687545     gbest340.seq
 208998489     gbest341.seq
 230688800     gbest342.seq
 230692161     gbest343.seq
 230689213     gbest344.seq
 230689279     gbest345.seq
 230689275     gbest346.seq
 230691162     gbest347.seq
 156568781     gbest348.seq
 165315954     gbest349.seq
 230687458     gbest35.seq
 230687574     gbest350.seq
 230690465     gbest351.seq
 230689915     gbest352.seq
 230690406     gbest353.seq
 230688810     gbest354.seq
 230689957     gbest355.seq
 230689322     gbest356.seq
 230687463     gbest357.seq
 230687859     gbest358.seq
 230689562     gbest359.seq
 230687454     gbest36.seq
 230687633     gbest360.seq
 230689470     gbest361.seq
 230689957     gbest362.seq
 230688585     gbest363.seq
 230687890     gbest364.seq
 230689533     gbest365.seq
 230688045     gbest366.seq
 230687448     gbest367.seq
 230688070     gbest368.seq
 230688955     gbest369.seq
 230687654     gbest37.seq
 230687736     gbest370.seq
 230690308     gbest371.seq
 230688110     gbest372.seq
 230689458     gbest373.seq
 230690593     gbest374.seq
 230687537     gbest375.seq
 230689131     gbest376.seq
 230687529     gbest377.seq
 230689006     gbest378.seq
 230689166     gbest379.seq
 230689034     gbest38.seq
 230691003     gbest380.seq
 230691090     gbest381.seq
 230693882     gbest382.seq
 230690694     gbest383.seq
 230689154     gbest384.seq
 230689472     gbest385.seq
 230687924     gbest386.seq
 230688935     gbest387.seq
 230687506     gbest388.seq
 230689598     gbest389.seq
 230688681     gbest39.seq
 230689366     gbest390.seq
 230689467     gbest391.seq
 230688936     gbest392.seq
 230688189     gbest393.seq
 228301612     gbest394.seq
 230687549     gbest395.seq
 230689419     gbest396.seq
 230688873     gbest397.seq
 230688721     gbest398.seq
 230688474     gbest399.seq
 230688895     gbest4.seq
 230690234     gbest40.seq
 222422943     gbest400.seq
 230688487     gbest401.seq
 230691045     gbest402.seq
 230689229     gbest403.seq
 230687696     gbest404.seq
 230690905     gbest405.seq
 230687835     gbest406.seq
 228299276     gbest407.seq
 230688402     gbest408.seq
 230691659     gbest409.seq
 230690108     gbest41.seq
 230687554     gbest410.seq
 230689092     gbest411.seq
 230687533     gbest412.seq
 230689601     gbest413.seq
 230691219     gbest414.seq
 230691418     gbest415.seq
 230690430     gbest416.seq
 230689117     gbest417.seq
 230687500     gbest418.seq
 230690683     gbest419.seq
 230687562     gbest42.seq
 230688396     gbest420.seq
 230691417     gbest421.seq
 230690533     gbest422.seq
 230691040     gbest423.seq
 230688220     gbest424.seq
 214065042     gbest425.seq
 208306068     gbest426.seq
 208237617     gbest427.seq
 208397032     gbest428.seq
 208342578     gbest429.seq
 230688726     gbest43.seq
 208513158     gbest430.seq
 209045605     gbest431.seq
 209895962     gbest432.seq
 209570074     gbest433.seq
 209368489     gbest434.seq
 212316435     gbest435.seq
 209549732     gbest436.seq
 208688664     gbest437.seq
 208780164     gbest438.seq
 208891878     gbest439.seq
 230689843     gbest44.seq
 208236395     gbest440.seq
 208248664     gbest441.seq
 208281343     gbest442.seq
 208155482     gbest443.seq
 215561097     gbest444.seq
 230687788     gbest445.seq
 230688725     gbest446.seq
 230688530     gbest447.seq
 230687968     gbest448.seq
 230688425     gbest449.seq
 230689355     gbest45.seq
 230689025     gbest450.seq
 230687882     gbest451.seq
 230687976     gbest452.seq
 230688862     gbest453.seq
 230687748     gbest454.seq
 230689859     gbest455.seq
 230687468     gbest456.seq
 230689019     gbest457.seq
 230689151     gbest458.seq
 230688020     gbest459.seq
 226803956     gbest46.seq
 230688229     gbest460.seq
 230688802     gbest461.seq
 230687778     gbest462.seq
 230689089     gbest463.seq
 230691538     gbest464.seq
 230687456     gbest465.seq
 230687525     gbest466.seq
 230689700     gbest467.seq
 230687998     gbest468.seq
 230689340     gbest469.seq
 189302383     gbest47.seq
 230688240     gbest470.seq
 230689586     gbest471.seq
 230689016     gbest472.seq
 230689022     gbest473.seq
 230687901     gbest474.seq
 230688493     gbest475.seq
 230687914     gbest476.seq
 230690386     gbest477.seq
 230688798     gbest478.seq
 230690678     gbest479.seq
 188238364     gbest48.seq
 230687697     gbest480.seq
 230688950     gbest481.seq
 230688559     gbest482.seq
 230690011     gbest483.seq
 230688400     gbest484.seq
 230688040     gbest485.seq
 230689284     gbest486.seq
 230688834     gbest487.seq
 230687513     gbest488.seq
 230691849     gbest489.seq
 212041800     gbest49.seq
 230690841     gbest490.seq
 230691066     gbest491.seq
 230690243     gbest492.seq
 230691422     gbest493.seq
 230688655     gbest494.seq
 230689293     gbest495.seq
 230688562     gbest496.seq
 230687938     gbest497.seq
 230688817     gbest498.seq
 230688923     gbest499.seq
 164142208     gbest5.seq
 214975578     gbest50.seq
 230688175     gbest500.seq
 230688178     gbest501.seq
 230687680     gbest502.seq
 230689042     gbest503.seq
 230689459     gbest504.seq
 230688564     gbest505.seq
 230689677     gbest506.seq
 230690670     gbest507.seq
 230688320     gbest508.seq
 230690415     gbest509.seq
 214660799     gbest51.seq
 230691583     gbest510.seq
 230688194     gbest511.seq
 230689338     gbest512.seq
 230690137     gbest513.seq
 230689310     gbest514.seq
 230690567     gbest515.seq
 230689284     gbest516.seq
 230688491     gbest517.seq
 230689156     gbest518.seq
 230688149     gbest519.seq
 215733408     gbest52.seq
 224236411     gbest520.seq
 227952054     gbest521.seq
 230690283     gbest522.seq
 230688088     gbest523.seq
 230689817     gbest524.seq
 230689731     gbest525.seq
 230688005     gbest526.seq
 230688608     gbest527.seq
 230689425     gbest528.seq
 230691097     gbest529.seq
 230689823     gbest53.seq
 230691695     gbest530.seq
 230689827     gbest531.seq
 230687571     gbest532.seq
 230688892     gbest533.seq
 230687792     gbest534.seq
 212025904     gbest535.seq
 196105118     gbest536.seq
 230689321     gbest537.seq
 230688641     gbest538.seq
 230689700     gbest539.seq
 230688066     gbest54.seq
 230687474     gbest540.seq
 230689952     gbest541.seq
 230688853     gbest542.seq
 230688272     gbest543.seq
 230689294     gbest544.seq
 230690270     gbest545.seq
 230688576     gbest546.seq
 230689319     gbest547.seq
 230688387     gbest548.seq
 230689007     gbest549.seq
 230689630     gbest55.seq
 222117881     gbest550.seq
 230689873     gbest551.seq
 230689243     gbest552.seq
 230690126     gbest553.seq
 230688910     gbest554.seq
 230690115     gbest555.seq
 230688247     gbest556.seq
 230689055     gbest557.seq
 220004338     gbest558.seq
 224245840     gbest559.seq
 220092159     gbest56.seq
 230688771     gbest560.seq
 230690730     gbest561.seq
 230688316     gbest562.seq
 230688110     gbest563.seq
 230688118     gbest564.seq
 230689034     gbest565.seq
 230687707     gbest566.seq
 230688899     gbest567.seq
 230689510     gbest568.seq
 230689512     gbest569.seq
 230688198     gbest57.seq
 230688023     gbest570.seq
 230687780     gbest571.seq
 230687920     gbest572.seq
 230687801     gbest573.seq
 230689618     gbest574.seq
 230688881     gbest575.seq
 230688340     gbest576.seq
 230689814     gbest577.seq
 230688016     gbest578.seq
 230687554     gbest579.seq
 230688706     gbest58.seq
 230688303     gbest580.seq
 230690810     gbest581.seq
 230688785     gbest582.seq
 230689095     gbest583.seq
 230687661     gbest584.seq
 230689682     gbest585.seq
 230690069     gbest586.seq
 230690315     gbest587.seq
 230690927     gbest588.seq
 230687458     gbest589.seq
 230687941     gbest59.seq
 230688322     gbest590.seq
 230688935     gbest591.seq
 230689045     gbest592.seq
 230689064     gbest593.seq
 230689570     gbest594.seq
 230687722     gbest595.seq
 230693393     gbest596.seq
 230688686     gbest597.seq
 230690589     gbest598.seq
 230688783     gbest599.seq
 177420861     gbest6.seq
 230689505     gbest60.seq
 230690960     gbest600.seq
 230690546     gbest601.seq
 230689977     gbest602.seq
 230688658     gbest603.seq
 230687641     gbest604.seq
 230688591     gbest605.seq
 230688731     gbest606.seq
 230687568     gbest607.seq
 230688047     gbest608.seq
 230690413     gbest609.seq
 230687824     gbest61.seq
 230690038     gbest610.seq
 230689737     gbest611.seq
 230687465     gbest612.seq
 230690972     gbest613.seq
 230687716     gbest614.seq
 230687804     gbest615.seq
 230689288     gbest616.seq
 230688418     gbest617.seq
 230687713     gbest618.seq
 230689120     gbest619.seq
 230689172     gbest62.seq
 230690740     gbest620.seq
 230690879     gbest621.seq
 230690297     gbest622.seq
 230690598     gbest623.seq
 230691534     gbest624.seq
 230688889     gbest625.seq
 230690084     gbest626.seq
 230689581     gbest627.seq
 230687869     gbest628.seq
 230690501     gbest629.seq
 230690963     gbest63.seq
 230687590     gbest630.seq
 230688700     gbest631.seq
 230689618     gbest632.seq
 230230315     gbest633.seq
 230688247     gbest634.seq
 230687454     gbest635.seq
 226583032     gbest636.seq
 217269971     gbest637.seq
 230690198     gbest638.seq
 226893280     gbest639.seq
 230688690     gbest64.seq
 190655583     gbest640.seq
 190464797     gbest641.seq
 193213289     gbest642.seq
 192383239     gbest643.seq
 191540204     gbest644.seq
 191868778     gbest645.seq
 193110854     gbest646.seq
 191955986     gbest647.seq
 191041163     gbest648.seq
 191604560     gbest649.seq
 230688603     gbest65.seq
 230690303     gbest650.seq
 230689551     gbest651.seq
 230687788     gbest652.seq
 230688009     gbest653.seq
 230688581     gbest654.seq
 230688847     gbest655.seq
 230687454     gbest656.seq
 172219918     gbest657.seq
 192589291     gbest658.seq
 230691133     gbest659.seq
 230691420     gbest66.seq
 230691665     gbest660.seq
 230689036     gbest661.seq
 230690328     gbest662.seq
 230687553     gbest663.seq
 230688494     gbest664.seq
 230688528     gbest665.seq
 230688942     gbest666.seq
 230689395     gbest667.seq
 230687446     gbest668.seq
 230688994     gbest669.seq
 230687893     gbest67.seq
 230690488     gbest670.seq
 230688913     gbest671.seq
 230689113     gbest672.seq
 230689491     gbest673.seq
 230689984     gbest674.seq
 230687711     gbest675.seq
 230688683     gbest676.seq
 230689458     gbest677.seq
 230690308     gbest678.seq
 230688757     gbest679.seq
 230687898     gbest68.seq
 230687584     gbest680.seq
 230687572     gbest681.seq
 230688795     gbest682.seq
 230687757     gbest683.seq
 230690347     gbest684.seq
 230690350     gbest685.seq
 230688086     gbest686.seq
 230690643     gbest687.seq
 230687725     gbest688.seq
 230689097     gbest689.seq
 230690225     gbest69.seq
 230690927     gbest690.seq
 230688275     gbest691.seq
 230688726     gbest692.seq
 230690317     gbest693.seq
 230688943     gbest694.seq
 230690295     gbest695.seq
 230688461     gbest696.seq
 230689943     gbest697.seq
 230689217     gbest698.seq
 230689890     gbest699.seq
 230687843     gbest7.seq
 230689631     gbest70.seq
 230689216     gbest700.seq
 230690693     gbest701.seq
 230687618     gbest702.seq
 230688818     gbest703.seq
 230688097     gbest704.seq
 230689545     gbest705.seq
 230689331     gbest706.seq
 230691620     gbest707.seq
 230689362     gbest708.seq
 230690006     gbest709.seq
 230689727     gbest71.seq
 230688698     gbest710.seq
 230691604     gbest711.seq
 230689801     gbest712.seq
 230687902     gbest713.seq
 230689342     gbest714.seq
 230689412     gbest715.seq
 230690149     gbest716.seq
 230690014     gbest717.seq
 230689098     gbest718.seq
 205049461     gbest719.seq
 230690630     gbest72.seq
 230233471     gbest720.seq
 230687723     gbest721.seq
 230688759     gbest722.seq
 230688021     gbest723.seq
 230689377     gbest724.seq
 230688895     gbest725.seq
 230689961     gbest726.seq
 230689591     gbest727.seq
 230689648     gbest728.seq
 230688902     gbest729.seq
 208414042     gbest73.seq
 230690635     gbest730.seq
 230689520     gbest731.seq
 230687844     gbest732.seq
 230688053     gbest733.seq
 230687652     gbest734.seq
 230687629     gbest735.seq
 230688792     gbest736.seq
 230690498     gbest737.seq
 230689655     gbest738.seq
 230688624     gbest739.seq
 208099030     gbest74.seq
 230693198     gbest740.seq
 230691169     gbest741.seq
 230694127     gbest742.seq
 230687529     gbest743.seq
 230688244     gbest744.seq
 230689452     gbest745.seq
 230688569     gbest746.seq
 230690559     gbest747.seq
 230689279     gbest748.seq
 230688917     gbest749.seq
 207479563     gbest75.seq
 230690686     gbest750.seq
 230690092     gbest751.seq
 230688613     gbest752.seq
 230687479     gbest753.seq
 230689969     gbest754.seq
 230689152     gbest755.seq
 230688993     gbest756.seq
 230690056     gbest757.seq
 230688086     gbest758.seq
 230690175     gbest759.seq
 207707529     gbest76.seq
 220212189     gbest760.seq
 230690825     gbest761.seq
 207117404     gbest762.seq
 209064869     gbest77.seq
 208612058     gbest78.seq
 207447123     gbest79.seq
 230688355     gbest8.seq
 207995601     gbest80.seq
 209387840     gbest81.seq
 205233207     gbest82.seq
 205412032     gbest83.seq
 206891831     gbest84.seq
 207289349     gbest85.seq
 214665212     gbest86.seq
 230688022     gbest87.seq
 230688092     gbest88.seq
 228953855     gbest89.seq
 230689573     gbest9.seq
 214117242     gbest90.seq
 213019393     gbest91.seq
 218697307     gbest92.seq
 230690002     gbest93.seq
 230688550     gbest94.seq
 230687524     gbest95.seq
 230689734     gbest96.seq
 230688281     gbest97.seq
 230690005     gbest98.seq
 230689916     gbest99.seq
  90319124     gbgen.idx
 230688999     gbgss1.seq
 230690079     gbgss10.seq
 230689050     gbgss100.seq
 227721222     gbgss101.seq
 228841700     gbgss102.seq
 228555080     gbgss103.seq
 228589280     gbgss104.seq
 227709541     gbgss105.seq
 230687905     gbgss106.seq
 230689673     gbgss107.seq
 230688375     gbgss108.seq
 230688720     gbgss109.seq
 230689764     gbgss11.seq
 230689380     gbgss110.seq
 230687472     gbgss111.seq
 230689449     gbgss112.seq
 230688452     gbgss113.seq
 230688492     gbgss114.seq
 230689280     gbgss115.seq
 230687746     gbgss116.seq
 230690108     gbgss117.seq
 230689688     gbgss118.seq
 230688196     gbgss119.seq
 230687679     gbgss12.seq
 230688153     gbgss120.seq
 230688409     gbgss121.seq
 230688419     gbgss122.seq
 230687706     gbgss123.seq
 230690388     gbgss124.seq
 230688886     gbgss125.seq
 230688651     gbgss126.seq
 230688733     gbgss127.seq
 230688982     gbgss128.seq
 230687639     gbgss129.seq
 230690347     gbgss13.seq
 230689760     gbgss130.seq
 230687534     gbgss131.seq
 230688957     gbgss132.seq
 230687960     gbgss133.seq
 230688758     gbgss134.seq
 230689807     gbgss135.seq
 230689241     gbgss136.seq
 230690256     gbgss137.seq
 230688873     gbgss138.seq
 230688252     gbgss139.seq
 230689893     gbgss14.seq
 230687963     gbgss140.seq
 230689869     gbgss141.seq
 230689101     gbgss142.seq
 230688539     gbgss143.seq
 230689376     gbgss144.seq
 224492863     gbgss145.seq
 230688138     gbgss146.seq
 230688663     gbgss147.seq
 198416753     gbgss148.seq
 230688611     gbgss149.seq
 230689648     gbgss15.seq
 230689771     gbgss150.seq
 230687903     gbgss151.seq
 230689361     gbgss152.seq
 230690090     gbgss153.seq
 230689742     gbgss154.seq
 230688366     gbgss155.seq
 230688215     gbgss156.seq
 230688295     gbgss157.seq
 230688094     gbgss158.seq
 230688109     gbgss159.seq
 230689778     gbgss16.seq
 230687651     gbgss160.seq
 230690072     gbgss161.seq
 230688469     gbgss162.seq
 230690490     gbgss163.seq
 230687819     gbgss164.seq
 230687619     gbgss165.seq
 230688502     gbgss166.seq
 230688122     gbgss167.seq
 230688380     gbgss168.seq
 230689184     gbgss169.seq
 230688655     gbgss17.seq
 230652980     gbgss170.seq
 230688943     gbgss171.seq
 230692349     gbgss172.seq
 230689145     gbgss173.seq
 214062351     gbgss174.seq
 207654151     gbgss175.seq
 210072912     gbgss176.seq
 210674578     gbgss177.seq
 209665565     gbgss178.seq
 209396091     gbgss179.seq
 230688580     gbgss18.seq
 207488307     gbgss180.seq
 207258509     gbgss181.seq
 207742947     gbgss182.seq
 209325720     gbgss183.seq
 209295926     gbgss184.seq
 208571354     gbgss185.seq
 205838016     gbgss186.seq
 205585204     gbgss187.seq
 205282901     gbgss188.seq
 205441891     gbgss189.seq
 230688247     gbgss19.seq
 205290251     gbgss190.seq
 206109754     gbgss191.seq
 207526871     gbgss192.seq
 208603823     gbgss193.seq
 207866277     gbgss194.seq
 207973328     gbgss195.seq
 208760685     gbgss196.seq
 208865693     gbgss197.seq
 208877076     gbgss198.seq
 205750924     gbgss199.seq
 230688628     gbgss2.seq
 230689216     gbgss20.seq
 206163101     gbgss200.seq
 206444174     gbgss201.seq
 205503672     gbgss202.seq
 206051073     gbgss203.seq
 207299104     gbgss204.seq
 207139897     gbgss205.seq
 207107032     gbgss206.seq
 207232896     gbgss207.seq
 207054507     gbgss208.seq
 207148365     gbgss209.seq
 230687583     gbgss21.seq
 206854570     gbgss210.seq
 206972921     gbgss211.seq
 206664734     gbgss212.seq
 207898107     gbgss213.seq
 207892769     gbgss214.seq
 209451332     gbgss215.seq
 210070285     gbgss216.seq
 209270081     gbgss217.seq
 210252752     gbgss218.seq
 218277243     gbgss219.seq
 230690343     gbgss22.seq
 218860455     gbgss220.seq
 230688503     gbgss221.seq
 230687448     gbgss222.seq
 230690120     gbgss223.seq
 230688011     gbgss224.seq
 230688497     gbgss225.seq
 230687474     gbgss226.seq
 217916744     gbgss227.seq
 217930084     gbgss228.seq
 230688583     gbgss229.seq
 230689056     gbgss23.seq
 230688989     gbgss230.seq
 230688755     gbgss231.seq
 230688629     gbgss232.seq
 230689541     gbgss233.seq
 230687718     gbgss234.seq
 230689969     gbgss235.seq
 230687537     gbgss236.seq
 230687497     gbgss237.seq
 230688628     gbgss238.seq
 230687957     gbgss239.seq
 230687549     gbgss24.seq
 230688504     gbgss240.seq
 230689891     gbgss241.seq
 230689321     gbgss242.seq
 230689015     gbgss243.seq
 230687572     gbgss244.seq
 230688997     gbgss245.seq
 230687992     gbgss246.seq
 143552529     gbgss247.seq
 250000654     gbgss248.seq
 250001101     gbgss249.seq
 230689248     gbgss25.seq
 250001260     gbgss250.seq
 250000873     gbgss251.seq
 250001373     gbgss252.seq
 250002756     gbgss253.seq
 250001341     gbgss254.seq
 250000021     gbgss255.seq
 250002458     gbgss256.seq
 250001722     gbgss257.seq
 250001048     gbgss258.seq
 250000337     gbgss259.seq
 230689875     gbgss26.seq
 250002275     gbgss260.seq
 250000607     gbgss261.seq
 250001919     gbgss262.seq
 250001148     gbgss263.seq
 250002310     gbgss264.seq
 250001208     gbgss265.seq
 250003287     gbgss266.seq
 250002153     gbgss267.seq
 250001627     gbgss268.seq
 250000972     gbgss269.seq
 230689928     gbgss27.seq
 250000768     gbgss270.seq
 250001256     gbgss271.seq
 250001663     gbgss272.seq
 250002105     gbgss273.seq
 250001640     gbgss274.seq
 250001752     gbgss275.seq
 250002011     gbgss276.seq
 250000930     gbgss277.seq
 250000329     gbgss278.seq
 250000039     gbgss279.seq
 230687453     gbgss28.seq
 250000843     gbgss280.seq
 250000066     gbgss281.seq
 250000769     gbgss282.seq
 250002225     gbgss283.seq
 250000183     gbgss284.seq
 250000617     gbgss285.seq
 250000399     gbgss286.seq
 250000369     gbgss287.seq
 250001012     gbgss288.seq
 250000635     gbgss289.seq
 230688970     gbgss29.seq
 250000768     gbgss290.seq
 250000371     gbgss291.seq
 250000570     gbgss292.seq
 250000910     gbgss293.seq
 250001765     gbgss294.seq
 250000350     gbgss295.seq
 250000703     gbgss296.seq
 250002632     gbgss297.seq
 250001386     gbgss298.seq
 250000231     gbgss299.seq
 230689286     gbgss3.seq
 230689804     gbgss30.seq
 250001359     gbgss300.seq
 250000885     gbgss301.seq
 250000502     gbgss302.seq
 250000273     gbgss303.seq
 250002912     gbgss304.seq
 250002625     gbgss305.seq
  78965989     gbgss306.seq
 230690386     gbgss31.seq
 230688120     gbgss32.seq
 230689077     gbgss33.seq
 230687452     gbgss34.seq
 230687659     gbgss35.seq
 230689742     gbgss36.seq
 230687950     gbgss37.seq
 230687910     gbgss38.seq
 230688690     gbgss39.seq
 230688064     gbgss4.seq
 230688763     gbgss40.seq
 230688108     gbgss41.seq
 230689834     gbgss42.seq
 230688239     gbgss43.seq
 230689976     gbgss44.seq
 230690129     gbgss45.seq
 230690373     gbgss46.seq
 230687984     gbgss47.seq
 230688577     gbgss48.seq
 230689402     gbgss49.seq
 230688342     gbgss5.seq
 230687899     gbgss50.seq
 230688301     gbgss51.seq
 230688675     gbgss52.seq
 230690514     gbgss53.seq
 230689734     gbgss54.seq
 230689855     gbgss55.seq
 230687670     gbgss56.seq
 230689635     gbgss57.seq
 230687843     gbgss58.seq
 230689656     gbgss59.seq
 230689182     gbgss6.seq
 230688852     gbgss60.seq
 229013602     gbgss61.seq
 230689901     gbgss62.seq
 230689630     gbgss63.seq
 230688268     gbgss64.seq
 230689994     gbgss65.seq
 230688671     gbgss66.seq
 230689287     gbgss67.seq
 230689792     gbgss68.seq
 230689440     gbgss69.seq
 230687458     gbgss7.seq
 230689415     gbgss70.seq
 230688319     gbgss71.seq
 230687852     gbgss72.seq
 230689709     gbgss73.seq
 230689262     gbgss74.seq
 230687590     gbgss75.seq
 230688251     gbgss76.seq
 230689034     gbgss77.seq
 230688794     gbgss78.seq
 230687678     gbgss79.seq
 230690430     gbgss8.seq
 230688851     gbgss80.seq
 225373654     gbgss81.seq
 194177396     gbgss82.seq
 194314068     gbgss83.seq
 230687821     gbgss84.seq
 230687666     gbgss85.seq
 230687504     gbgss86.seq
 230688352     gbgss87.seq
 230689471     gbgss88.seq
 230688089     gbgss89.seq
 230689298     gbgss9.seq
 230688277     gbgss90.seq
 230688150     gbgss91.seq
 230688202     gbgss92.seq
 230688460     gbgss93.seq
 230687466     gbgss94.seq
 230689879     gbgss95.seq
 230690080     gbgss96.seq
 230688997     gbgss97.seq
 230688431     gbgss98.seq
 230689413     gbgss99.seq
 250005013     gbhtc1.seq
 250000382     gbhtc10.seq
 250001536     gbhtc11.seq
 250003577     gbhtc12.seq
  32005889     gbhtc13.seq
 250016614     gbhtc2.seq
 250005704     gbhtc3.seq
 250002242     gbhtc4.seq
 250012415     gbhtc5.seq
 250007005     gbhtc6.seq
 250002604     gbhtc7.seq
 250003016     gbhtc8.seq
 250001746     gbhtc9.seq
 250095791     gbhtg1.seq
 250059678     gbhtg10.seq
 250130499     gbhtg100.seq
 250105228     gbhtg101.seq
 250143865     gbhtg102.seq
 250249693     gbhtg103.seq
 250177163     gbhtg104.seq
 250089445     gbhtg105.seq
 250159944     gbhtg106.seq
 250832270     gbhtg107.seq
 250002476     gbhtg108.seq
 250246262     gbhtg109.seq
 250041996     gbhtg11.seq
 250128050     gbhtg110.seq
 250152887     gbhtg111.seq
 250146952     gbhtg112.seq
 250025721     gbhtg113.seq
 250014103     gbhtg114.seq
 250146606     gbhtg115.seq
 250066810     gbhtg116.seq
 250016279     gbhtg117.seq
 250162741     gbhtg118.seq
 250159008     gbhtg119.seq
 250314169     gbhtg12.seq
  49574247     gbhtg120.seq
 250259212     gbhtg13.seq
 250032870     gbhtg14.seq
 250130174     gbhtg15.seq
 250073392     gbhtg16.seq
 250176119     gbhtg17.seq
 250090632     gbhtg18.seq
 250144332     gbhtg19.seq
 250020826     gbhtg2.seq
 250179509     gbhtg20.seq
 250079453     gbhtg21.seq
 250030789     gbhtg22.seq
 250231672     gbhtg23.seq
 250255351     gbhtg24.seq
 250093456     gbhtg25.seq
 250291231     gbhtg26.seq
 250254656     gbhtg27.seq
 250248428     gbhtg28.seq
 250048864     gbhtg29.seq
 250039055     gbhtg3.seq
 250013141     gbhtg30.seq
 250161065     gbhtg31.seq
 250189327     gbhtg32.seq
 250060740     gbhtg33.seq
 250096739     gbhtg34.seq
 250083825     gbhtg35.seq
 250180043     gbhtg36.seq
 250174307     gbhtg37.seq
 250040490     gbhtg38.seq
 250252095     gbhtg39.seq
 250101900     gbhtg4.seq
 250056626     gbhtg40.seq
 250000322     gbhtg41.seq
 250114720     gbhtg42.seq
 250368305     gbhtg43.seq
 250027341     gbhtg44.seq
 250140717     gbhtg45.seq
 250163862     gbhtg46.seq
 250071075     gbhtg47.seq
 250260503     gbhtg48.seq
 250043222     gbhtg49.seq
 250209197     gbhtg5.seq
 250471875     gbhtg50.seq
 250063130     gbhtg51.seq
 250144643     gbhtg52.seq
 250160676     gbhtg53.seq
 250265864     gbhtg54.seq
 250222720     gbhtg55.seq
 250135863     gbhtg56.seq
 250095864     gbhtg57.seq
 250220973     gbhtg58.seq
 250167645     gbhtg59.seq
 250053316     gbhtg6.seq
 250135184     gbhtg60.seq
 250275134     gbhtg61.seq
 250231778     gbhtg62.seq
 250299796     gbhtg63.seq
 250027084     gbhtg64.seq
 250210290     gbhtg65.seq
 250017381     gbhtg66.seq
 250095267     gbhtg67.seq
 250028396     gbhtg68.seq
 250142774     gbhtg69.seq
 250004175     gbhtg7.seq
 250067231     gbhtg70.seq
 250004282     gbhtg71.seq
 250198947     gbhtg72.seq
 250006729     gbhtg73.seq
 250198444     gbhtg74.seq
 250061475     gbhtg75.seq
 250147666     gbhtg76.seq
 250174732     gbhtg77.seq
 250118043     gbhtg78.seq
 250153181     gbhtg79.seq
 250124023     gbhtg8.seq
 250042986     gbhtg80.seq
 250021913     gbhtg81.seq
 250016800     gbhtg82.seq
 250088435     gbhtg83.seq
 250001165     gbhtg84.seq
 250213146     gbhtg85.seq
 250133193     gbhtg86.seq
 250101318     gbhtg87.seq
 250124391     gbhtg88.seq
 250114104     gbhtg89.seq
 250009870     gbhtg9.seq
 250065812     gbhtg90.seq
 250101084     gbhtg91.seq
 250097346     gbhtg92.seq
 250025925     gbhtg93.seq
 250102824     gbhtg94.seq
 250160601     gbhtg95.seq
 250154101     gbhtg96.seq
 250218820     gbhtg97.seq
 250329104     gbhtg98.seq
 250212619     gbhtg99.seq
 250067565     gbinv1.seq
 250001024     gbinv10.seq
 250000353     gbinv11.seq
 250049946     gbinv12.seq
  70670645     gbinv13.seq
 250223415     gbinv2.seq
 267725207     gbinv3.seq
 250002066     gbinv4.seq
 250332081     gbinv5.seq
 250001749     gbinv6.seq
 250000319     gbinv7.seq
 250003537     gbinv8.seq
 250005069     gbinv9.seq
 150689630     gbjou1.idx
 140047109     gbjou2.idx
 213026822     gbjou3.idx
 280868203     gbjou4.idx
 242814073     gbjou5.idx
 187635345     gbkey1.idx
 232477748     gbkey2.idx
  61417896     gbkey3.idx
 250297016     gbmam1.seq
 250003106     gbmam2.seq
 250003429     gbmam3.seq
 156833436     gbmam4.seq
  67836334     gbnew.txt
 250000525     gbpat1.seq
 250001796     gbpat10.seq
 250000526     gbpat11.seq
 250001764     gbpat12.seq
 250000646     gbpat13.seq
 250000830     gbpat14.seq
 250000190     gbpat15.seq
 250001035     gbpat16.seq
 250002101     gbpat17.seq
 250000538     gbpat18.seq
 250006144     gbpat19.seq
 250000203     gbpat2.seq
 250003359     gbpat20.seq
 250001189     gbpat21.seq
 250170197     gbpat22.seq
 250000294     gbpat23.seq
 250000637     gbpat24.seq
 250007671     gbpat25.seq
 250054772     gbpat26.seq
 250007420     gbpat27.seq
 250001564     gbpat28.seq
 250014310     gbpat29.seq
 250003352     gbpat3.seq
 250002140     gbpat30.seq
 250001880     gbpat31.seq
 250000890     gbpat32.seq
 250003338     gbpat33.seq
 250001888     gbpat34.seq
 250000571     gbpat35.seq
 250000574     gbpat36.seq
 250000036     gbpat37.seq
 250001412     gbpat38.seq
 250000583     gbpat39.seq
 250002405     gbpat4.seq
 250026151     gbpat40.seq
 250002314     gbpat41.seq
 250000211     gbpat42.seq
 250000668     gbpat43.seq
 250000070     gbpat44.seq
 250000187     gbpat45.seq
 132135294     gbpat46.seq
 250000083     gbpat5.seq
 250000375     gbpat6.seq
 250000761     gbpat7.seq
 250001452     gbpat8.seq
 250000831     gbpat9.seq
  73549162     gbphg.seq
 250044478     gbpln1.seq
 250003160     gbpln10.seq
 250000628     gbpln11.seq
 250011645     gbpln12.seq
 250008497     gbpln13.seq
 250005945     gbpln14.seq
 250089800     gbpln15.seq
 250099728     gbpln16.seq
 278221632     gbpln17.seq
 286798700     gbpln18.seq
 250000480     gbpln19.seq
 250169518     gbpln2.seq
 250001973     gbpln20.seq
 250001427     gbpln21.seq
 250174954     gbpln22.seq
 250068700     gbpln23.seq
 250001593     gbpln24.seq
 250003157     gbpln25.seq
 250001582     gbpln26.seq
 250001804     gbpln27.seq
 250002558     gbpln28.seq
 250000999     gbpln29.seq
 250032130     gbpln3.seq
 139686006     gbpln30.seq
 250037730     gbpln4.seq
 250001778     gbpln5.seq
 250000201     gbpln6.seq
 250003192     gbpln7.seq
 250004718     gbpln8.seq
 250185339     gbpln9.seq
 250053823     gbpri1.seq
 250153529     gbpri10.seq
 250204132     gbpri11.seq
 250124311     gbpri12.seq
 250165432     gbpri13.seq
 250193291     gbpri14.seq
 250141141     gbpri15.seq
 250027907     gbpri16.seq
 250030960     gbpri17.seq
 250023701     gbpri18.seq
 250025027     gbpri19.seq
 250087224     gbpri2.seq
 250000628     gbpri20.seq
 250002237     gbpri21.seq
 250073572     gbpri22.seq
 250020483     gbpri23.seq
 250009271     gbpri24.seq
 250137602     gbpri25.seq
 250017238     gbpri26.seq
 250146601     gbpri27.seq
 250100275     gbpri28.seq
 250003066     gbpri29.seq
 250110152     gbpri3.seq
 250788979     gbpri30.seq
 250003773     gbpri31.seq
 250076822     gbpri32.seq
 250015399     gbpri33.seq
 250001807     gbpri34.seq
 250004658     gbpri35.seq
 133087500     gbpri36.seq
 250208358     gbpri4.seq
 250066954     gbpri5.seq
 250189590     gbpri6.seq
 250063397     gbpri7.seq
 250177822     gbpri8.seq
 250047329     gbpri9.seq
    310430     gbrel.txt
 250121667     gbrod1.seq
 250121809     gbrod10.seq
 250236281     gbrod11.seq
 250137349     gbrod12.seq
 250186625     gbrod13.seq
 250165128     gbrod14.seq
 250048041     gbrod15.seq
 250006975     gbrod16.seq
 250001668     gbrod17.seq
 250244445     gbrod18.seq
 250056862     gbrod19.seq
 250080031     gbrod2.seq
 250153665     gbrod20.seq
 250003864     gbrod21.seq
 250003179     gbrod22.seq
 250055618     gbrod23.seq
 250004423     gbrod24.seq
 250002580     gbrod25.seq
 157670167     gbrod26.seq
 250216775     gbrod3.seq
 250056786     gbrod4.seq
 250175829     gbrod5.seq
 250248916     gbrod6.seq
 250180937     gbrod7.seq
 250294283     gbrod8.seq
 250257448     gbrod9.seq
1471370008     gbsdr1.txt
4384333925     gbsdr2.txt
1952366013     gbsdr3.txt
 112371147     gbsec.idx
 250002076     gbsts1.seq
 250002348     gbsts10.seq
 250000920     gbsts11.seq
 250001457     gbsts12.seq
 250000591     gbsts13.seq
 231158671     gbsts14.seq
 250002003     gbsts2.seq
 250002126     gbsts3.seq
 250002391     gbsts4.seq
 250004547     gbsts5.seq
 250003583     gbsts6.seq
 250002768     gbsts7.seq
 250001976     gbsts8.seq
 250001447     gbsts9.seq
 250001810     gbsyn1.seq
 146786116     gbsyn2.seq
   8986229     gbtsa.seq
    430744     gbuna.seq
 250001642     gbvrl1.seq
   6159148     gbvrl10.seq
 250001533     gbvrl2.seq
 250000722     gbvrl3.seq
 250000493     gbvrl4.seq
 250001087     gbvrl5.seq
 250000189     gbvrl6.seq
 250002004     gbvrl7.seq
 250003102     gbvrl8.seq
 250014446     gbvrl9.seq
 250044460     gbvrt1.seq
 250124976     gbvrt10.seq
 250085952     gbvrt11.seq
 250077840     gbvrt12.seq
 250009391     gbvrt13.seq
 250002586     gbvrt14.seq
 250002598     gbvrt15.seq
  98596272     gbvrt16.seq
 250001320     gbvrt2.seq
 250147936     gbvrt3.seq
 250000741     gbvrt4.seq
 250001048     gbvrt5.seq
 250070327     gbvrt6.seq
 250203695     gbvrt7.seq
 250080727     gbvrt8.seq
 250087145     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         37309      102202315
BCT10        31941      103596214
BCT11        166        100210237
BCT12        101        106940925
BCT13        51         115048466
BCT14        54         115216029
BCT15        53         119178838
BCT16        63         114548520
BCT17        59         120777572
BCT18        41         110858034
BCT19        62         110498750
BCT2         3423       110264120
BCT20        64         112952229
BCT21        59         112144177
BCT22        67         113357173
BCT23        54         113009258
BCT24        49         113300966
BCT25        67         113140226
BCT26        60         110560818
BCT27        246        106142957
BCT28        68370      83141659
BCT29        77861      80290906
BCT3         159        115987743
BCT30        40003      86856545
BCT4         22460      103645651
BCT5         54644      86858514
BCT6         5648       95799862
BCT7         13884      100301224
BCT8         5428       115324894
BCT9         37818      98259046
ENV1         91347      71558909
ENV10        16222      13591517
ENV2         95195      69410122
ENV3         83383      81981634
ENV4         89875      86428819
ENV5         111284     55172778
ENV6         125901     36784034
ENV7         88280      75463234
ENV8         86407      83538644
ENV9         80046      94359851
EST1         68125      26289403
EST10        76524      29834002
EST100       78174      37899214
EST101       69414      40499853
EST102       74665      35691276
EST103       74688      38041908
EST104       69844      36705685
EST105       77096      49452331
EST106       67724      35995319
EST107       71456      36147190
EST108       72674      37401794
EST109       72953      44490780
EST11        75175      28789926
EST110       66677      44008528
EST111       75063      44988026
EST112       70436      28425189
EST113       70706      31559583
EST114       64535      35061215
EST115       66461      38609553
EST116       71605      48131581
EST117       75495      28112640
EST118       74710      34623852
EST119       74532      27074118
EST12        77544      30745583
EST120       73663      35495525
EST121       68724      35125321
EST122       72931      41631261
EST123       79440      44225903
EST124       74567      47814438
EST125       67265      41122534
EST126       69458      45380124
EST127       72109      46555780
EST128       70918      44652651
EST129       74279      41496783
EST13        76983      29267115
EST130       74656      46718395
EST131       73716      50408678
EST132       70611      48310825
EST133       79458      38879381
EST134       75815      30473736
EST135       78054      42392724
EST136       78282      41723761
EST137       75939      46730128
EST138       61420      29566851
EST139       71363      36816002
EST14        78759      31927337
EST140       66825      39586005
EST141       68320      36624239
EST142       70723      43688737
EST143       72772      45002333
EST144       67294      38720603
EST145       72031      41184592
EST146       70061      42631207
EST147       62251      39059335
EST148       79327      42976778
EST149       104062     57732949
EST15        74556      31516607
EST150       67689      36715487
EST151       102919     54507779
EST152       115475     61460808
EST153       103793     57866774
EST154       78553      47286833
EST155       99247      55350883
EST156       103041     63791029
EST157       94833      58558590
EST158       88484      47691138
EST159       72672      42344596
EST16        75846      33344451
EST160       64805      31529696
EST161       63744      29100729
EST162       52914      24862209
EST163       67484      32071150
EST164       60413      30808051
EST165       69358      37116721
EST166       69686      49938731
EST167       66729      46434583
EST168       80210      46798884
EST169       57857      29886006
EST17        82116      33864865
EST170       62370      31631167
EST171       66665      39618357
EST172       64690      40088478
EST173       62530      40291816
EST174       95770      46247286
EST175       88901      47148568
EST176       101104     58664178
EST177       103949     60192303
EST178       96888      52289483
EST179       87106      42695760
EST18        80714      32315414
EST180       92572      37769901
EST181       98967      52964265
EST182       92793      37776924
EST183       99811      43904601
EST184       64994      41146169
EST185       68507      39588740
EST186       61192      35873520
EST187       68633      44008930
EST188       69763      29781510
EST189       76695      34475262
EST19        78619      31740188
EST190       68182      42346207
EST191       79594      39330542
EST192       64030      33263513
EST193       68743      49298046
EST194       68700      45770849
EST195       68084      35941412
EST196       68928      44473907
EST197       68735      53107959
EST198       69833      35521367
EST199       70181      41398690
EST2         74644      28643983
EST20        74639      30731961
EST200       69888      60114127
EST201       65203      48164356
EST202       63714      46393517
EST203       63237      46875996
EST204       65210      45376169
EST205       65235      47738723
EST206       63463      45747622
EST207       62411      37455434
EST208       63674      34411625
EST209       64739      37803857
EST21        73968      34331128
EST210       84638      48393304
EST211       83788      54431201
EST212       72387      42247393
EST213       112331     70285783
EST214       115106     69053808
EST215       114091     67892554
EST216       88695      57841850
EST217       114006     60828942
EST218       108063     53340254
EST219       89135      53846587
EST22        74963      30034611
EST220       97342      42681525
EST221       86941      47058892
EST222       71944      46105036
EST223       67131      45110921
EST224       68363      58831303
EST225       69771      57087551
EST226       79591      40079103
EST227       79530      46915908
EST228       73707      52324186
EST229       70464      51400393
EST23        77386      32708730
EST230       38982      18932442
EST231       28002      10659520
EST232       27785      10283362
EST233       26527      9754111
EST234       26793      9016765
EST235       27864      10105393
EST236       27412      9977333
EST237       27399      9885361
EST238       27518      10510670
EST239       27324      12123274
EST24        74773      32808779
EST240       27434      11245023
EST241       27543      10090640
EST242       27837      9333712
EST243       27129      9475805
EST244       28017      11370055
EST245       27910      10969021
EST246       27126      11424717
EST247       26893      12101531
EST248       27290      11310685
EST249       27245      10931666
EST25        74061      31938151
EST250       27234      11870843
EST251       27375      11628574
EST252       27480      10963060
EST253       27470      10953692
EST254       27329      10498834
EST255       27098      12295355
EST256       24569      17200258
EST257       26188      17638076
EST258       61822      26870890
EST259       94278      47697850
EST26        75200      31043524
EST260       44123      29039088
EST261       110381     42317991
EST262       71272      40347272
EST263       68666      44547937
EST264       69369      44540572
EST265       69198      44305509
EST266       66725      39148659
EST267       74218      43160435
EST268       64413      47890982
EST269       65277      34239733
EST27        74401      32418497
EST270       75619      37743423
EST271       101896     47265522
EST272       75844      42540180
EST273       67135      34285854
EST274       67710      32719109
EST275       70267      42132296
EST276       73087      34902326
EST277       68701      33514765
EST278       75173      48090831
EST279       63433      33733696
EST28        107972     51088791
EST280       68039      38788490
EST281       80201      41530219
EST282       76499      43024520
EST283       77031      50736980
EST284       78670      55442470
EST285       109143     48942255
EST286       86012      43301296
EST287       74360      45011947
EST288       73459      41032880
EST289       71572      38148339
EST29        97102      45895594
EST290       70087      27693399
EST291       70657      39580172
EST292       61876      33893925
EST293       63356      42424010
EST294       71992      41139883
EST295       61706      44333163
EST296       62117      32232996
EST297       83253      42996263
EST298       83746      41397730
EST299       75263      48900207
EST3         73730      29915710
EST30        98623      53899956
EST300       104041     57542142
EST301       123226     46853581
EST302       76887      37885494
EST303       67865      35033640
EST304       69175      45965893
EST305       81900      41101949
EST306       71237      41587286
EST307       71450      40903052
EST308       60080      34269384
EST309       59278      36532992
EST31        86674      50524383
EST310       58353      34660719
EST311       70383      48890122
EST312       71325      43546917
EST313       68889      40131719
EST314       69782      36244113
EST315       63943      33543197
EST316       55950      28226289
EST317       54814      29123845
EST318       54975      29445489
EST319       53768      28117600
EST32        65118      40783465
EST320       56270      26922704
EST321       57989      25664127
EST322       57224      23988132
EST323       56695      23271848
EST324       57701      22043864
EST325       57534      23175275
EST326       57845      22885236
EST327       57557      21962517
EST328       57999      20794559
EST329       72139      42647573
EST33        70684      57555398
EST330       77894      35089373
EST331       78454      32072369
EST332       76929      32982723
EST333       85716      46528544
EST334       73233      53429066
EST335       64745      45211035
EST336       96201      59050654
EST337       96768      58496253
EST338       104212     60009270
EST339       104602     56944785
EST34        84694      48505908
EST340       79681      42872046
EST341       70649      39852915
EST342       76985      43261141
EST343       63015      55275483
EST344       63832      46143935
EST345       63555      41044239
EST346       61197      34102689
EST347       73582      51368372
EST348       50520      27758190
EST349       52767      26208672
EST35        85780      42903552
EST350       70928      38385859
EST351       60317      32734667
EST352       62493      31425364
EST353       64447      41473584
EST354       84807      43270207
EST355       70200      41820224
EST356       68180      43823759
EST357       67340      37262716
EST358       63374      41680718
EST359       86852      50244220
EST36        90012      48520040
EST360       84356      50004704
EST361       78502      42719918
EST362       63699      37312305
EST363       65871      34021232
EST364       73761      40472256
EST365       46782      24275020
EST366       67379      38033431
EST367       69096      42398268
EST368       98853      45758349
EST369       74941      45097626
EST37        86723      61644596
EST370       71484      47236105
EST371       71528      46001947
EST372       62726      35770606
EST373       74852      36499632
EST374       82500      37877976
EST375       58047      41141724
EST376       55859      38002118
EST377       63702      37360808
EST378       85946      51987637
EST379       88341      47756354
EST38        77190      50327143
EST380       67701      42516721
EST381       77922      41145007
EST382       54397      35303847
EST383       43804      22540756
EST384       63804      40211652
EST385       82100      42837412
EST386       77449      46475681
EST387       73007      45161502
EST388       78798      46886929
EST389       76799      49148754
EST39        95762      56274935
EST390       88156      62567627
EST391       76944      71226302
EST392       85269      49524062
EST393       84687      58493839
EST394       71972      59984630
EST395       72272      39766834
EST396       61065      40248048
EST397       71616      39795853
EST398       57134      34665879
EST399       71623      31665969
EST4         74560      28391201
EST40        63842      49105433
EST400       79597      25648907
EST401       70509      43516300
EST402       68053      38284560
EST403       67530      35381039
EST404       69648      42806295
EST405       73028      47846408
EST406       66263      43541559
EST407       72292      42469109
EST408       59613      33624999
EST409       66081      39892605
EST41        78073      55308860
EST410       76769      48913588
EST411       82937      48611284
EST412       81461      45846009
EST413       59404      40337764
EST414       55900      40799994
EST415       56835      40014922
EST416       62114      39707121
EST417       75344      48187615
EST418       53076      31554471
EST419       60016      37972586
EST42        100963     48155254
EST420       61774      39769583
EST421       56456      41229274
EST422       60147      41600338
EST423       47530      33483145
EST424       78491      43151178
EST425       78672      39449911
EST426       70559      38868231
EST427       70636      38747622
EST428       70488      39194525
EST429       70491      38935845
EST43        83966      45946644
EST430       70362      39291766
EST431       69901      38765087
EST432       69832      38773642
EST433       69777      39706000
EST434       69695      38771516
EST435       67920      38441832
EST436       70148      38997487
EST437       70275      39260076
EST438       70287      39098292
EST439       70247      38242782
EST44        97907      47408838
EST440       70688      38722551
EST441       70618      38783588
EST442       70562      38769391
EST443       70788      38149088
EST444       79555      43376973
EST445       90571      49787617
EST446       82218      36914794
EST447       106065     60787606
EST448       82728      46260697
EST449       75451      47764191
EST45        98540      49953323
EST450       83332      48670355
EST451       88709      52252485
EST452       96758      60362554
EST453       83468      49441007
EST454       89920      49602743
EST455       87821      48354557
EST456       77403      57572093
EST457       91629      52758040
EST458       77039      52316894
EST459       97614      65124914
EST46        99072      39467830
EST460       96278      67061153
EST461       105897     55581629
EST462       111358     44509997
EST463       65065      40619852
EST464       51502      40320523
EST465       72263      44266952
EST466       61747      37179961
EST467       73078      43229050
EST468       112784     56747225
EST469       77462      47721255
EST47        70163      18814553
EST470       83729      57752590
EST471       50278      29993995
EST472       48004      43459215
EST473       46353      59030899
EST474       71857      55682929
EST475       64962      37982852
EST476       72485      42806488
EST477       71487      42052870
EST478       67172      43718798
EST479       65437      47403101
EST48        70379      18684940
EST480       72265      46993092
EST481       109189     47936701
EST482       91470      48668557
EST483       63433      46644974
EST484       56103      40745418
EST485       56286      38775843
EST486       64802      45631764
EST487       65029      46125214
EST488       63070      46796423
EST489       53257      37126344
EST49        65474      20058402
EST490       51227      38741672
EST491       59770      41836173
EST492       60071      35650618
EST493       71727      44678402
EST494       58759      38783600
EST495       57007      39164257
EST496       62448      46410788
EST497       58381      45708541
EST498       72999      47047228
EST499       49807      39686379
EST5         48193      15292118
EST50        44265      12056155
EST500       57660      40060572
EST501       53656      34176531
EST502       57552      40534907
EST503       55924      35435607
EST504       75351      44785479
EST505       67811      57367649
EST506       69838      50982091
EST507       75588      49889831
EST508       45774      59607209
EST509       56263      49059826
EST51        43874      12147129
EST510       67441      48075937
EST511       58837      39617790
EST512       77564      44549500
EST513       83319      53690860
EST514       82824      52394335
EST515       71821      43099525
EST516       60573      38679188
EST517       72475      49496844
EST518       80384      49484834
EST519       78226      60799364
EST52        43736      11584325
EST520       69600      46625697
EST521       72925      51376975
EST522       68844      46373384
EST523       60757      48826828
EST524       62620      45745152
EST525       78463      43939809
EST526       69695      42579790
EST527       115303     45663425
EST528       113971     49789714
EST529       80687      51715610
EST53        80673      32850965
EST530       50579      49874138
EST531       62793      46251183
EST532       97655      14036505
EST533       99742      10985873
EST534       99134      22710450
EST535       89250      38264452
EST536       86878      31661959
EST537       80888      42656923
EST538       65083      60652613
EST539       91130      55902744
EST54        94167      38578554
EST540       81015      44643124
EST541       67456      43721385
EST542       72120      47327910
EST543       77464      51340465
EST544       86126      51293936
EST545       73084      53401027
EST546       67633      47025844
EST547       71879      55035618
EST548       85397      50928522
EST549       84054      45740322
EST55        97034      43831871
EST550       82617      45475540
EST551       84583      40385643
EST552       83127      45507705
EST553       76330      51803549
EST554       72577      55457972
EST555       74318      51783360
EST556       81768      44394469
EST557       102881     47449493
EST558       111321     48611681
EST559       119270     50373084
EST56        92896      47720348
EST560       132617     59328352
EST561       92029      53702306
EST562       80192      52415993
EST563       80587      23747823
EST564       84290      8748634
EST565       101484     43476912
EST566       116433     57103289
EST567       78009      44258014
EST568       61727      38782552
EST569       74633      47314920
EST57        91637      41934932
EST570       76609      48922507
EST571       71557      43369521
EST572       76486      46279849
EST573       67372      51747027
EST574       85622      54633902
EST575       97537      52559980
EST576       76849      37191802
EST577       64204      42058868
EST578       70893      51546125
EST579       102461     62520932
EST58        109056     57187703
EST580       80330      45993254
EST581       75980      41327334
EST582       93203      18004510
EST583       98496      10593449
EST584       98503      10581700
EST585       80692      38212677
EST586       82656      45907644
EST587       88017      48139776
EST588       68399      49871134
EST589       81141      56492871
EST59        98545      48475187
EST590       90984      53386894
EST591       84581      56897785
EST592       79800      47525176
EST593       84856      48676756
EST594       78052      47303469
EST595       72591      51476656
EST596       59736      37736692
EST597       96580      28758359
EST598       71118      42634195
EST599       50719      33162808
EST6         54905      17436848
EST60        76735      32939627
EST600       51382      32776836
EST601       50395      35836335
EST602       76500      47764184
EST603       65593      47207901
EST604       87096      34828973
EST605       122599     11113868
EST606       118220     14538250
EST607       122492     11276527
EST608       122479     11293426
EST609       72945      42590732
EST61        67374      29818219
EST610       64008      49515080
EST611       75117      48865063
EST612       81242      52975617
EST613       68323      49640801
EST614       72508      43626067
EST615       66697      43100020
EST616       67217      41677698
EST617       97696      30129550
EST618       127287     11710945
EST619       106237     23469037
EST62        72249      31442049
EST620       72518      45943535
EST621       70354      52094639
EST622       81846      45560394
EST623       90496      50485117
EST624       74507      47336037
EST625       65347      33251230
EST626       79541      59528968
EST627       70469      48563523
EST628       106929     46470407
EST629       89300      55219589
EST63        70426      29558419
EST630       61530      47686732
EST631       62214      50477684
EST632       75348      49862447
EST633       79603      41435217
EST634       93922      54685666
EST635       81218      46170417
EST636       81307      42563356
EST637       71487      46909024
EST638       69745      51713243
EST639       90330      42185246
EST64        82076      33388667
EST640       77372      26862840
EST641       77667      24223632
EST642       75525      29436389
EST643       76242      27175730
EST644       76410      28589037
EST645       76141      29740751
EST646       75611      28900250
EST647       76351      27740977
EST648       76717      28957990
EST649       76295      29421151
EST65        74511      29817368
EST650       83170      44122596
EST651       80896      54295625
EST652       81996      59751197
EST653       81927      56080782
EST654       68506      34833375
EST655       61617      39783317
EST656       78697      47391273
EST657       44789      27711402
EST658       45669      36390725
EST659       58834      44897351
EST66        67895      27735432
EST660       58208      44643299
EST661       70587      46473000
EST662       77751      38753996
EST663       66512      43275280
EST664       94884      49595570
EST665       69129      41867548
EST666       65187      43630497
EST667       78043      49555452
EST668       78537      41906444
EST669       62753      39417461
EST67        67673      29744985
EST670       72405      50805111
EST671       70960      46186739
EST672       63087      45038124
EST673       70533      52032384
EST674       75793      45853481
EST675       70891      46180194
EST676       68053      49155956
EST677       73636      57989893
EST678       82241      69331377
EST679       82061      68977054
EST68        76617      36439906
EST680       76816      57413302
EST681       77852      37779620
EST682       68512      31767473
EST683       57393      35621864
EST684       64890      45820831
EST685       63914      41321087
EST686       67233      49575115
EST687       65788      42961172
EST688       58643      38786720
EST689       56192      38914349
EST69        73730      31999987
EST690       63794      42031593
EST691       68985      44863782
EST692       65655      45398300
EST693       65884      45976580
EST694       66338      44632479
EST695       69591      48407517
EST696       71116      58757346
EST697       65123      35859659
EST698       67886      40808763
EST699       67232      45718111
EST7         74531      29353676
EST70        74713      27946794
EST700       58836      37685684
EST701       66482      40159954
EST702       62052      37772885
EST703       68417      42900263
EST704       91094      52957334
EST705       101634     50160280
EST706       64483      38281370
EST707       54484      27415867
EST708       51079      32429682
EST709       55349      35448039
EST71        78372      29350783
EST710       58403      40783432
EST711       59403      38044544
EST712       61574      37897422
EST713       65106      41578832
EST714       56017      34981896
EST715       52551      32666158
EST716       68257      41488699
EST717       82804      42748375
EST718       80952      43379682
EST719       73930      28690794
EST72        78896      36089451
EST720       79639      39677882
EST721       78795      47575913
EST722       84381      51052260
EST723       74126      47520072
EST724       83107      45866367
EST725       57432      38399417
EST726       57745      37654655
EST727       61242      42030723
EST728       59726      39208507
EST729       59871      38843063
EST73        41013      11637622
EST730       62657      41174241
EST731       79381      47364849
EST732       89865      64582477
EST733       83140      44351405
EST734       73871      40219640
EST735       85126      43871961
EST736       90116      57729702
EST737       78093      59736870
EST738       73997      55829524
EST739       32657      19314859
EST74        40865      11295896
EST740       32542      19500137
EST741       32466      19773751
EST742       32795      18801648
EST743       65341      37702552
EST744       58780      34975557
EST745       58622      35366865
EST746       58970      34496169
EST747       65545      28292968
EST748       70982      14766785
EST749       71129      14368189
EST75        40926      12874674
EST750       70897      14908916
EST751       71309      13945963
EST752       70797      15141380
EST753       70861      34481890
EST754       89020      55325684
EST755       70442      48280660
EST756       71752      26942904
EST757       72202      27049739
EST758       73549      26090902
EST759       72018      26143980
EST76        41249      12479962
EST760       77283      26069424
EST761       71455      28957552
EST762       67403      25280536
EST77        41360      12721640
EST78        41138      13085889
EST79        41094      12789589
EST8         75810      30584188
EST80        40893      12251197
EST81        40665      12427604
EST82        41660      12464712
EST83        41663      12447454
EST84        41552      13230588
EST85        41405      13135422
EST86        44089      12546003
EST87        46795      22524087
EST88        43006      24688840
EST89        44103      18150995
EST9         77564      29870697
EST90        50781      23211667
EST91        51856      21478716
EST92        55678      26042356
EST93        89677      52504508
EST94        74933      32391408
EST95        73836      29125486
EST96        72799      30851338
EST97        76461      44529268
EST98        77297      41224622
EST99        75906      40081456
GSS1         90430      38662943
GSS10        74787      43607320
GSS100       80700      52986388
GSS101       74643      42476821
GSS102       73344      45758012
GSS103       73675      44924822
GSS104       73312      45571000
GSS105       73285      44771114
GSS106       75160      45685715
GSS107       81112      54360072
GSS108       83721      55541554
GSS109       80644      52886890
GSS11        70802      35983221
GSS110       82892      50228457
GSS111       84107      56519862
GSS112       79973      60846560
GSS113       90479      45928631
GSS114       90305      54158170
GSS115       74497      49731626
GSS116       88867      64483432
GSS117       82283      59525077
GSS118       75683      40992326
GSS119       81577      51559706
GSS12        73150      38495437
GSS120       95457      53312113
GSS121       84363      55617830
GSS122       84986      54716318
GSS123       82152      55248187
GSS124       76269      69393692
GSS125       76058      67097058
GSS126       79550      55612127
GSS127       72448      50209219
GSS128       72516      50071160
GSS129       73104      49091043
GSS13        76795      38906116
GSS130       72212      50636620
GSS131       73969      50198952
GSS132       84029      59934337
GSS133       80939      58571340
GSS134       69588      56089138
GSS135       71074      55294116
GSS136       75865      67791090
GSS137       75633      62681288
GSS138       77272      52414676
GSS139       86109      53641731
GSS14        71379      32114760
GSS140       94681      58088361
GSS141       93212      60013781
GSS142       81955      53757582
GSS143       89058      51052670
GSS144       73540      58576714
GSS145       114887     59690272
GSS146       110449     58535647
GSS147       86655      63416067
GSS148       53216      30401901
GSS149       67510      47849670
GSS15        70493      35055254
GSS150       72997      55893522
GSS151       72979      55923824
GSS152       72998      55892561
GSS153       73014      55864261
GSS154       72973      55935287
GSS155       72979      55924564
GSS156       75749      57729272
GSS157       83717      39291969
GSS158       88245      60143741
GSS159       86243      65371130
GSS16        78213      46093569
GSS160       88627      59283782
GSS161       91852      57052063
GSS162       83304      57868868
GSS163       75760      49071980
GSS164       75935      48772421
GSS165       92708      58649546
GSS166       88866      59688092
GSS167       86025      61517965
GSS168       103301     25411297
GSS169       102573     30070088
GSS17        70895      33315071
GSS170       78834      46724544
GSS171       80681      52772284
GSS172       54184      39212125
GSS173       52939      41236326
GSS174       61827      51347678
GSS175       59031      45452209
GSS176       57750      48398835
GSS177       57490      48792974
GSS178       58200      46566886
GSS179       58396      45982966
GSS18        58792      27918452
GSS180       58897      48102792
GSS181       58949      48419623
GSS182       58614      49456462
GSS183       58238      48405141
GSS184       58635      46087100
GSS185       58751      49388131
GSS186       60112      50295281
GSS187       60298      49791431
GSS188       60509      49159122
GSS189       60397      49494368
GSS19        56814      29015258
GSS190       60504      49173751
GSS191       60038      46907252
GSS192       59176      45278192
GSS193       58423      47650979
GSS194       58939      46037382
GSS195       58864      46272710
GSS196       58315      47992308
GSS197       58241      48223604
GSS198       58226      48429613
GSS199       60127      50008343
GSS2         89000      39334171
GSS20        57683      26671178
GSS200       59844      50860772
GSS201       59843      49441152
GSS202       60660      45799785
GSS203       60282      46972788
GSS204       59414      49654477
GSS205       59525      49316252
GSS206       59550      49241301
GSS207       59460      49515157
GSS208       59584      49137663
GSS209       59519      49334989
GSS21        61510      29536897
GSS210       59723      48713434
GSS211       59643      48959780
GSS212       59855      48311125
GSS213       58866      46148860
GSS214       58871      45984934
GSS215       58392      47631899
GSS216       58243      48157444
GSS217       58742      46240023
GSS218       57873      48042855
GSS219       64405      54263649
GSS22        64657      37608795
GSS220       64818      54767216
GSS221       90289      58835542
GSS222       83890      44421283
GSS223       78161      60667629
GSS224       84480      53821335
GSS225       91285      49694378
GSS226       75320      52058769
GSS227       71265      47120651
GSS228       71250      47156734
GSS229       96974      51450278
GSS23        57533      27069354
GSS230       99596      65018282
GSS231       90788      56949940
GSS232       95822      62944362
GSS233       95708      63087865
GSS234       96052      62663286
GSS235       94747      64131707
GSS236       95263      63418742
GSS237       92390      66996380
GSS238       94204      64745110
GSS239       94897      63873296
GSS24        66342      42114517
GSS240       92263      67158502
GSS241       93151      66051587
GSS242       94679      64153822
GSS243       91341      68648866
GSS244       94659      64798004
GSS245       89894      70057107
GSS246       85775      65424982
GSS247       44911      33629702
GSS248       87184      64446495
GSS249       83576      62756836
GSS25        67961      28174863
GSS250       103565     48487567
GSS251       68487      58452386
GSS252       68305      58780224
GSS253       69369      56628175
GSS254       69627      56126135
GSS255       70559      56034412
GSS256       76223      57617228
GSS257       75916      58210084
GSS258       87238      74899217
GSS259       81587      44434075
GSS26        58158      25404796
GSS260       92217      44635655
GSS261       84640      64736433
GSS262       71239      59054443
GSS263       69697      58673228
GSS264       65128      62492372
GSS265       73098      48811677
GSS266       86703      34731429
GSS267       112990     71341855
GSS268       96511      74565346
GSS269       92178      46259678
GSS27        65554      32027989
GSS270       109371     61539875
GSS271       120651     73180044
GSS272       117135     76147498
GSS273       103985     54987581
GSS274       82742      54666483
GSS275       95627      61125525
GSS276       107314     78650187
GSS277       108106     77812872
GSS278       106102     79983316
GSS279       104023     80029779
GSS28        65216      32514250
GSS280       76700      51240876
GSS281       109572     66442514
GSS282       109962     66304167
GSS283       104228     57934401
GSS284       68448      37538673
GSS285       78632      43509832
GSS286       75986      43310262
GSS287       105836     60318290
GSS288       92453      46450532
GSS289       101936     59583700
GSS29        77652      39788992
GSS290       114432     45477964
GSS291       116819     39727252
GSS292       98910      70068904
GSS293       95371      64166692
GSS294       95892      36542567
GSS295       95418      37268886
GSS296       96672      35161976
GSS297       94286      39168339
GSS298       101639     58186894
GSS299       94807      61168275
GSS3         87422      41844005
GSS30        82681      39696428
GSS300       94592      61132827
GSS301       95303      60106496
GSS302       87141      63544777
GSS303       83786      28453498
GSS304       84356      27350762
GSS305       85365      25360755
GSS306       28195      13296242
GSS31        74189      40416268
GSS32        70423      48221181
GSS33        79836      37788948
GSS34        75880      40335657
GSS35        74160      39904352
GSS36        87438      56459406
GSS37        87595      58177130
GSS38        85539      44928326
GSS39        86658      50308088
GSS4         79227      41150659
GSS40        86430      39784567
GSS41        83085      32240682
GSS42        81250      56927812
GSS43        80078      57990401
GSS44        72015      47525025
GSS45        72046      47412666
GSS46        77605      45677826
GSS47        77849      38797135
GSS48        83220      58005156
GSS49        86562      64828067
GSS5         78819      40567994
GSS50        81678      54317110
GSS51        93826      59328143
GSS52        88475      58772896
GSS53        76480      42036837
GSS54        72967      40705083
GSS55        86422      46909379
GSS56        88058      58563061
GSS57        76130      63968913
GSS58        70801      78004627
GSS59        85626      68955920
GSS6         78088      38842501
GSS60        89445      60067449
GSS61        63439      44860135
GSS62        66154      45425855
GSS63        89653      67227351
GSS64        84948      58382594
GSS65        86087      52984289
GSS66        85460      55665378
GSS67        93406      57830853
GSS68        97850      52547586
GSS69        97521      52983377
GSS7         77657      39174963
GSS70        98229      52046735
GSS71        99189      50772994
GSS72        99223      50728001
GSS73        99077      50923754
GSS74        99665      50142719
GSS75        97777      52642563
GSS76        91831      64743636
GSS77        89866      70739341
GSS78        88913      70107284
GSS79        87855      69638323
GSS8         75881      38134490
GSS80        87890      63944267
GSS81        88239      44628846
GSS82        78265      23302669
GSS83        78152      23566962
GSS84        84035      49203901
GSS85        77224      45333917
GSS86        88924      56137954
GSS87        84315      58640224
GSS88        75422      75718342
GSS89        78486      72974163
GSS9         72240      37167492
GSS90        84075      46680544
GSS91        85139      49478912
GSS92        75286      41387465
GSS93        79813      56497580
GSS94        76854      56728523
GSS95        82337      53198692
GSS96        83692      58804524
GSS97        85528      57668250
GSS98        87290      52278928
GSS99        82170      66917174
HTC1         24998      26954535
HTC10        65256      85976928
HTC11        66998      61009091
HTC12        69469      70263261
HTC13        12040      7552437
HTC2         15993      36013431
HTC3         15970      36547861
HTC4         16191      35357336
HTC5         15927      40313070
HTC6         16010      37271080
HTC7         51463      28046115
HTC8         80339      61968762
HTC9         73824      69577475
HTG1         1318       188929277
HTG10        1300       186477873
HTG100       1320       191168390
HTG101       1214       190176970
HTG102       1092       190018848
HTG103       1296       189976061
HTG104       1073       188004673
HTG105       1445       189573730
HTG106       1235       190022187
HTG107       1003       189691793
HTG108       814        173322191
HTG109       1062       193654866
HTG11        1452       184100451
HTG110       1088       193423561
HTG111       1042       189315130
HTG112       1078       191985988
HTG113       1130       191928071
HTG114       1120       192410998
HTG115       1143       192638062
HTG116       1210       192431924
HTG117       1244       191833703
HTG118       1200       191754005
HTG119       1254       191213761
HTG12        876        192056419
HTG120       357        37705043
HTG13        750        192437652
HTG14        744        192158023
HTG15        782        192230176
HTG16        803        192009637
HTG17        769        192283132
HTG18        2064       171033537
HTG19        1071       187903257
HTG2         2465       186071856
HTG20        963        189548030
HTG21        784        191909290
HTG22        923        190306412
HTG23        902        190717511
HTG24        811        191592140
HTG25        776        192067539
HTG26        868        191479631
HTG27        889        190824411
HTG28        946        190172111
HTG29        899        191050856
HTG3         2517       185290576
HTG30        927        190341026
HTG31        871        191395263
HTG32        966        189711739
HTG33        883        191133821
HTG34        862        191459235
HTG35        822        191882341
HTG36        946        190165839
HTG37        931        190843675
HTG38        936        190384520
HTG39        1042       189423761
HTG4         2553       188532563
HTG40        1206       186876762
HTG41        1260       188130356
HTG42        1175       188026307
HTG43        1153       188184187
HTG44        1119       191420899
HTG45        1274       190790953
HTG46        1177       191252803
HTG47        1134       191423493
HTG48        1040       191597494
HTG49        1019       189848294
HTG5         1284       185715991
HTG50        1127       190383730
HTG51        971        190299724
HTG52        1110       190345610
HTG53        1047       190452500
HTG54        1016       190035900
HTG55        969        189377307
HTG56        1023       189638300
HTG57        1025       190014190
HTG58        1052       188299817
HTG59        1110       188022804
HTG6         1274       185234665
HTG60        1135       189450719
HTG61        1089       189889158
HTG62        1071       189725708
HTG63        1174       189114234
HTG64        1173       187663471
HTG65        1288       184620446
HTG66        1231       185375419
HTG67        1237       184701930
HTG68        1248       184653564
HTG69        1200       187454311
HTG7         1277       185414872
HTG70        1125       189153833
HTG71        1119       188454488
HTG72        1103       191093967
HTG73        1137       191031874
HTG74        1221       191256930
HTG75        1115       190571611
HTG76        1181       190700276
HTG77        1121       190315991
HTG78        1203       190287752
HTG79        1137       190220371
HTG8         1459       184762119
HTG80        1113       190306026
HTG81        1231       188834779
HTG82        1277       187876076
HTG83        1150       190544599
HTG84        1167       190264118
HTG85        1125       190722336
HTG86        1218       190654228
HTG87        1148       191113823
HTG88        1179       191453814
HTG89        1131       191990683
HTG9         1200       186999351
HTG90        1187       192004907
HTG91        1100       191880090
HTG92        1197       192021328
HTG93        1077       190182465
HTG94        1088       189950166
HTG95        1015       189951355
HTG96        1035       190028946
HTG97        994        189716213
HTG98        1008       189729678
HTG99        982        189621779
INV1         84740      64161466
INV10        85200      66812266
INV11        86584      65434641
INV12        57441      90499073
INV13        2738       35811610
INV2         1506       186424679
INV3         790        167041062
INV4         50765      97271065
INV5         70821      81297570
INV6         23043      128331445
INV7         71584      74090113
INV8         77454      71564458
INV9         65924      83327494
MAM1         12458      166319267
MAM2         66123      90685840
MAM3         35742      123420229
MAM4         51594      47469509
PAT1         222610     70141260
PAT10        125442     99515062
PAT11        141738     62609680
PAT12        105794     59943621
PAT13        103555     50226633
PAT14        121471     53274919
PAT15        113046     61290522
PAT16        145018     54899409
PAT17        155519     69891391
PAT18        97490      122598443
PAT19        147595     87376862
PAT2         194518     84655123
PAT20        117408     104542101
PAT21        123717     103465007
PAT22        119286     106149134
PAT23        146234     86276481
PAT24        175260     64171427
PAT25        140517     61008125
PAT26        100420     79560422
PAT27        108697     70803288
PAT28        111347     66582863
PAT29        113599     67362592
PAT3         171984     95898893
PAT30        129236     68268266
PAT31        111310     78154097
PAT32        138112     29117385
PAT33        158493     24106566
PAT34        114729     48995749
PAT35        89551      87425403
PAT36        136214     100154123
PAT37        159279     101006643
PAT38        124693     122946139
PAT39        174828     89326200
PAT4         153750     106059356
PAT40        113497     129648415
PAT41        27632      180874595
PAT42        185412     93064780
PAT43        274593     6864825
PAT44        305893     8737479
PAT45        299628     30663237
PAT46        101597     48927614
PAT5         184018     85619906
PAT6         156356     93378118
PAT7         152399     81703403
PAT8         104673     119399316
PAT9         143539     89230831
PHG          3850       29750043
PLN1         58275      94961237
PLN10        20466      125761789
PLN11        17605      145150273
PLN12        17681      146581295
PLN13        17607      146693644
PLN14        22358      139795487
PLN15        1255       165552817
PLN16        1206       164015892
PLN17        19         181875765
PLN18        7          190147207
PLN19        39903      107550218
PLN2         1492       166359642
PLN20        76328      77138210
PLN21        77313      76850166
PLN22        51288      94980444
PLN23        14001      139965656
PLN24        35895      118227442
PLN25        78670      75592796
PLN26        99118      59411540
PLN27        77722      71693767
PLN28        79150      76847969
PLN29        77938      75832068
PLN3         1574       182833131
PLN30        28605      52248481
PLN4         1995       191719060
PLN5         35432      123142989
PLN6         75930      78740879
PLN7         75160      71376532
PLN8         31087      51284979
PLN9         27516      102616523
PRI1         33534      117131189
PRI10        1453       182636149
PRI11        1279       179349103
PRI12        1453       177964555
PRI13        1590       180241605
PRI14        1602       182142647
PRI15        1275       191950767
PRI16        1137       193836406
PRI17        1101       194347633
PRI18        1199       193575883
PRI19        8118       178900363
PRI2         1641       172599702
PRI20        46461      115670816
PRI21        61519      78424700
PRI22        31547      99698222
PRI23        2634       178482963
PRI24        2077       182264935
PRI25        1634       183006529
PRI26        2053       182456509
PRI27        2123       180103570
PRI28        12814      160004381
PRI29        8360       163362316
PRI3         1306       183556099
PRI30        57595      89349035
PRI31        32767      64937747
PRI32        19080      125624500
PRI33        20797      144670041
PRI34        68294      83493200
PRI35        64536      85843958
PRI36        30032      57035934
PRI4         1349       185561228
PRI5         1195       181186310
PRI6         1188       179183875
PRI7         1232       181021971
PRI8         1323       176571278
PRI9         1242       174654956
ROD1         29370      146080304
ROD10        976        181452610
ROD11        1037       185938760
ROD12        943        183051541
ROD13        1038       189479067
ROD14        952        180504980
ROD15        966        181941874
ROD16        1000       186084246
ROD17        10628      174288877
ROD18        26465      141205483
ROD19        1132       183058092
ROD2         911        174945476
ROD20        1184       184293692
ROD21        13975      163394567
ROD22        38533      70528780
ROD23        19355      116026533
ROD24        1814       189605079
ROD25        153423     19683112
ROD26        44385      50705764
ROD3         913        173662974
ROD4         903        174022951
ROD5         929        174225203
ROD6         983        179530200
ROD7         957        179813584
ROD8         994        182385252
ROD9         1003       182407283
STS1         84844      36529627
STS10        57841      44812491
STS11        57925      43638168
STS12        64591      43001803
STS13        88615      38408361
STS14        81147      35399727
STS2         84165      48236598
STS3         69728      27431057
STS4         78848      37497682
STS5         54788      32164909
STS6         54863      31907576
STS7         54669      32203229
STS8         55701      35698132
STS9         57887      44483446
SYN1         47470      71418834
SYN2         29245      39471564
TSA          2886       2546788
UNA          214        116246
VRL1         72146      66252224
VRL10        2464       1135757
VRL2         70522      64519814
VRL3         72569      63678593
VRL4         68829      69310786
VRL5         54367      73772208
VRL6         62488      72690424
VRL7         68207      66865933
VRL8         57091      72877777
VRL9         68553      72442860
VRT1         23636      155233932
VRT10        11261      176085848
VRT11        13332      171626663
VRT12        5290       184278638
VRT13        4141       187477666
VRT14        79683      69329315
VRT15        79708      67173661
VRT16        30997      28320602
VRT2         45273      126870866
VRT3         28486      143838410
VRT4         55807      103642550
VRT5         60909      66317570
VRT6         32081      71299801
VRT7         1167       191385937
VRT8         1277       190559463
VRT9         1334       189730569

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 167.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:

Entries        Bases   Species

11535248 13124444947   Homo sapiens
7252378   8358715455   Mus musculus
1642662   5991517925   Rattus norvegicus
2086180   5228482576   Bos taurus
3188970   4578968522   Zea mays
2126845   3141652150   Sus scrofa
1588532   2932513510   Danio rerio
1205445   1533452587   Oryza sativa Japonica Group
227973    1352646211   Strongylocentrotus purpuratus
1673014   1142506965   Nicotiana tabacum
1410967   1044923875   Xenopus (Silurana) tropicalis
212933     996033334   Pan troglodytes
779849     911708853   Drosophila melanogaster
2210667    911688499   Arabidopsis thaliana
650352     905008645   Vitis vinifera
803827     869211632   Gallus gallus
76854      802815723   Macaca mulatta
1215317    748029713   Ciona intestinalis
1223247    706524422   Canis lupus familiaris
1111132    667180484   Triticum aestivum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          August 15 2008

                NCBI-GenBank Flat File Release 167.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 PROJECT Format

  This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
PROJECT     GenomeProject:18787

  A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second 
contains the actual project identifier ("18787").

  PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 167.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
	Andrea Gocke, Anjanette Johnston, Mark Landree,	Richard McVeigh,
	Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
	Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev

User Support
	Medha Bhagwat, Peter Cooper, Wayne Matten, Scott McGinnis, Monica Romiti,
	Eric Sayers, Tao Tao, Majda Valjavec-Gratian, David Wheeler

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center